Psyllid ID: psy17672

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------32
MDVEQFRLICQDECGIDATDMILLNNGKHLLEDGSCLKQAGVRDGDIILVAMPGRGPTYHVAQSRHTAPHRSFMTAQLQDPAHVRDLLLACPDQLALLKQNNPRLSEALSTGKDAFTKVFKEQLVEREKRQKQKIKLMNAHPFDTHAQRLIAEEIRQKNVEANMEAAMEYNPETFGSVVMLYINCKVNGYPVKAFVDSGAQTTIMSAKCAERCNIMRLIDTRWAGVAKGVGVQQIIGRIHMVQVAIEKDFLTTSLSILEEQPMDMLLGLDMLRRHECCIDLRKNVLRIGTTGTETKFLPERELPSCARLTSASDEEEYF
ccHHHHHHHHHHHHcccccccEEEEccEEcccccccccccccccccEEEEEcccccccccccccccccccccccccccccHHHHHHHHHccHHHHHHHHHccccHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEEEEccEEEEEEEccccccccccHHHHHHcccccccccccccEEcccccEEEEEEEEEEEEEEccEEEEEEEEEcccccccccccHHHHHHccEEEEccccEEEEcccccEEEccccccccccccccccccccccc
ccHHHHHHHHHHHccccHHcEEEEEcccccccccccHHHcccccccEEEEEEccccccccccccccccccccccccccccHHHHHHHHHccHHHHHHHHHHcHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHcEEEEEEEEEEEEcccEEEEEEcccccHEEccHHHHHHcccHHHHHHHHcccEEcccccEEEEEEEEEEEEEcccccccEEEEEccccccEEEHHHHHHHccEEEEccccEEEEcccccEEccccHHHcHHHHHHHccccHHHHc
MDVEQFRLICQdecgidatDMILLNNgkhlledgsclkqagvrdgdiilvampgrgptyhvaqsrhtaphrsfmtaqlqdpAHVRDLLLACPDQLALLKQNNPRLSEALSTGKDAFTKVFKEQLVEREKRQKQKIKlmnahpfdtHAQRLIAEEIRQKNVEANMEAAMEYNPETFGSVVMLYINCKvngypvkafvdsgaqTTIMSAKCAERCNIMRLIDTRWAGVAKGVGVQQIIGRIHMVQVAIEKDFLTTSLSILEEQPMDMLLGLDMLRRHECCIDLRKNVLrigttgtetkflperelpscarltsasdeeeyf
MDVEQFRLICQDECGIDATDMILLNNGKHLLEDGSCLKQAGVRDGDIILVAMPGRGPTYHVAQSRHTAPHRSFMTAQLQDPAHVRDLLLACPDQLALLKQNNPRLSEALSTGKDAFTKVFKEQLVEREKRQKQkiklmnahpfdthAQRLIAEEIRQKNVEANMEAAMEYNPETFGSVVMLYINCKVNGYPVKAFVDSGAQTTIMSAKCAERCNIMRLIDTRWAGVAKGVGVQQIIGRIHMVQVAIEKDFLTTSLSILEEQPMDMLLGLDMLRRHECCIDLRknvlrigttgtetkflperelpscarltsasdeeeyf
MDVEQFRLICQDECGIDATDMILLNNGKHLLEDGSCLKQAGVRDGDIILVAMPGRGPTYHVAQSRHTAPHRSFMTAQLQDPAHVRdlllacpdqlallKQNNPRLSEALSTGKDAFTKVFKEQLVEREKRQKQKIKLMNAHPFDTHAQRLIAEEIRQKNVEANMEAAMEYNPETFGSVVMLYINCKVNGYPVKAFVDSGAQTTIMSAKCAERCNIMRLIDTRWAGVAKGVGVQQIIGRIHMVQVAIEKDFLTTSLSILEEQPmdmllgldmlRRHECCIDLRKNVLRIGTTGTETKFLPERELPSCARLTSASDEEEYF
****QFRLICQDECGIDATDMILLNNGKHLLEDGSCLKQAGVRDGDIILVAMPGRGPTYHVA**********FMTAQLQDPAHVRDLLLACPDQLALLK****************FTKVF*************************HAQRLIAEEI*********EAAMEYNPETFGSVVMLYINCKVNGYPVKAFVDSGAQTTIMSAKCAERCNIMRLIDTRWAGVAKGVGVQQIIGRIHMVQVAIEKDFLTTSLSILEEQPMDMLLGLDMLRRHECCIDLRKNVLRIGTTGTETKFL*********************
MDVEQFRLICQDECGIDATDMILLNNGKHLLEDGSCLKQAGVRDGDIILVAM*********************************DLLLACPDQLAL*KQ********************************************THAQRLIAEEIRQKNVEANMEAAMEYNPETFGSVVMLYINCKVNGYPVKAFVDSGAQTTIMSAKCAERCNIMRLI***************IIGRIHMVQVAIEKDFLTTSLSILEEQPMDMLLGLDMLRRHECCIDLRKNVLRIGTTGTETKFLP********************
MDVEQFRLICQDECGIDATDMILLNNGKHLLEDGSCLKQAGVRDGDIILVAMPGRGPTYHVAQSRHTAPHRSFMTAQLQDPAHVRDLLLACPDQLALLKQNNPRLSEALSTGKDAFTKVFKEQLVEREKRQKQKIKLMNAHPFDTHAQRLIAEEIRQKNVEANMEAAMEYNPETFGSVVMLYINCKVNGYPVKAFVDSGAQTTIMSAKCAERCNIMRLIDTRWAGVAKGVGVQQIIGRIHMVQVAIEKDFLTTSLSILEEQPMDMLLGLDMLRRHECCIDLRKNVLRIGTTGTETKFLPERELPSCARL**********
MDVEQFRLICQDECGIDATDMILLNNGKHLLEDGSCLKQAGVRDGDIILVAMPG**********************QLQDPAHVRDLLLACPDQLALLKQNNPRLSEALSTGKDAFTKVFKEQLVEREKRQKQKIKLMNAHPFDTHAQRLIAEEIRQKNVEANMEAAMEYNPETFGSVVMLYINCKVNGYPVKAFVDSGAQTTIMSAKCAERCNIMRLIDTRWAGVAKGVGVQQIIGRIHMVQVAIEKDFLTTSLSILEEQPMDMLLGLDMLRRHECCIDLRKNVLRIGTTGTETKFLPERELPSCARLTSAS******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVEQFRLICQDECGIDATDMILLNNGKHLLEDGSCLKQAGVRDGDIILVAMPGRGPTYHVAQSRHTAPHRSFMTAQLQDPAHVRDLLLACPDQLALLKQNNPRLSEALSTGKDAFTKVFKEQLVEREKRQKQKIKLMNAHPFDTHAQRLIAEEIRQKNVEANMEAAMEYNPETFGSVVMLYINCKVNGYPVKAFVDSGAQTTIMSAKCAERCNIMRLIDTRWAGVAKGVGVQQIIGRIHMVQVAIEKDFLTTSLSILEEQPMDMLLGLDMLRRHECCIDLRKNVLRIGTTGTETKFLPERELPSCARLTSASDEEEYF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query319 2.2.26 [Sep-21-2011]
Q7ZYA7393 Protein DDI1 homolog 2 OS N/A N/A 0.993 0.806 0.529 6e-95
Q5TDH0399 Protein DDI1 homolog 2 OS yes N/A 0.987 0.789 0.508 2e-94
Q497D6394 Protein DDI1 homolog 2 OS yes N/A 0.993 0.804 0.524 3e-94
A2ADY9399 Protein DDI1 homolog 2 OS yes N/A 0.993 0.794 0.5 6e-94
Q6TH22411 Protein DDI1 homolog 2 OS yes N/A 0.993 0.771 0.502 9e-93
Q2T9Z1396 Protein DDI1 homolog 1 OS no N/A 0.993 0.800 0.494 5e-91
Q8WTU0396 Protein DDI1 homolog 1 OS no N/A 0.987 0.795 0.488 2e-90
Q95JI3396 Protein DDI1 homolog 1 OS N/A N/A 0.987 0.795 0.480 7e-89
A0JPP7408 Protein DDI1 homolog 1 OS yes N/A 0.993 0.776 0.475 8e-89
Q9DAF3408 Protein DDI1 homolog 1 OS no N/A 0.993 0.776 0.475 2e-88
>sp|Q7ZYA7|DDI2_XENLA Protein DDI1 homolog 2 OS=Xenopus laevis GN=ddi2 PE=2 SV=1 Back     alignment and function desciption
 Score =  347 bits (891), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 181/342 (52%), Positives = 229/342 (66%), Gaps = 25/342 (7%)

Query: 1   MDVEQFRLICQDECGIDATDMILLNNGKHLLEDGSCLKQAGVRDGDIIL----------- 49
            ++E FR +C+ E GI A+D +++   + L ++   L   G++DGD+++           
Sbjct: 25  FELENFRALCELESGIPASDTLIVYAERPLTDNQRSLASYGLKDGDVVILRQKEAPETRP 84

Query: 50  -----------VAMPGRGPTYHVAQSRHTAPHR--SFMTAQLQDPAHVRDLLLACPDQLA 96
                      +A+PG       +Q +   P    S     L +PA +R +LLA P +L+
Sbjct: 85  AAPFPGLDFSTIAVPGASSQPDPSQPQAPPPPPDTSSFPQGLDNPALLRQMLLANPHELS 144

Query: 97  LLKQNNPRLSEALSTGK-DAFTKVFKEQLVEREKRQKQKIKLMNAHPFDTHAQRLIAEEI 155
           LLK+ NP L+EAL +G  + FTKV +EQ  ER +R++++I+L +A PFD  AQ  I E+I
Sbjct: 145 LLKERNPPLAEALLSGDLEKFTKVLQEQQQERARREQERIRLYSADPFDLDAQAKIEEDI 204

Query: 156 RQKNVEANMEAAMEYNPETFGSVVMLYINCKVNGYPVKAFVDSGAQTTIMSAKCAERCNI 215
           RQ N+E NM  AME  PE+FG VVMLYINCKVNGYPVKAFVDSGAQ TIMS  CAERC+I
Sbjct: 205 RQHNIEENMTIAMEEAPESFGQVVMLYINCKVNGYPVKAFVDSGAQMTIMSQACAERCHI 264

Query: 216 MRLIDTRWAGVAKGVGVQQIIGRIHMVQVAIEKDFLTTSLSILEEQPMDMLLGLDMLRRH 275
           MRL+D RWAG+AKGVG Q+IIGR+H+ QV IE DFL  S SILEEQPMDMLLGLDML+RH
Sbjct: 265 MRLVDRRWAGIAKGVGTQKIIGRVHLAQVQIEGDFLPCSFSILEEQPMDMLLGLDMLKRH 324

Query: 276 ECCIDLRKNVLRIGTTGTETKFLPERELPSCARLTSASDEEE 317
           +C IDL KNVL IGTTGT T FLPE ELP CARL      EE
Sbjct: 325 QCSIDLEKNVLVIGTTGTHTTFLPEGELPECARLAYGPGREE 366

Xenopus laevis (taxid: 8355)
>sp|Q5TDH0|DDI2_HUMAN Protein DDI1 homolog 2 OS=Homo sapiens GN=DDI2 PE=1 SV=1 Back     alignment and function description
>sp|Q497D6|DDI2_XENTR Protein DDI1 homolog 2 OS=Xenopus tropicalis GN=ddi2 PE=2 SV=1 Back     alignment and function description
>sp|A2ADY9|DDI2_MOUSE Protein DDI1 homolog 2 OS=Mus musculus GN=Ddi2 PE=1 SV=1 Back     alignment and function description
>sp|Q6TH22|DDI2_DANRE Protein DDI1 homolog 2 OS=Danio rerio GN=ddi2 PE=2 SV=1 Back     alignment and function description
>sp|Q2T9Z1|DDI1_BOVIN Protein DDI1 homolog 1 OS=Bos taurus GN=DDI1 PE=2 SV=1 Back     alignment and function description
>sp|Q8WTU0|DDI1_HUMAN Protein DDI1 homolog 1 OS=Homo sapiens GN=DDI1 PE=1 SV=1 Back     alignment and function description
>sp|Q95JI3|DDI1_MACFA Protein DDI1 homolog 1 OS=Macaca fascicularis GN=DDI1 PE=2 SV=1 Back     alignment and function description
>sp|A0JPP7|DDI1_RAT Protein DDI1 homolog 1 OS=Rattus norvegicus GN=Ddi1 PE=2 SV=1 Back     alignment and function description
>sp|Q9DAF3|DDI1_MOUSE Protein DDI1 homolog 1 OS=Mus musculus GN=Ddi1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query319
328724599 453 PREDICTED: protein DDI1 homolog 2-like i 0.974 0.686 0.615 1e-117
328724597 434 PREDICTED: protein DDI1 homolog 2-like i 0.974 0.716 0.615 1e-117
270007166 448 hypothetical protein TcasGA2_TC013702 [T 0.990 0.705 0.597 1e-116
357605437 460 DNA-damage inducible protein [Danaus ple 0.990 0.686 0.599 1e-115
189237227 452 PREDICTED: similar to DNA-damage inducib 0.990 0.699 0.602 1e-115
114051417389 DNA-damage inducible protein [Bombyx mor 0.990 0.812 0.610 1e-115
307188581 456 Protein DDI1-like protein 2 [Camponotus 0.987 0.690 0.6 1e-114
332374366399 unknown [Dendroctonus ponderosae] 0.981 0.784 0.595 1e-114
322799330 459 hypothetical protein SINV_11449 [Solenop 0.987 0.686 0.598 1e-113
307191967399 Protein DDI1-like protein 2 [Harpegnatho 0.987 0.789 0.591 1e-113
>gi|328724599|ref|XP_003248194.1| PREDICTED: protein DDI1 homolog 2-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  427 bits (1097), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 205/333 (61%), Positives = 255/333 (76%), Gaps = 22/333 (6%)

Query: 6   FRLICQDECGIDATDMILLNNGKHLLEDGSCLKQAGVRDGDIILV--------------A 51
           F+ +C+ E GI + +  L +NG+ L++D S +K  GVR+GD+I++              +
Sbjct: 26  FKALCEVETGIPSQETGLTHNGQLLVDDFSTMKNLGVREGDVIIIQRVASSATAMDHSFS 85

Query: 52  MPGRGPTYHVAQSRHTAPHRSFMTA-------QLQDPAHVRDLLLACPDQLALLKQNNPR 104
            P          SR   P  S           Q+QD  +VR+L L+ P+QLALLKQNNPR
Sbjct: 86  SPSNNMLPQFDFSRIQVPGSSNSNNPGTNRQHQMQDAEYVRNLFLSSPEQLALLKQNNPR 145

Query: 105 LSEALSTGK-DAFTKVFKEQLVEREKRQKQKIKLMNAHPFDTHAQRLIAEEIRQKNVEAN 163
           L++ALS+ K + F+KV  EQ+ ER+KR+ Q+I++M AHPFD+ AQ+LIAEEIRQKN+EAN
Sbjct: 146 LADALSSNKIEEFSKVMAEQMEERKKREDQRIRMMKAHPFDSEAQKLIAEEIRQKNIEAN 205

Query: 164 MEAAMEYNPETFGSVVMLYINCKVNGYPVKAFVDSGAQTTIMSAKCAERCNIMRLIDTRW 223
           MEAAMEYNPE FG+VVMLYINCKV+GYPVKAF+DSGAQTTIMS+ CAERCNIMRL+D+RW
Sbjct: 206 MEAAMEYNPEMFGTVVMLYINCKVDGYPVKAFIDSGAQTTIMSSACAERCNIMRLVDSRW 265

Query: 224 AGVAKGVGVQQIIGRIHMVQVAIEKDFLTTSLSILEEQPMDMLLGLDMLRRHECCIDLRK 283
           AG+AKGVGVQ+IIGRIHMVQVAIE DFLTTS S+LE+QPMDMLLGLDML+RH+CCIDL  
Sbjct: 266 AGLAKGVGVQKIIGRIHMVQVAIENDFLTTSFSVLEDQPMDMLLGLDMLKRHQCCIDLEH 325

Query: 284 NVLRIGTTGTETKFLPERELPSCARLTSASDEE 316
           NVL+IGTTGTET FLPE ELP C RLT++SD +
Sbjct: 326 NVLKIGTTGTETPFLPENELPDCGRLTTSSDHD 358

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328724597|ref|XP_001948469.2| PREDICTED: protein DDI1 homolog 2-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|270007166|gb|EFA03614.1| hypothetical protein TcasGA2_TC013702 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357605437|gb|EHJ64625.1| DNA-damage inducible protein [Danaus plexippus] Back     alignment and taxonomy information
>gi|189237227|ref|XP_969775.2| PREDICTED: similar to DNA-damage inducible protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|114051417|ref|NP_001040314.1| DNA-damage inducible protein [Bombyx mori] gi|87248309|gb|ABD36207.1| DNA-damage inducible protein [Bombyx mori] Back     alignment and taxonomy information
>gi|307188581|gb|EFN73309.1| Protein DDI1-like protein 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332374366|gb|AEE62324.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|322799330|gb|EFZ20718.1| hypothetical protein SINV_11449 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307191967|gb|EFN75357.1| Protein DDI1-like protein 2 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query319
UNIPROTKB|E2R2Z0392 DDI1 "Uncharacterized protein" 0.843 0.686 0.534 2e-77
FB|FBgn0030753458 rngo "rings lost" [Drosophila 0.739 0.515 0.569 2e-77
UNIPROTKB|F6XP41400 DDI1 "Uncharacterized protein" 0.802 0.64 0.552 1.1e-76
UNIPROTKB|E1B9T9399 DDI2 "Uncharacterized protein" 0.852 0.681 0.528 4.6e-76
UNIPROTKB|F1SV49401 DDI1 "Uncharacterized protein" 0.815 0.648 0.549 4.6e-76
UNIPROTKB|Q5TDH0399 DDI2 "Protein DDI1 homolog 2" 0.852 0.681 0.528 5.9e-76
UNIPROTKB|F1SUU7399 DDI2 "Uncharacterized protein" 0.852 0.681 0.528 5.9e-76
UNIPROTKB|E2QUJ5399 DDI2 "Uncharacterized protein" 0.802 0.641 0.550 7.5e-76
ZFIN|ZDB-GENE-031030-15411 ddi2 "DNA-damage inducible pro 0.786 0.610 0.575 9.6e-76
RGD|1559430408 Ddi1 "DNA-damage inducible 1 h 0.799 0.625 0.544 9.7e-74
UNIPROTKB|E2R2Z0 DDI1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 711 (255.3 bits), Expect = 2.0e-77, Sum P(2) = 2.0e-77
 Identities = 149/279 (53%), Positives = 183/279 (65%)

Query:    46 DIILVAMPG----RGPTYHVAQSRHTAPHRSFMTAQ--LQDPAHVRXXXXXXXXXXXXXK 99
             D   +A+PG    R P+   AQ  H       MT    L  PA +R             K
Sbjct:    95 DFTRLAVPGTSSSRAPS---AQQSHGLDSGEKMTPTQGLDSPALIRSMLLSNPHDLSLLK 151

Query:   100 QNNPRLSEALSTGK-DAFTKVFKEQLVEREKRQKQKIKLMNAHPFDTHAQRLIAEEIRQK 158
             + NP L+EAL +G  D F+ V  EQ  ER  R++++++L  A PFD  AQ  I EEIRQ+
Sbjct:   152 ERNPPLAEALLSGNLDTFSHVLMEQQRERALREQERLRLYTADPFDLEAQAKIEEEIRQQ 211

Query:   159 NVEANMEAAMEYNPETFGSVVMLYINCKVNGYPVKAFVDSGAQTTIMSAKCAERCNIMRL 218
             N+E NM  AME  PE+FG V MLYINCKVNG+P+KAFVDSGAQ TIMS  CAERCNI+RL
Sbjct:   212 NIEENMNIAMEEAPESFGQVAMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIIRL 271

Query:   219 IDTRWAGVAKGVGVQQIIGRIHMVQVAIEKDFLTTSLSILEEQPXXXXXXXXXXRRHECC 278
             +D RWAG+AKGVG Q+IIGR+H+ Q+ IE DFL  S SILEEQP          RRH+C 
Sbjct:   272 VDRRWAGIAKGVGTQRIIGRVHLAQIQIEGDFLQCSFSILEEQPMDMLLGLDMLRRHQCS 331

Query:   279 IDLRKNVLRIGTTGTETKFLPERELPSCARLTSASDEEE 317
             IDL+KNVL IGTTGT+T FLPE ELP CA+L S++ ++E
Sbjct:   332 IDLKKNVLVIGTTGTQTPFLPEGELPLCAKLVSSAGQQE 370
GO:0006508 "proteolysis" evidence=IEA
GO:0004190 "aspartic-type endopeptidase activity" evidence=IEA
FB|FBgn0030753 rngo "rings lost" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F6XP41 DDI1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1B9T9 DDI2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1SV49 DDI1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q5TDH0 DDI2 "Protein DDI1 homolog 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1SUU7 DDI2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUJ5 DDI2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031030-15 ddi2 "DNA-damage inducible protein 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1559430 Ddi1 "DNA-damage inducible 1 homolog 1 (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7ZYA7DDI2_XENLANo assigned EC number0.52920.99370.8066N/AN/A
Q6TH22DDI2_DANRENo assigned EC number0.50270.99370.7712yesN/A
Q6BK42DDI1_DEBHANo assigned EC number0.37850.92780.6607yesN/A
Q5TDH0DDI2_HUMANNo assigned EC number0.50850.98740.7894yesN/A
A0JPP7DDI1_RATNo assigned EC number0.47510.99370.7769yesN/A
Q6CNS3DDI1_KLULANo assigned EC number0.37650.85890.6618yesN/A
Q6CFI3DDI1_YARLINo assigned EC number0.34790.94040.7556yesN/A
Q4WGS4DDI1_ASPFUNo assigned EC number0.38870.92160.7259yesN/A
A2ADY9DDI2_MOUSENo assigned EC number0.50.99370.7944yesN/A
Q2USD7DDI1_ASPORNo assigned EC number0.39420.94350.7487yesN/A
Q754R2DDI1_ASHGONo assigned EC number0.52290.53290.3601yesN/A
Q497D6DDI2_XENTRNo assigned EC number0.52470.99370.8045yesN/A
Q6FQE9DDI1_CANGANo assigned EC number0.36220.89960.6737yesN/A
Q5AY89DDI1_EMENINo assigned EC number0.39180.94670.7224yesN/A
Q10256MUD1_SCHPONo assigned EC number0.43470.69270.6656yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query319
cd05479124 cd05479, RP_DDI, RP_DDI; retropepsin-like domain o 5e-78
pfam09668124 pfam09668, Asp_protease, Aspartyl protease 4e-77
cd0030392 cd00303, retropepsin_like, Retropepsins; pepsin-li 3e-14
cd05480103 cd05480, NRIP_C, NRIP_C; putative nuclear receptor 6e-07
pfam1365089 pfam13650, Asp_protease_2, Aspartyl protease 2e-06
cd0548396 cd05483, retropepsin_like_bacteria, Bacterial aspa 2e-05
pfam0007799 pfam00077, RVP, Retroviral aspartyl protease 3e-04
cd0179671 cd01796, DDI1_N, DNA damage inducible protein 1 ub 0.001
pfam1397572 pfam13975, gag-asp_proteas, gag-polyprotein putati 0.001
cd0176969 cd01769, UBL, Ubiquitin-like domain of UBL 0.003
>gnl|CDD|133146 cd05479, RP_DDI, RP_DDI; retropepsin-like domain of DNA damage inducible protein Back     alignment and domain information 
 Score =  233 bits (597), Expect = 5e-78
 Identities = 78/124 (62%), Positives = 100/124 (80%)

Query: 165 EAAMEYNPETFGSVVMLYINCKVNGYPVKAFVDSGAQTTIMSAKCAERCNIMRLIDTRWA 224
           + AME++PE+FG V MLYIN ++NG PVKAFVDSGAQ TIMS  CAE+C +MRLID R+ 
Sbjct: 1   QNAMEHHPESFGKVPMLYINVEINGVPVKAFVDSGAQMTIMSKACAEKCGLMRLIDKRFQ 60

Query: 225 GVAKGVGVQQIIGRIHMVQVAIEKDFLTTSLSILEEQPMDMLLGLDMLRRHECCIDLRKN 284
           G+AKGVG Q+I+GRIH+ QV I   FL  S ++LE+  +D L+GLDML+RH+C IDL++N
Sbjct: 61  GIAKGVGTQKILGRIHLAQVKIGNLFLPCSFTVLEDDDVDFLIGLDMLKRHQCVIDLKEN 120

Query: 285 VLRI 288
           VLRI
Sbjct: 121 VLRI 124

The family represents the retropepsin-like domain of DNA damage inducible protein. DNA damage inducible protein has a retropepsin-like domain and an amino-terminal ubiquitin-like domain and/or a UBA (ubiquitin-associated) domain. This CD represents the retropepsin-like domain of DDI. Length = 124
>gnl|CDD|118200 pfam09668, Asp_protease, Aspartyl protease Back     alignment and domain information
>gnl|CDD|133136 cd00303, retropepsin_like, Retropepsins; pepsin-like aspartate proteases Back     alignment and domain information
>gnl|CDD|133147 cd05480, NRIP_C, NRIP_C; putative nuclear receptor interacting protein Back     alignment and domain information
>gnl|CDD|222288 pfam13650, Asp_protease_2, Aspartyl protease Back     alignment and domain information
>gnl|CDD|133150 cd05483, retropepsin_like_bacteria, Bacterial aspartate proteases, retropepsin-like protease family Back     alignment and domain information
>gnl|CDD|215697 pfam00077, RVP, Retroviral aspartyl protease Back     alignment and domain information
>gnl|CDD|176391 cd01796, DDI1_N, DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>gnl|CDD|206145 pfam13975, gag-asp_proteas, gag-polyprotein putative aspartyl protease Back     alignment and domain information
>gnl|CDD|176364 cd01769, UBL, Ubiquitin-like domain of UBL Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 319
KOG0012|consensus380 100.0
PF09668124 Asp_protease: Aspartyl protease; InterPro: IPR0191 100.0
cd05480103 NRIP_C NRIP_C; putative nuclear receptor interacti 100.0
cd05479124 RP_DDI RP_DDI; retropepsin-like domain of DNA dama 99.97
PF08284135 RVP_2: Retroviral aspartyl protease; InterPro: IPR 99.88
TIGR02281121 clan_AA_DTGA clan AA aspartic protease, TIGR02281 99.75
cd0548491 retropepsin_like_LTR_2 Retropepsins_like_LTR, peps 99.72
KOG0010|consensus493 99.68
PF1365090 Asp_protease_2: Aspartyl protease 99.62
cd0548396 retropepsin_like_bacteria Bacterial aspartate prot 99.61
PF00077100 RVP: Retroviral aspartyl protease The Prosite entr 99.57
TIGR03698107 clan_AA_DTGF clan AA aspartic protease, AF_0612 fa 99.51
cd0609586 RP_RTVL_H_like Retropepsin of the RTVL_H family of 99.5
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 99.42
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 99.4
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 99.38
COG3577215 Predicted aspartyl protease [General function pred 99.37
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 99.36
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 99.36
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 99.32
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 99.31
cd0030392 retropepsin_like Retropepsins; pepsin-like asparta 99.29
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 99.28
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 99.28
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 99.27
KOG0011|consensus340 99.27
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 99.27
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 99.22
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 99.21
PTZ0004476 ubiquitin; Provisional 99.2
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 99.19
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 99.17
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 99.16
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 99.16
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 99.16
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 99.14
PF1397572 gag-asp_proteas: gag-polyprotein putative aspartyl 99.13
cd0548193 retropepsin_like_LTR_1 Retropepsins_like_LTR; peps 99.13
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 99.13
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 99.12
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 99.09
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 99.09
PF12384177 Peptidase_A2B: Ty3 transposon peptidase; InterPro: 99.02
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 99.02
COG5550125 Predicted aspartyl protease [Posttranslational mod 98.93
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 98.9
cd01814113 NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT 98.84
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 98.84
KOG0003|consensus128 98.82
KOG0005|consensus70 98.81
cd0178984 Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol 98.8
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 98.78
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 98.78
KOG0004|consensus156 98.74
PF02160201 Peptidase_A3: Cauliflower mosaic virus peptidase ( 98.63
cd0609489 RP_Saci_like RP_Saci_like, retropepsin family. Ret 98.62
cd0548287 HIV_retropepsin_like Retropepsins, pepsin-like asp 98.41
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 98.38
PF05585164 DUF1758: Putative peptidase (DUF1758); InterPro: I 98.36
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 98.32
KOG4248|consensus 1143 98.17
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 98.07
KOG0001|consensus75 97.75
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 97.75
PF0928059 XPC-binding: XPC-binding domain; InterPro: IPR0153 97.67
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 97.63
cd01788119 ElonginB Ubiquitin-like domain of Elongin B. Elong 97.54
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 97.36
PLN02560308 enoyl-CoA reductase 97.36
PF12382137 Peptidase_A2E: Retrotransposon peptidase; InterPro 96.9
PF00026 317 Asp: Eukaryotic aspartyl protease The Prosite entr 96.27
PTZ00013 450 plasmepsin 4 (PM4); Provisional 96.01
cd05470109 pepsin_retropepsin_like Cellular and retroviral pe 95.91
KOG0006|consensus 446 95.76
PTZ00147 453 plasmepsin-1; Provisional 95.59
KOG1872|consensus 473 95.38
cd05476265 pepsin_A_like_plant Chroloplast Nucleoids DNA-bind 95.28
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 95.28
COG4067162 Uncharacterized protein conserved in archaea [Post 95.09
cd06097 278 Aspergillopepsin_like Aspergillopepsin_like, aspar 95.08
cd05474 295 SAP_like SAPs, pepsin-like proteinases secreted fr 94.66
cd05478 317 pepsin_A Pepsin A, aspartic protease produced in g 94.59
cd05487 326 renin_like Renin stimulates production of angioten 94.38
cd05476 265 pepsin_A_like_plant Chroloplast Nucleoids DNA-bind 94.2
KOG3206|consensus234 94.13
PF05618138 Zn_protease: Putative ATP-dependant zinc protease; 94.02
cd05477 318 gastricsin Gastricsins, asparate proteases produce 93.84
KOG1769|consensus99 93.83
cd06098 317 phytepsin Phytepsin, a plant homolog of mammalian 93.83
KOG4495|consensus110 93.7
cd05478317 pepsin_A Pepsin A, aspartic protease produced in g 93.65
PF1030297 DUF2407: DUF2407 ubiquitin-like domain; InterPro: 93.62
cd05488 320 Proteinase_A_fungi Fungal Proteinase A , aspartic 93.49
cd05486 316 Cathespin_E Cathepsin E, non-lysosomal aspartic pr 93.09
cd05477318 gastricsin Gastricsins, asparate proteases produce 93.06
cd05474295 SAP_like SAPs, pepsin-like proteinases secreted fr 92.95
cd05485 329 Cathepsin_D_like Cathepsin_D_like, pepsin family o 92.93
cd06096326 Plasmepsin_5 Plasmepsins are a class of aspartic p 92.84
cd05490 325 Cathepsin_D2 Cathepsin_D2, pepsin family of protei 92.76
PTZ00165 482 aspartyl protease; Provisional 92.69
cd06098317 phytepsin Phytepsin, a plant homolog of mammalian 92.68
cd05485329 Cathepsin_D_like Cathepsin_D_like, pepsin family o 92.5
cd05473 364 beta_secretase_like Beta-secretase, aspartic-acid 92.22
KOG3493|consensus73 92.05
cd05472 299 cnd41_like Chloroplast Nucleoids DNA-binding Prote 91.74
cd05475273 nucellin_like Nucellins, plant aspartic proteases 90.64
cd05488320 Proteinase_A_fungi Fungal Proteinase A , aspartic 90.55
PF00026317 Asp: Eukaryotic aspartyl protease The Prosite entr 90.44
cd06096 326 Plasmepsin_5 Plasmepsins are a class of aspartic p 89.98
cd06097278 Aspergillopepsin_like Aspergillopepsin_like, aspar 89.89
cd05471 283 pepsin_like Pepsin-like aspartic proteases, biloba 89.78
cd05472299 cnd41_like Chloroplast Nucleoids DNA-binding Prote 89.53
cd0181180 OASL_repeat1 2'-5' oligoadenylate synthetase-like 89.49
cd05471283 pepsin_like Pepsin-like aspartic proteases, biloba 88.71
cd05475 273 nucellin_like Nucellins, plant aspartic proteases 88.46
PF0078982 UBX: UBX domain; InterPro: IPR001012 The UBX domai 88.38
smart0072741 STI1 Heat shock chaperonin-binding motif. 87.82
PF03539163 Spuma_A9PTase: Spumavirus aspartic protease (A9); 86.99
PF1504476 CLU_N: Mitochondrial function, CLU-N-term 85.94
COG541781 Uncharacterized small protein [Function unknown] 85.55
KOG0013|consensus231 85.54
cd05486316 Cathespin_E Cathepsin E, non-lysosomal aspartic pr 85.36
cd05489362 xylanase_inhibitor_I_like TAXI-I inhibits degradat 84.16
cd05490325 Cathepsin_D2 Cathepsin_D2, pepsin family of protei 83.86
KOG0010|consensus 493 82.49
PLN03146431 aspartyl protease family protein; Provisional 82.17
PTZ00147453 plasmepsin-1; Provisional 81.99
smart0016680 UBX Domain present in ubiquitin-regulatory protein 81.92
cd05487326 renin_like Renin stimulates production of angioten 81.49
>KOG0012|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.6e-68  Score=496.69  Aligned_cols=317  Identities=45%  Similarity=0.734  Sum_probs=286.2

Q ss_pred             CCHHHHHHHHHhhhCCCCCCeEEEecCeeccCC-cccccccCCCCCcEEEEEccCCCCC----------CCccccCCCCc
Q psy17672          1 MDVEQFRLICQDECGIDATDMILLNNGKHLLED-GSCLKQAGVRDGDIILVAMPGRGPT----------YHVAQSRHTAP   69 (319)
Q Consensus         1 ~tv~~lK~~i~~e~gip~~~q~Li~~Gk~L~d~-~~tL~~~gI~~~d~l~l~~~~~~p~----------~~~s~~~~p~~   69 (319)
                      +.+.+|++++..++|++.+...|+||++++.++ +.+|.++|+++||+|.+..+...|.          .+|+++..|..
T Consensus        23 g~L~nl~aL~~~d~g~~~~~~~li~n~~~l~s~~s~~l~Q~g~~~~dsl~lr~ks~d~r~~v~~~~~~~~dFat~A~~~f  102 (380)
T KOG0012|consen   23 GELNNLAALCWKDTGIVYDPSDLIYNPRPLVSNESQGLTQIGLKDGDSLALRCKSSDPRPIVPIQVRLISDFATIAVPMF  102 (380)
T ss_pred             cchhhHHHHHHHHhCcccchhhcccCCCccccchhhhhhhcccccceeEeccCCCCCCCccccccceehhcccccccccc
Confidence            467899999999999999999999999999764 6789999999999999987643321          13433322211


Q ss_pred             -----------cccc---------cccC-CCChHHHHHHHhhCHHHHHHHHhcCchhHHHHhcCh-HHHHHHHHHHHHHH
Q psy17672         70 -----------HRSF---------MTAQ-LQDPAHVRDLLLACPDQLALLKQNNPRLSEALSTGK-DAFTKVFKEQLVER  127 (319)
Q Consensus        70 -----------~~~~---------~~~~-~~dpe~~r~~il~nP~~l~~L~~~nP~La~ai~~~~-~~f~~~l~~~~~~~  127 (319)
                                 ++.+         .... .++|+.|||+++++|..+..+++.+|.|+.++..++ ++|...++..+..+
T Consensus       103 s~q~a~~~~gaq~~rg~~~~di~~a~~~~ldsp~~~Rq~~la~pf~L~~~r~~lp~La~~l~~g~~~k~~~~~~~~q~d~  182 (380)
T KOG0012|consen  103 SSQRARQLQGAQRTRGRLQTDIPEASSLSLDSPATFRQALLAMPFFLHLDRAYLPPLAALLVLGDLEKFDRTLKEMQKDY  182 (380)
T ss_pred             cchhccccccccccccccccccccccccCcCCHHHHHHHHhcCchhhhhchhhcCccchhhcccchhhhhhhhhhhcccc
Confidence                       1110         1122 589999999999999999999999999999997777 99999999877777


Q ss_pred             HHHHHHHHHHhhcCCCCHHHHHHHHHHHHHHHHHHHHHHhHhcCCCCccccceEEEEEEEcCEEEEEEEcCCccccccCH
Q psy17672        128 EKRQKQKIKLMNAHPFDTHAQRLIAEEIRQKNVEANMEAAMEYNPETFGSVVMLYINCKVNGYPVKAFVDSGAQTTIMSA  207 (319)
Q Consensus       128 ~~~~~~~~~~l~~dP~~~e~q~~i~~~i~~~~~~~~~~~a~~~~pe~~~~~~~l~v~v~Ing~~v~aLVDTGA~~siIs~  207 (319)
                      .+++..+++++++||||+|+|+||+|.|+|++|+|||.+|+||+||.|+.|+||||+|+|||++||||||||||.|+||.
T Consensus       183 ~rr~~~~~rl~eanPfd~E~q~rIee~irq~~i~eq~~~ai~~~pe~f~~v~ML~iN~~ing~~VKAfVDsGaq~timS~  262 (380)
T KOG0012|consen  183 QRRSVHQRRLLEANPFDLEAQRRIEEKIRQNAIDEQMSHAIEYHPEDFTQVTMLYINCEINGVPVKAFVDSGAQTTIMSA  262 (380)
T ss_pred             chhhhhhHHHHhcCCcchhhhhhhhHHHHHHHHHHHHHHhhhcCccccccceEEEEEEEECCEEEEEEEcccchhhhhhH
Confidence            77778899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHcCCccccccceeeEeeccceeEEEeEEEEEEEEEcCEEEEeeEEEecCCCCceeechhhhhhccEEEEccCCEEE
Q psy17672        208 KCAERCNIMRLIDTRWAGVAKGVGVQQIIGRIHMVQVAIEKDFLTTSLSILEEQPMDMLLGLDMLRRHECCIDLRKNVLR  287 (319)
Q Consensus       208 ~~a~rlgl~~~~~~~~~g~a~Gvg~~~~~g~v~~~~i~IG~~~~~~~f~Vl~~~~~d~ILG~D~L~~~~~~ID~~~~~L~  287 (319)
                      +||+||||.+++|+++.|++.|||+.|+.|+||.++++||+.+++|+|.|++...+|++||+|+|++|+||||+++|.|+
T Consensus       263 ~Caer~gL~rlid~r~~g~a~gvg~~ki~g~Ih~~~lki~~~~l~c~ftV~d~~~~d~llGLd~Lrr~~ccIdL~~~~L~  342 (380)
T KOG0012|consen  263 ACAERCGLNRLIDKRFQGEARGVGTEKILGRIHQAQLKIEDLYLPCSFTVLDRRDMDLLLGLDMLRRHQCCIDLKTNVLR  342 (380)
T ss_pred             HHHHHhChHHHhhhhhhccccCCCcccccceeEEEEEEeccEeeccceEEecCCCcchhhhHHHHHhccceeecccCeEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EccCCeeeecccCCCccccccccCCccccc
Q psy17672        288 IGTTGTETKFLPERELPSCARLTSASDEEE  317 (319)
Q Consensus       288 i~~~~~~vpfl~~~~~~~~~~~~~~~~~~~  317 (319)
                      |+++++++||+...++|...+.++.++|+.
T Consensus       343 ig~~~teiPfl~~~~lp~~~~~~~~~~~~~  372 (380)
T KOG0012|consen  343 IGNTETEIPFLPSNELPSHNKETGASPEPE  372 (380)
T ss_pred             ecCCCccccccccccCCccccccccCCCcc
Confidence            999999999999999999999999987764

>PF09668 Asp_protease: Aspartyl protease; InterPro: IPR019103 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd05480 NRIP_C NRIP_C; putative nuclear receptor interacting protein Back     alignment and domain information
>cd05479 RP_DDI RP_DDI; retropepsin-like domain of DNA damage inducible protein Back     alignment and domain information
>PF08284 RVP_2: Retroviral aspartyl protease; InterPro: IPR013242 This region defines single domain aspartyl proteases from retroviruses, retrotransposons, and badnaviruses (plant dsDNA viruses) Back     alignment and domain information
>TIGR02281 clan_AA_DTGA clan AA aspartic protease, TIGR02281 family Back     alignment and domain information
>cd05484 retropepsin_like_LTR_2 Retropepsins_like_LTR, pepsin-like aspartate proteases Back     alignment and domain information
>KOG0010|consensus Back     alignment and domain information
>PF13650 Asp_protease_2: Aspartyl protease Back     alignment and domain information
>cd05483 retropepsin_like_bacteria Bacterial aspartate proteases, retropepsin-like protease family Back     alignment and domain information
>PF00077 RVP: Retroviral aspartyl protease The Prosite entry also includes Pfam:PF00026; InterPro: IPR018061 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR03698 clan_AA_DTGF clan AA aspartic protease, AF_0612 family Back     alignment and domain information
>cd06095 RP_RTVL_H_like Retropepsin of the RTVL_H family of human endogenous retrovirus-like elements Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>COG3577 Predicted aspartyl protease [General function prediction only] Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd00303 retropepsin_like Retropepsins; pepsin-like aspartate proteases Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>KOG0011|consensus Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>PF13975 gag-asp_proteas: gag-polyprotein putative aspartyl protease Back     alignment and domain information
>cd05481 retropepsin_like_LTR_1 Retropepsins_like_LTR; pepsin-like aspartate protease from retrotransposons with long terminal repeats Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>PF12384 Peptidase_A2B: Ty3 transposon peptidase; InterPro: IPR024650 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>COG5550 Predicted aspartyl protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>KOG0003|consensus Back     alignment and domain information
>KOG0005|consensus Back     alignment and domain information
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>KOG0004|consensus Back     alignment and domain information
>PF02160 Peptidase_A3: Cauliflower mosaic virus peptidase (A3); InterPro: IPR000588 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd06094 RP_Saci_like RP_Saci_like, retropepsin family Back     alignment and domain information
>cd05482 HIV_retropepsin_like Retropepsins, pepsin-like aspartate proteases Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>PF05585 DUF1758: Putative peptidase (DUF1758); InterPro: IPR008737 This is a family of nematode proteins of unknown function [] Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>KOG4248|consensus Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information
>KOG0001|consensus Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>PF09280 XPC-binding: XPC-binding domain; InterPro: IPR015360 Members of this entry adopt a structure consisting of four alpha helices, arranged in an array Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>cd01788 ElonginB Ubiquitin-like domain of Elongin B Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>PF12382 Peptidase_A2E: Retrotransposon peptidase; InterPro: IPR024648 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00026 Asp: Eukaryotic aspartyl protease The Prosite entry also includes Pfam:PF00077 Back     alignment and domain information
>PTZ00013 plasmepsin 4 (PM4); Provisional Back     alignment and domain information
>cd05470 pepsin_retropepsin_like Cellular and retroviral pepsin-like aspartate proteases Back     alignment and domain information
>KOG0006|consensus Back     alignment and domain information
>PTZ00147 plasmepsin-1; Provisional Back     alignment and domain information
>KOG1872|consensus Back     alignment and domain information
>cd05476 pepsin_A_like_plant Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>COG4067 Uncharacterized protein conserved in archaea [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06097 Aspergillopepsin_like Aspergillopepsin_like, aspartic proteases of fungal origin Back     alignment and domain information
>cd05474 SAP_like SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins Back     alignment and domain information
>cd05478 pepsin_A Pepsin A, aspartic protease produced in gastric mucosa of mammals Back     alignment and domain information
>cd05487 renin_like Renin stimulates production of angiotensin and thus affects blood pressure Back     alignment and domain information
>cd05476 pepsin_A_like_plant Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants Back     alignment and domain information
>KOG3206|consensus Back     alignment and domain information
>PF05618 Zn_protease: Putative ATP-dependant zinc protease; InterPro: IPR008503 This family consists of several hypothetical proteins from different archaeal and bacterial species Back     alignment and domain information
>cd05477 gastricsin Gastricsins, asparate proteases produced in gastric mucosa Back     alignment and domain information
>KOG1769|consensus Back     alignment and domain information
>cd06098 phytepsin Phytepsin, a plant homolog of mammalian lysosomal pepsins Back     alignment and domain information
>KOG4495|consensus Back     alignment and domain information
>cd05478 pepsin_A Pepsin A, aspartic protease produced in gastric mucosa of mammals Back     alignment and domain information
>PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi Back     alignment and domain information
>cd05488 Proteinase_A_fungi Fungal Proteinase A , aspartic proteinase superfamily Back     alignment and domain information
>cd05486 Cathespin_E Cathepsin E, non-lysosomal aspartic protease Back     alignment and domain information
>cd05477 gastricsin Gastricsins, asparate proteases produced in gastric mucosa Back     alignment and domain information
>cd05474 SAP_like SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins Back     alignment and domain information
>cd05485 Cathepsin_D_like Cathepsin_D_like, pepsin family of proteinases Back     alignment and domain information
>cd06096 Plasmepsin_5 Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite Back     alignment and domain information
>cd05490 Cathepsin_D2 Cathepsin_D2, pepsin family of proteinases Back     alignment and domain information
>PTZ00165 aspartyl protease; Provisional Back     alignment and domain information
>cd06098 phytepsin Phytepsin, a plant homolog of mammalian lysosomal pepsins Back     alignment and domain information
>cd05485 Cathepsin_D_like Cathepsin_D_like, pepsin family of proteinases Back     alignment and domain information
>cd05473 beta_secretase_like Beta-secretase, aspartic-acid protease important in the pathogenesis of Alzheimer's disease Back     alignment and domain information
>KOG3493|consensus Back     alignment and domain information
>cd05472 cnd41_like Chloroplast Nucleoids DNA-binding Protease, catalyzes the degradation of ribulose-1,5-bisphosphate carboxylase/oxygenase Back     alignment and domain information
>cd05475 nucellin_like Nucellins, plant aspartic proteases specifically expressed in nucellar cells during degradation Back     alignment and domain information
>cd05488 Proteinase_A_fungi Fungal Proteinase A , aspartic proteinase superfamily Back     alignment and domain information
>PF00026 Asp: Eukaryotic aspartyl protease The Prosite entry also includes Pfam:PF00077 Back     alignment and domain information
>cd06096 Plasmepsin_5 Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite Back     alignment and domain information
>cd06097 Aspergillopepsin_like Aspergillopepsin_like, aspartic proteases of fungal origin Back     alignment and domain information
>cd05471 pepsin_like Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH Back     alignment and domain information
>cd05472 cnd41_like Chloroplast Nucleoids DNA-binding Protease, catalyzes the degradation of ribulose-1,5-bisphosphate carboxylase/oxygenase Back     alignment and domain information
>cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2 Back     alignment and domain information
>cd05471 pepsin_like Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH Back     alignment and domain information
>cd05475 nucellin_like Nucellins, plant aspartic proteases specifically expressed in nucellar cells during degradation Back     alignment and domain information
>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast Back     alignment and domain information
>smart00727 STI1 Heat shock chaperonin-binding motif Back     alignment and domain information
>PF03539 Spuma_A9PTase: Spumavirus aspartic protease (A9); InterPro: IPR001641 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF15044 CLU_N: Mitochondrial function, CLU-N-term Back     alignment and domain information
>COG5417 Uncharacterized small protein [Function unknown] Back     alignment and domain information
>KOG0013|consensus Back     alignment and domain information
>cd05486 Cathespin_E Cathepsin E, non-lysosomal aspartic protease Back     alignment and domain information
>cd05489 xylanase_inhibitor_I_like TAXI-I inhibits degradation of xylan in the cell wall Back     alignment and domain information
>cd05490 Cathepsin_D2 Cathepsin_D2, pepsin family of proteinases Back     alignment and domain information
>KOG0010|consensus Back     alignment and domain information
>PLN03146 aspartyl protease family protein; Provisional Back     alignment and domain information
>PTZ00147 plasmepsin-1; Provisional Back     alignment and domain information
>smart00166 UBX Domain present in ubiquitin-regulatory proteins Back     alignment and domain information
>cd05487 renin_like Renin stimulates production of angiotensin and thus affects blood pressure Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query319
3s8i_A148 The Retroviral-Like Protease (Rvp) Domain Of Human 9e-51
2i1a_A148 A Retroviral Protease-Like Domain In The Eukaryotic 6e-34
>pdb|3S8I|A Chain A, The Retroviral-Like Protease (Rvp) Domain Of Human Ddi1 Length = 148 Back     alignment and structure 
Iteration: 1

 Score =  197 bits (500), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 103/133 (77%)
Query: 172 PETFGSVVMLYINCKVNGYPVKAFVDSGAQTTIMSAKCAERCNIMRLIDTRWAGVAKGVG 231
           P   G V MLYINCKVNG+P+KAFVDSGAQ TIMS  CAERCNIMRL+D RWAGVAKGVG
Sbjct: 16  PRGSGQVTMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGVAKGVG 75
Query: 232 VQQIIGRIHMVQVAIEKDFLTTSLSILEEQPXXXXXXXXXXRRHECCIDLRKNVLRIGTT 291
            Q+IIGR+H+ Q+ IE DFL  S SILE+QP          RRH+C IDL+KNVL IGTT
Sbjct: 76  TQRIIGRVHLAQIQIEGDFLQCSFSILEDQPMDMLLGLDMLRRHQCSIDLKKNVLVIGTT 135
Query: 292 GTETKFLPERELP 304
           GT+T FLPE ELP
Sbjct: 136 GTQTYFLPEGELP 148
>pdb|2I1A|A Chain A, A Retroviral Protease-Like Domain In The Eukaryotic Protein Ddi1 Length = 148 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query319
2i1a_A148 DNA damage-inducible protein DDI1; acid protease f 7e-60
3s8i_A148 Protein DDI1 homolog 1; protease, structural genom 1e-56
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 6e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-06
>2i1a_A DNA damage-inducible protein DDI1; acid protease fold, dimer, retroviral protease domain, protein turnover; HET: DNA; 2.30A {Saccharomyces cerevisiae} Length = 148 Back     alignment and structure
 Score =  187 bits (476), Expect = 7e-60
 Identities = 76/150 (50%), Positives = 107/150 (71%), Gaps = 3/150 (2%)

Query: 155 IRQKNVEANMEAAMEYNPETFGSVVMLYINCKVNGYPVKAFVDSGAQTTIMSAKCAERCN 214
           ++Q+ ++  +  A+EY PE F  V MLYIN ++N YPVKAFVD+GAQTTIMS + A++  
Sbjct: 1   MKQQAIDEQLRNAIEYTPEMFTQVPMLYINIEINNYPVKAFVDTGAQTTIMSTRLAKKTG 60

Query: 215 IMRLIDTRWAGVAKGVGVQQIIGRIHMVQVAIEKDFLTTSLSILEEQPMDMLLGLDMLRR 274
           + R+ID R+ G A+GVG  +IIGRIH  QV IE  ++  S ++L +  +D+L+GLDML+R
Sbjct: 61  LSRMIDKRFIGEARGVGTGKIIGRIHQAQVKIETQYIPCSFTVL-DTDIDVLIGLDMLKR 119

Query: 275 HECCIDLRKNVLRIGTTGTETKFLPERELP 304
           H  C+DL++NVLRI     ET FL E E+P
Sbjct: 120 HLACVDLKENVLRIA--EVETSFLSEAEIP 147
>3s8i_A Protein DDI1 homolog 1; protease, structural genomics, structural genomics consortiu retropepsin-like domain, protein turnover, hydrolase; 1.70A {Homo sapiens} Length = 148 Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 102 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query319
3s8i_A148 Protein DDI1 homolog 1; protease, structural genom 100.0
2i1a_A148 DNA damage-inducible protein DDI1; acid protease f 100.0
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 99.39
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 99.38
3m62_B106 UV excision repair protein RAD23; armadillo-like r 99.38
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 99.38
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 99.37
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 99.35
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 99.33
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 99.31
3slz_A132 GAG-Pro-POL polyprotein; beta sheet and dimer, pro 99.29
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 99.29
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 99.29
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 99.29
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 99.28
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 99.28
1fmb_A104 EIAV protease; hydrolase (acid proteinase), RNA-di 99.27
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 99.27
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 99.27
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 99.27
3v6c_B91 Ubiquitin; structural genomics, structural genomic 99.27
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 99.27
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 99.26
4ajy_B118 Transcription elongation factor B polypeptide 2; E 99.26
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 99.26
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 99.25
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 99.25
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 99.24
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 99.24
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 99.24
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 99.24
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 99.24
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 99.24
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 99.23
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 99.23
2fnj_B118 Transcription elongation factor B polypeptide 2; b 99.23
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 99.22
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 99.21
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 99.21
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 99.21
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 99.2
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 99.2
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 99.2
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 99.2
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 99.2
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 99.2
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 99.2
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 99.19
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 99.19
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 99.19
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 99.19
2kj6_A97 Tubulin folding cofactor B; methods development, N 99.19
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 99.18
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 99.18
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 99.18
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 99.17
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 99.16
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 99.15
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 99.13
1we6_A111 Splicing factor, putative; structural genomics, ub 99.13
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 99.13
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 99.13
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 99.12
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 99.11
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 98.71
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 99.11
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 99.09
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 99.08
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 99.08
3ec0_A99 Protease; HIV-2, inhibitor, hydrolase; HET: GRL; 1 99.07
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 99.06
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.06
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 99.04
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 99.04
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 99.04
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 99.03
2hs1_A99 HIV-1 protease; ultra-high resolution active site 99.02
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 98.97
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 98.97
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 98.96
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 98.95
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 98.94
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 98.94
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 98.92
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 98.92
3ka2_A203 [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydro 98.91
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 98.9
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 98.9
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 98.85
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 98.83
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 98.81
2hah_A116 Protease, retropepsin; retroviral, aspartyl, hydro 98.7
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 98.67
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 98.55
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 98.52
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 98.46
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 98.46
3ka2_A203 [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydro 98.45
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 98.41
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 98.37
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 98.28
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 98.22
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 98.19
3sqf_A114 Protease; folded monomer, retropepsin, D-type retr 98.15
2rsp_A124 RSV protease; hydrolase(aspartyl proteinase); 2.00 98.12
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 97.76
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 97.59
1pve_A72 HHR23B, UV excision repair protein RAD23 homolog B 97.52
2f4m_B61 UV excision repair protein RAD23 homolog B; glycop 97.49
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 97.42
3liy_A116 Protease; hydrolase, hydrolase-hydrolase inhibitor 97.41
2pjh_A80 Protein NPL4, nuclear protein localization protein 97.35
4efo_A94 Serine/threonine-protein kinase TBK1; ubiquitin li 97.2
2qsf_X171 RAD23, UV excision repair protein RAD23; alpha-bet 97.18
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 97.16
2pma_A146 Uncharacterized protein; APC86035.2, protein LPG00 97.05
3v7o_A227 Minor nucleoprotein VP30; ssgcid, seattle structur 96.84
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 96.63
3qvc_A 451 Histo-aspartic protease; HAP, plasmepsin, zymogen, 96.35
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 95.93
1miq_A 375 Plasmepsin; aspartic proteinase zymogen, domain op 95.79
3psg_A 370 Pepsinogen; hydrolase(acid proteinase zymogen); 1. 95.59
2bps_A81 YUKD protein; ubiquitin-like protein, ubiquitin; 2 95.55
3ix6_A360 TS, tsase, thymidylate synthase; niaid, ssgcid, se 95.54
2x0b_A 383 Renin; hydrolase-hormone complex, hydrolase hormon 95.51
1bxo_A 323 Protein (penicillopepsin); hydrolase, phosphonate 95.41
2bju_A 453 Plasmepsin II; aspartic proteinase, drug design, m 95.32
3cms_A 323 Chymosin B; hydrolase, acid proteinase; 2.00A {Bos 95.13
3k1w_A 341 Renin; protease, alternative splicing, aspartyl pr 95.12
2l76_A95 Nfatc2-interacting protein; ubiquitin-like domain, 95.11
1wkr_A 340 Polyporopepsin; hydrolase, hydrolase-hydrolase inh 95.11
1yg9_A 330 Aspartic protease BLA G 2; allegren, hydrolase, al 95.09
4da1_A389 Protein phosphatase 1K, mitochondrial; metal-ION-a 95.07
1izd_A 323 Aspartic proteinase; sugar binding, acid protease, 95.04
1ibq_A 325 Aspergillopepsin; aspartic proteinase, hydrolase; 94.99
1mpp_A 361 Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu 94.97
1b5f_A239 Protein (cardosin A); hydrolase, aspartic proteina 94.9
1dpj_A 329 Proteinase A; proteinase A, hydrolase-hydrolase in 94.47
1tzs_A 351 Cathepsin E; hydrolase, aspartic protease, activat 94.46
4aa9_A 320 Chymosin; hydrolase, aspartic peptidase, rennet; H 94.43
1oew_A 329 Endothiapepsin; hydrolase, aspartic proteinase mec 94.4
2jys_A107 Protease/reverse transcriptase; retroviral proteas 94.4
3c9x_A 329 Trichoderma reesei aspartic protease; aspartic pro 94.31
1htr_B 329 Gastricsin; aspartyl protease; 1.62A {Homo sapiens 94.02
2kc2_A128 Talin-1, F1; FERM, adhesion, cell membrane, cell p 93.86
3fv3_A 339 SAPP1P-secreted aspartic protease 1; secreted aspa 93.49
1am5_A 324 Pepsin, acid proteinase; aspartyl protease, hydrol 93.44
3pvk_A 342 Candidapepsin-2; hydrolase; 1.27A {Candida albican 93.32
1qdm_A 478 Prophytepsin; aspartic proteinases, saposin-like d 93.28
2apr_A 325 Rhizopuspepsin; hydrolase (aspartic proteinase); 1 93.2
2qzx_A 342 Candidapepsin-5; aspartic proteinase, aspartyl pro 93.0
3aup_A 403 SBG7S, BG, basic 7S globulin; pepsin-like fold, pl 92.96
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 92.93
1j71_A 334 Candidapepsin, aspartic proteinase; candida tropic 92.71
2ewy_A 383 Beta-secretase 2; BACE2, aspartic protease, hydrol 92.23
3lpj_A 455 Beta-secretase 1; alzheimer'S, aspartyl protease, 92.19
3cms_A323 Chymosin B; hydrolase, acid proteinase; 2.00A {Bos 91.77
1yg9_A330 Aspartic protease BLA G 2; allegren, hydrolase, al 91.65
3vf3_A 402 Beta-secretase 1; structure-based drug design, hyd 91.47
1lya_A97 Cathepsin D; lysosomal aspartic protease; HET: NAG 91.06
1lya_B241 Cathepsin D; lysosomal aspartic protease; HET: NAG 90.78
3qvc_A451 Histo-aspartic protease; HAP, plasmepsin, zymogen, 90.62
1wkr_A340 Polyporopepsin; hydrolase, hydrolase-hydrolase inh 90.49
1am5_A324 Pepsin, acid proteinase; aspartyl protease, hydrol 90.3
2qp8_A 395 Beta-secretase 1; BACE1, protease, alternative spl 90.17
4a3p_A217 Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H 89.99
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 89.8
1miq_A375 Plasmepsin; aspartic proteinase zymogen, domain op 89.8
1j71_A334 Candidapepsin, aspartic proteinase; candida tropic 89.71
3fv3_A339 SAPP1P-secreted aspartic protease 1; secreted aspa 89.53
1dpj_A329 Proteinase A; proteinase A, hydrolase-hydrolase in 89.51
1mpp_A361 Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu 89.42
3jyu_A231 Ubiquitin carboxyl-terminal hydrolase; domain in u 89.36
1ibq_A325 Aspergillopepsin; aspartic proteinase, hydrolase; 89.26
4aa9_A320 Chymosin; hydrolase, aspartic peptidase, rennet; H 89.05
1bxo_A323 Protein (penicillopepsin); hydrolase, phosphonate 88.96
2qzx_A342 Candidapepsin-5; aspartic proteinase, aspartyl pro 88.76
1htr_B329 Gastricsin; aspartyl protease; 1.62A {Homo sapiens 88.6
2apr_A325 Rhizopuspepsin; hydrolase (aspartic proteinase); 1 88.4
3k1w_A341 Renin; protease, alternative splicing, aspartyl pr 88.08
2bju_A453 Plasmepsin II; aspartic proteinase, drug design, m 88.07
1izd_A323 Aspartic proteinase; sugar binding, acid protease, 87.82
3pvk_A342 Candidapepsin-2; hydrolase; 1.27A {Candida albican 87.75
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 87.67
1oew_A329 Endothiapepsin; hydrolase, aspartic proteinase mec 87.24
3c9x_A329 Trichoderma reesei aspartic protease; aspartic pro 86.52
1tzs_A351 Cathepsin E; hydrolase, aspartic protease, activat 86.1
1t6e_X381 Xylanase inhibitor; two beta-barrel domain structu 85.85
3aup_A403 SBG7S, BG, basic 7S globulin; pepsin-like fold, pl 85.67
2x0b_A383 Renin; hydrolase-hormone complex, hydrolase hormon 85.45
3vf3_A402 Beta-secretase 1; structure-based drug design, hyd 85.08
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 84.18
3onh_A127 Ubiquitin-activating enzyme E1-like; ligase, SUMO 83.53
3psg_A370 Pepsinogen; hydrolase(acid proteinase zymogen); 1. 82.74
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 82.26
2ewy_A383 Beta-secretase 2; BACE2, aspartic protease, hydrol 81.41
3lpj_A455 Beta-secretase 1; alzheimer'S, aspartyl protease, 80.36
2juo_A89 GA-binding protein alpha chain; OST, ubiquitin, tr 80.03
>3s8i_A Protein DDI1 homolog 1; protease, structural genomics, structural genomics consortiu retropepsin-like domain, protein turnover, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=3.9e-38  Score=268.54  Aligned_cols=137  Identities=74%  Similarity=1.190  Sum_probs=120.3

Q ss_pred             HhcCCCCccccceEEEEEEEcCEEEEEEEcCCccccccCHHHHHHcCCccccccceeeEeeccceeEEEeEEEEEEEEEc
Q psy17672        168 MEYNPETFGSVVMLYINCKVNGYPVKAFVDSGAQTTIMSAKCAERCNIMRLIDTRWAGVAKGVGVQQIIGRIHMVQVAIE  247 (319)
Q Consensus       168 ~~~~pe~~~~~~~l~v~v~Ing~~v~aLVDTGA~~siIs~~~a~rlgl~~~~~~~~~g~a~Gvg~~~~~g~v~~~~i~IG  247 (319)
                      --.-||+|+++.|+||+|+|||++++|||||||++|+||.+||+||||....+.++.+++.|+|+.++.|+++.++|+||
T Consensus        12 ~~~~~~~~~~~~~l~v~~~Ing~~v~~LVDTGAs~s~Is~~~A~rlGL~~~~~~~~~~~a~g~G~~~~~g~v~~~~I~Ig   91 (148)
T 3s8i_A           12 SGLVPRGSGQVTMLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGVAKGVGTQRIIGRVHLAQIQIE   91 (148)
T ss_dssp             ----------CCCCEEEEEETTEEEEEEECTTCSSCEEEHHHHHHTTCGGGEEGGGCEECCC---CEEEEEEEEEEEEET
T ss_pred             CCcCceeccccCEEEEEEEECCEEEEEEEeCCCCcEeeCHHHHHHcCCccccCcceeEEEEcCCccEEEEEEEEEEEEEC
Confidence            34579999999999999999999999999999999999999999999998888888889999998899999999999999


Q ss_pred             CEEEEeeEEEecCCCCceeechhhhhhccEEEEccCCEEEEccCCeeeecccCCCcc
Q psy17672        248 KDFLTTSLSILEEQPMDMLLGLDMLRRHECCIDLRKNVLRIGTTGTETKFLPERELP  304 (319)
Q Consensus       248 ~~~~~~~f~Vl~~~~~d~ILG~D~L~~~~~~ID~~~~~L~i~~~~~~vpfl~~~~~~  304 (319)
                      +++++++|.|++..++|+|||||||++++|+|||++++|+|+++++++|||+++|||
T Consensus        92 ~~~~~~~~~Vle~~~~d~LLGmD~L~~~~~~ID~~~~~L~l~~~~~~~pfl~~~~~~  148 (148)
T 3s8i_A           92 GDFLQCSFSILEDQPMDMLLGLDMLRRHQCSIDLKKNVLVIGTTGTQTYFLPEGELP  148 (148)
T ss_dssp             TEEEEEEEEEETTCSSSEEECHHHHHHTTCEEETTTTEEECTTTCCEEECCCGGGCC
T ss_pred             CEEEEEEEEEeCCCCcCeeccHHHHHhCCEEEEcCCCEEEEccCCeEEeecCcccCc
Confidence            999999999999999999999999999999999999999999888999999999997
>2i1a_A DNA damage-inducible protein DDI1; acid protease fold, dimer, retroviral protease domain, protein turnover; HET: DNA; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>3slz_A GAG-Pro-POL polyprotein; beta sheet and dimer, protease, peptide inhibitor, TL-3 PEPS virus, hydrolase-hydrolase inhibitor complex; HET: 3TL; 1.40A {Dg-75 murine leukemia virus} PDB: 3nr6_A* 3sm1_A* 3sm2_A* 4exh_A* Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1fmb_A EIAV protease; hydrolase (acid proteinase), RNA-directed DNA polymerase, AS protease, endonuclease, polyprotein; HET: HYB; 1.80A {Equine infectious anemia virus} SCOP: b.50.1.1 PDB: 2fmb_A* Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>3ec0_A Protease; HIV-2, inhibitor, hydrolase; HET: GRL; 1.18A {Human immunodeficiency virus type 2} SCOP: b.50.1.1 PDB: 1hii_A* 1hsi_A 1hsh_A* 1idb_A* 1jld_A* 2mip_A 1ida_A* 3ebz_A* 3ecg_A* 3s45_A* 4upj_A* 1ivq_A* 1ivp_A 2hpf_A 3upj_A* 2hpe_A* 5upj_A* 6upj_A* 1sip_A 1tcw_A* ... Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>2hs1_A HIV-1 protease; ultra-high resolution active site surface binding site, HYDR; HET: 017; 0.84A {Human immunodeficiency virus 1} PDB: 3nu4_A* 3tl9_A* 3tkw_A* 3tkg_A* 3ndu_A* 3ndt_A* 3k4v_A* 3a2o_A* 1fgc_C* 2a1e_A* 2aod_A* 2aoi_A* 2aoj_A* 2hb3_A* 2ien_A* 1sdt_A* 2z4o_A* 2zye_A* 2nmw_A* 3b7v_A* ... Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3ka2_A [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydrolase-hydrolase inhibitor complex; HET: YCM 2NC; 1.40A {Synthetic} PDB: 3fsm_A* 3gi0_A* 2o40_A* 3hzc_A* 3hlo_A* 3iaw_A* 3nxe_A* 3nxn_A* 4epj_A 4ep2_A 4ep3_A 4eq0_A 4eqj_A 1hvc_A* 1g6l_A 2whh_A* 1lv1_A* 3dox_A 3kt5_A 3kt2_A ... Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2hah_A Protease, retropepsin; retroviral, aspartyl, hydrolase-hydrolase complex; HET: 3TL; 1.70A {Feline immunodeficiency virus} PDB: 3ogp_A* 3ogq_A* 2fiv_A* 6fiv_A* 3fiv_A* 5fiv_A* 4fiv_A* 1fiv_A* 1b11_A* Back     alignment and structure
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>3ka2_A [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydrolase-hydrolase inhibitor complex; HET: YCM 2NC; 1.40A {Synthetic} PDB: 3fsm_A* 3gi0_A* 2o40_A* 3hzc_A* 3hlo_A* 3iaw_A* 3nxe_A* 3nxn_A* 4epj_A 4ep2_A 4ep3_A 4eq0_A 4eqj_A 1hvc_A* 1g6l_A 2whh_A* 1lv1_A* 3dox_A 3kt5_A 3kt2_A ... Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>3sqf_A Protease; folded monomer, retropepsin, D-type retrovirus; 1.63A {Mason-pfizer monkey virus} SCOP: b.50.1.1 PDB: 1nso_A Back     alignment and structure
>2rsp_A RSV protease; hydrolase(aspartyl proteinase); 2.00A {Rous sarcoma virus} SCOP: b.50.1.1 PDB: 1mvp_A 1bai_A* Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1pve_A HHR23B, UV excision repair protein RAD23 homolog B; XPC binding domain, solution structure, nucleotide excision repair, chaps, DNA binding protein; NMR {Homo sapiens} SCOP: a.189.1.1 Back     alignment and structure
>2f4m_B UV excision repair protein RAD23 homolog B; glycoproteins, ubiquitin-dependent protein degradation, NUCL excision repair, peptide:N-glycanase; 1.85A {Mus musculus} SCOP: a.189.1.1 PDB: 2f4o_B* Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3liy_A Protease; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.86A {Human t-lymphotropic virus 1} PDB: 2b7f_A* 3liq_A* 3lit_A* 3liv_A* 3lix_A* 3lin_A* Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Back     alignment and structure
>2pma_A Uncharacterized protein; APC86035.2, protein LPG0085, DUF785, legionella pneumophila pneumophila STR. philadelphia 1; 1.89A {Legionella pneumophila subsp} SCOP: b.50.1.3 Back     alignment and structure
>3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Back     alignment and structure
>3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Back     alignment and structure
>3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A Back     alignment and structure
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} Back     alignment and structure
>3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} Back     alignment and structure
>2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Back     alignment and structure
>1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A Back     alignment and structure
>2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Back     alignment and structure
>3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Back     alignment and structure
>3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... Back     alignment and structure
>2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Back     alignment and structure
>1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* Back     alignment and structure
>4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Back     alignment and structure
>1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* Back     alignment and structure
>1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 Back     alignment and structure
>1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* Back     alignment and structure
>1b5f_A Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 Back     alignment and structure
>1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* Back     alignment and structure
>1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Back     alignment and structure
>4aa9_A Chymosin; hydrolase, aspartic peptidase, rennet; HET: NAG; 1.60A {Camelus dromedarius} PDB: 4aa8_A 1czi_E* 1cms_A 4cms_A 3cms_A Back     alignment and structure
>1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... Back     alignment and structure
>2jys_A Protease/reverse transcriptase; retroviral protease, hydrolase; NMR {Simian foamy virus type 1} Back     alignment and structure
>3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Back     alignment and structure
>1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A Back     alignment and structure
>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} Back     alignment and structure
>3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} SCOP: b.50.1.0 PDB: 3tne_A* Back     alignment and structure
>1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 Back     alignment and structure
>3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} SCOP: b.50.1.2 PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* Back     alignment and structure
>1qdm_A Prophytepsin; aspartic proteinases, saposin-like domain, zymogen structure, hydrolase; 2.30A {Hordeum vulgare} SCOP: a.64.1.2 b.50.1.2 Back     alignment and structure
>2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A Back     alignment and structure
>2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} Back     alignment and structure
>3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 Back     alignment and structure
>2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} Back     alignment and structure
>3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 4fse_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* Back     alignment and structure
>3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Back     alignment and structure
>1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* Back     alignment and structure
>3vf3_A Beta-secretase 1; structure-based drug design, hydrolase-hydrolase inhibitor C; HET: 0GS; 1.48A {Homo sapiens} PDB: 2f3e_A* 2f3f_A* 1ym2_A* 3dv1_A* 3dv5_A* 3k5c_A* 3k5f_A* 3k5g_A* 3pi5_A* 3qbh_A* 3duy_A* 3veu_A* 3vg1_A* 4d83_A* 4d88_A* 4d89_A* 4d8c_A* 3msk_A* 3k5d_A* 1ym4_A* ... Back     alignment and structure
>1lya_A Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_A* 1lyw_A* Back     alignment and structure
>1lya_B Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_B* 1lyw_B* Back     alignment and structure
>3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Back     alignment and structure
>1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Back     alignment and structure
>1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 Back     alignment and structure
>2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... Back     alignment and structure
>4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Back     alignment and structure
>1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Back     alignment and structure
>1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 Back     alignment and structure
>3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} SCOP: b.50.1.0 PDB: 3tne_A* Back     alignment and structure
>1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* Back     alignment and structure
>1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* Back     alignment and structure
>3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} Back     alignment and structure
>1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 Back     alignment and structure
>4aa9_A Chymosin; hydrolase, aspartic peptidase, rennet; HET: NAG; 1.60A {Camelus dromedarius} PDB: 4aa8_A 1czi_E* 1cms_A 4cms_A 3cms_A Back     alignment and structure
>1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A Back     alignment and structure
>2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} Back     alignment and structure
>1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A Back     alignment and structure
>2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A Back     alignment and structure
>3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... Back     alignment and structure
>2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Back     alignment and structure
>1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* Back     alignment and structure
>3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} SCOP: b.50.1.2 PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... Back     alignment and structure
>3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Back     alignment and structure
>1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Back     alignment and structure
>1t6e_X Xylanase inhibitor; two beta-barrel domain structure, hydrolase inhibitor; 1.70A {Triticum aestivum} SCOP: b.50.1.2 PDB: 1t6g_A 2b42_A 3hd8_A Back     alignment and structure
>3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} Back     alignment and structure
>2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Back     alignment and structure
>3vf3_A Beta-secretase 1; structure-based drug design, hydrolase-hydrolase inhibitor C; HET: 0GS; 1.48A {Homo sapiens} PDB: 2f3e_A* 2f3f_A* 1ym2_A* 3dv1_A* 3dv5_A* 3k5c_A* 3k5f_A* 3k5g_A* 3pi5_A* 3qbh_A* 3duy_A* 3veu_A* 3vg1_A* 4d83_A* 4d88_A* 4d89_A* 4d8c_A* 3msk_A* 3k5d_A* 1ym4_A* ... Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Back     alignment and structure
>3onh_A Ubiquitin-activating enzyme E1-like; ligase, SUMO conjugation, UBC9; 1.60A {Saccharomyces cerevisiae} PDB: 3ong_A Back     alignment and structure
>3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A Back     alignment and structure
>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} Back     alignment and structure
>3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 4fse_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* Back     alignment and structure
>2juo_A GA-binding protein alpha chain; OST, ubiquitin, transcription factor, ensemble, DNA-binding, nucleus, transcription regulation; NMR {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 319
d1wjna_97 d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse 9e-05
d2bwfa173 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyc 5e-04
d1v6ea_95 d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol 0.002
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: Tubulin-folding protein TbcE
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 38.7 bits (90), Expect = 9e-05
 Identities = 10/57 (17%), Positives = 23/57 (40%), Gaps = 7/57 (12%)

Query: 1  MDVEQFRLICQDECGIDATDMILLNNGKHL-------LEDGSCLKQAGVRDGDIILV 50
          M V++ + +      +  ++++L      +         D   L+   V +GD +LV
Sbjct: 33 MTVQKVKGLLSRLLKVPVSELLLSYESSKMPGREIELENDLQPLQFYSVENGDCLLV 89
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query319
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 99.5
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.44
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 99.42
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 99.41
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 99.41
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 99.4
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 99.39
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 99.39
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 99.39
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 99.39
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 99.39
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 99.38
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 99.36
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 99.35
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 99.35
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 99.34
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 99.34
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 99.33
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 99.32
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 99.32
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 99.29
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 99.26
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 99.26
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 99.25
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 99.22
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 99.21
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 99.18
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 99.17
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 99.17
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 99.16
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 99.12
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 99.09
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 99.07
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 99.06
d2fmba_104 EIAV protease {Equine infectious anemia virus [Tax 99.04
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 99.01
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 99.0
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 98.82
d4fiva_113 Feline immunodeficiency virus (FIV) protease {Feli 98.76
d2nmza199 Human immunodeficiency virus type 1 protease {Huma 98.68
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 98.56
d1hvca_203 Human immunodeficiency virus type 1 protease {Huma 98.55
d3ecga199 Human immunodeficiency virus type 2 (HIV-2) protea 98.52
d1nsoa_107 Mason-Pfizer monkey virus protease {Simian retrovi 98.43
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 98.03
d1hvca_203 Human immunodeficiency virus type 1 protease {Huma 97.92
d2f4mb158 XPC-binding domain of Rad23 homolog B (Hhr23b) {Hu 97.66
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 97.4
d2rspa_124 Rous sarcoma virus protease {Rous sarcoma virus, s 97.4
d2pmaa1141 Uncharacterized protein LPG0085 {Legionella pneumo 96.98
d1x3zb157 Rad23 STI1 domain {Baker's yeast (Saccharomyces ce 94.74
d1bxoa_323 Acid protease {Fungus (Penicillium janthinellum), 94.1
d1izea_323 Acid protease {Fungus (Aspergillus oryzae) [TaxId: 93.76
d1wkra_ 340 Acid protease {Irpex lacteus (Polyporus tulipifera 93.2
d2apra_ 325 Acid protease {Bread mold (Rhizopus chinensis) [Ta 93.14
d1smra_ 335 Chymosin (synonym: renin) {Mouse (Mus musculus) [T 92.8
d1miqa_ 373 Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo 92.73
d3psga_ 370 Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} 92.64
d1izea_ 323 Acid protease {Fungus (Aspergillus oryzae) [TaxId: 92.13
d1eaga_342 Acid protease {Yeast (Candida albicans) [TaxId: 54 92.1
d2qp8a1387 beta-secretase (memapsin) {Human (Homo sapiens) [T 91.92
d1wkra_340 Acid protease {Irpex lacteus (Polyporus tulipifera 91.91
d1bxoa_ 323 Acid protease {Fungus (Penicillium janthinellum), 91.87
d1oewa_ 330 Endothiapepsin {Chestnut blight fungus (Endothia p 91.27
d2apra_325 Acid protease {Bread mold (Rhizopus chinensis) [Ta 90.77
d2bjua1 329 Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo 90.67
g1htr.1 372 Pepsin(ogen) {Human (Homo sapiens), progastricsin 90.5
d1miqa_373 Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo 90.5
d1j71a_334 Acid protease {Yeast (Candida tropicalis) [TaxId: 90.47
d2bjua1329 Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo 90.04
d1dpja_329 Acid protease {Baker's yeast (Saccharomyces cerevi 90.02
d3cmsa_323 Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId 89.15
d1am5a_324 Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 88.47
d1mppa_357 Pepsin {Mucor pusillus [TaxId: 4840]} 87.9
g1htr.1372 Pepsin(ogen) {Human (Homo sapiens), progastricsin 87.16
d1dpja_ 329 Acid protease {Baker's yeast (Saccharomyces cerevi 86.86
g1lya.1 338 Cathepsin D {Human (Homo sapiens) [TaxId: 9606]} 86.81
d1t6ex_381 Xylanase inhibitor TAXI-I {Wheat (Triticum aestivu 86.0
d1h8ca_82 Fas-associated factor 1, Faf1 {Human (Homo sapiens 85.84
d1hrna_ 337 Chymosin (synonym: renin) {Human (Homo sapiens) [T 85.14
d3psga_370 Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} 84.74
d1i42a_89 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 84.34
d1smra_335 Chymosin (synonym: renin) {Mouse (Mus musculus) [T 83.9
d1oewa_330 Endothiapepsin {Chestnut blight fungus (Endothia p 83.6
d1am5a_ 324 Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 83.3
d2qp8a1 387 beta-secretase (memapsin) {Human (Homo sapiens) [T 82.56
d1hrna_337 Chymosin (synonym: renin) {Human (Homo sapiens) [T 82.21
d1j71a_ 334 Acid protease {Yeast (Candida tropicalis) [TaxId: 82.18
g1lya.1338 Cathepsin D {Human (Homo sapiens) [TaxId: 9606]} 81.46
d1mppa_ 357 Pepsin {Mucor pusillus [TaxId: 4840]} 81.33
g1b5f.1 326 Plant acid proteinase, phytepsin {Cynara carduncul 80.46
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 80.2
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-Grasp (ubiquitin-like)
superfamily: Ubiquitin-like
family: Ubiquitin-related
domain: 1700011n24rik protein
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.50  E-value=1.1e-14  Score=114.18  Aligned_cols=55  Identities=24%  Similarity=0.553  Sum_probs=50.8

Q ss_pred             CCHHHHHHHHHhhhCCCCCCeEEEecCeeccCCcccccccCCCCCcEEEEEccCC
Q psy17672          1 MDVEQFRLICQDECGIDATDMILLNNGKHLLEDGSCLKQAGVRDGDIILVAMPGR   55 (319)
Q Consensus         1 ~tv~~lK~~i~~e~gip~~~q~Li~~Gk~L~d~~~tL~~~gI~~~d~l~l~~~~~   55 (319)
                      +||.+||++|+.++|||+++|+|+|+||.|.||.+||++|||++||+|+|+.+..
T Consensus        32 ~tV~~LK~~Ie~~~gip~~~Q~Li~~Gk~L~dd~~tL~~~gI~~g~~i~l~~r~~   86 (102)
T d1v5oa_          32 FELSNFRVLCELESGVPAEEAQIVYMEQLLTDDHCSLGSYGLKDGDMVVLLQKDN   86 (102)
T ss_dssp             CBHHHHHHHHHHHTCCCGGGBCEEETTEEECCSSSBHHHHTCCTTEEEEECBCCC
T ss_pred             ccHHHHHHHHHHHhCCCcceEEEEeCCeEeecccCCHHHcCCCCCCEEEEEECCC
Confidence            5899999999999999999999999999997657899999999999999987643
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fmba_ b.50.1.1 (A:) EIAV protease {Equine infectious anemia virus [TaxId: 11665]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d4fiva_ b.50.1.1 (A:) Feline immunodeficiency virus (FIV) protease {Feline immunodeficiency virus [TaxId: 11673]} Back     information, alignment and structure
>d2nmza1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hvca_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} Back     information, alignment and structure
>d3ecga1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
>d1nsoa_ b.50.1.1 (A:) Mason-Pfizer monkey virus protease {Simian retrovirus 1, SRV-1 [TaxId: 11942]} Back     information, alignment and structure
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hvca_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} Back     information, alignment and structure
>d2f4mb1 a.189.1.1 (B:275-332) XPC-binding domain of Rad23 homolog B (Hhr23b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rspa_ b.50.1.1 (A:) Rous sarcoma virus protease {Rous sarcoma virus, strain pr-C [TaxId: 11886]} Back     information, alignment and structure
>d2pmaa1 b.50.1.3 (A:26-166) Uncharacterized protein LPG0085 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1x3zb1 a.189.1.1 (B:253-309) Rad23 STI1 domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} Back     information, alignment and structure
>d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} Back     information, alignment and structure
>d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} Back     information, alignment and structure
>d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} Back     information, alignment and structure
>d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} Back     information, alignment and structure
>d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} Back     information, alignment and structure
>d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} Back     information, alignment and structure
>d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} Back     information, alignment and structure
>d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} Back     information, alignment and structure
>d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} Back     information, alignment and structure
>d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} Back     information, alignment and structure
>d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} Back     information, alignment and structure
>d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Back     information, alignment and structure
>d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} Back     information, alignment and structure
>d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oewa_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]} Back     information, alignment and structure
>d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} Back     information, alignment and structure
>d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure