Psyllid ID: psy17689
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 216 | ||||||
| 58385914 | 332 | AGAP004880-PB [Anopheles gambiae str. PE | 0.958 | 0.623 | 0.681 | 1e-81 | |
| 170063026 | 331 | l-lactate dehydrogenase [Culex quinquefa | 0.953 | 0.622 | 0.669 | 5e-81 | |
| 170058421 | 331 | l-lactate dehydrogenase [Culex quinquefa | 0.953 | 0.622 | 0.665 | 8e-81 | |
| 157131170 | 331 | l-lactate dehydrogenase [Aedes aegypti] | 0.953 | 0.622 | 0.679 | 9e-81 | |
| 312381230 | 479 | hypothetical protein AND_06519 [Anophele | 0.925 | 0.417 | 0.7 | 6e-80 | |
| 330371803 | 332 | lactate dehydrogenase [Litopenaeus vanna | 0.958 | 0.623 | 0.666 | 1e-78 | |
| 330371799 | 332 | lactate dehydrogenase [Litopenaeus vanna | 0.958 | 0.623 | 0.666 | 1e-78 | |
| 330371801 | 332 | lactate dehydrogenase [Litopenaeus vanna | 0.958 | 0.623 | 0.666 | 1e-78 | |
| 330371797 | 332 | lactate dehydrogenase [Litopenaeus vanna | 0.958 | 0.623 | 0.661 | 3e-78 | |
| 126038 | 333 | RecName: Full=L-lactate dehydrogenase B | 0.912 | 0.591 | 0.670 | 5e-78 |
| >gi|58385914|ref|XP_314306.2| AGAP004880-PB [Anopheles gambiae str. PEST] gi|158292996|ref|XP_001688555.1| AGAP004880-PC [Anopheles gambiae str. PEST] gi|158292998|ref|XP_001688556.1| AGAP004880-PA [Anopheles gambiae str. PEST] gi|55240259|gb|EAA09690.2| AGAP004880-PB [Anopheles gambiae str. PEST] gi|157016894|gb|EDO64032.1| AGAP004880-PC [Anopheles gambiae str. PEST] gi|157016895|gb|EDO64033.1| AGAP004880-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
Score = 308 bits (788), Expect = 1e-81, Method: Compositional matrix adjust.
Identities = 141/207 (68%), Positives = 174/207 (84%)
Query: 10 FKGVNVLTRLNYALSEGSRIVIVTAGVRQREGESRLSLVERNVNIFKGIIPNIVKYSPQC 69
K +V ++++S GSR++++TAGVRQ+EGESRL LV+RN +I KGIIP +V SP C
Sbjct: 72 MKNAHVSAGTDFSVSAGSRLIVITAGVRQKEGESRLDLVQRNTDILKGIIPKLVAQSPDC 131
Query: 70 TLLIVSNPVDILTYVSWKLSGFPKNRVIGSGTNLDSMRFRVLLAQKLGLSPESVYGFIIG 129
LL+VSNPVDILTYV+WKLSG PKNRVIGSGTNLDS RFR L++QKLG++P S +G+IIG
Sbjct: 132 ILLVVSNPVDILTYVAWKLSGLPKNRVIGSGTNLDSSRFRFLMSQKLGVAPTSCHGWIIG 191
Query: 130 EHGDSSVPVWSGVNVAGVNLREVNPAIGTEGDTEEFGKLHTDVVNSAYEIIRLKGYTSWA 189
EHGDSSVPVWSGVNVAGV L E+NP+IGT+ DTE++G LH VVNSAYE+IRLKGYTSWA
Sbjct: 192 EHGDSSVPVWSGVNVAGVRLAEINPSIGTDADTEKWGDLHHQVVNSAYEVIRLKGYTSWA 251
Query: 190 IGLSIASLTYTLLNNTNKIHAISTLIQ 216
IGLS+ASL +L NT +HA+STL++
Sbjct: 252 IGLSVASLASAILRNTYNVHAVSTLVK 278
|
Source: Anopheles gambiae str. PEST Species: Anopheles gambiae Genus: Anopheles Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|170063026|ref|XP_001866924.1| l-lactate dehydrogenase [Culex quinquefasciatus] gi|167880810|gb|EDS44193.1| l-lactate dehydrogenase [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|170058421|ref|XP_001864915.1| l-lactate dehydrogenase [Culex quinquefasciatus] gi|167877547|gb|EDS40930.1| l-lactate dehydrogenase [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|157131170|ref|XP_001662150.1| l-lactate dehydrogenase [Aedes aegypti] gi|108871618|gb|EAT35843.1| AAEL012014-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|312381230|gb|EFR27023.1| hypothetical protein AND_06519 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|330371803|gb|AEC12822.1| lactate dehydrogenase [Litopenaeus vannamei] | Back alignment and taxonomy information |
|---|
| >gi|330371799|gb|AEC12820.1| lactate dehydrogenase [Litopenaeus vannamei] gi|385211790|gb|AFI47929.1| L-lactate dehydrogenase isoform 1 [Litopenaeus vannamei] | Back alignment and taxonomy information |
|---|
| >gi|330371801|gb|AEC12821.1| lactate dehydrogenase [Litopenaeus vannamei] | Back alignment and taxonomy information |
|---|
| >gi|330371797|gb|AEC12819.1| lactate dehydrogenase [Litopenaeus vannamei] gi|385211791|gb|AFI47930.1| L-lactate dehydrogenase isoform 2 [Litopenaeus vannamei] | Back alignment and taxonomy information |
|---|
| >gi|126038|sp|P13743.2|LDHB_ANAPL RecName: Full=L-lactate dehydrogenase B chain; Short=LDH-B; AltName: Full=Epsilon-crystallin | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 216 | ||||||
| ZFIN|ZDB-GENE-040718-176 | 388 | ldhbb "lactate dehydrogenase B | 0.736 | 0.409 | 0.647 | 4.6e-78 | |
| RGD|2996 | 332 | Ldha "lactate dehydrogenase A" | 0.972 | 0.632 | 0.627 | 5.3e-72 | |
| UNIPROTKB|P00337 | 333 | LDHB "L-lactate dehydrogenase | 0.912 | 0.591 | 0.670 | 1.1e-71 | |
| ZFIN|ZDB-GENE-991026-5 | 333 | ldha "lactate dehydrogenase A4 | 0.972 | 0.630 | 0.622 | 4.8e-71 | |
| MGI|MGI:96759 | 332 | Ldha "lactate dehydrogenase A" | 0.972 | 0.632 | 0.622 | 7.7e-71 | |
| ZFIN|ZDB-GENE-991026-6 | 334 | ldhba "lactate dehydrogenase B | 0.972 | 0.628 | 0.627 | 7.7e-71 | |
| UNIPROTKB|P19858 | 332 | LDHA "L-lactate dehydrogenase | 0.935 | 0.608 | 0.643 | 9.9e-71 | |
| MGI|MGI:96763 | 334 | Ldhb "lactate dehydrogenase B" | 0.912 | 0.589 | 0.654 | 1.3e-70 | |
| RGD|2997 | 334 | Ldhb "lactate dehydrogenase B" | 0.912 | 0.589 | 0.654 | 1.3e-70 | |
| UNIPROTKB|E2RA64 | 279 | LDHA "L-lactate dehydrogenase" | 0.935 | 0.724 | 0.633 | 2.1e-70 |
| ZFIN|ZDB-GENE-040718-176 ldhbb "lactate dehydrogenase Bb" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 579 (208.9 bits), Expect = 4.6e-78, Sum P(2) = 4.6e-78
Identities = 103/159 (64%), Positives = 134/159 (84%)
Query: 58 IIPNIVKYSPQCTLLIVSNPVDILTYVSWKLSGFPKNRVIGSGTNLDSMRFRVLLAQKLG 117
IIP IVKYSP C L++VSNPVD+LTYV+WKLSG PK+RVIGSGTNLDS RFR L+A++LG
Sbjct: 175 IIPQIVKYSPNCILIVVSNPVDVLTYVTWKLSGLPKHRVIGSGTNLDSARFRYLMAERLG 234
Query: 118 LSPESVYGFIIGEHGDSSVPVWSGVNVAGVNLREVNPAIGTEGDTEEFGKLHTDVVNSAY 177
+ P S G+I+GEHGDSSVPVWSG NVAGV+L+++NP IG + D E + + H VV+SAY
Sbjct: 235 IHPSSFNGWILGEHGDSSVPVWSGANVAGVSLQKLNPDIGKDTDRENWKETHKKVVDSAY 294
Query: 178 EIIRLKGYTSWAIGLSIASLTYTLLNNTNKIHAISTLIQ 216
E+IRLKGYT+WAIGLS+A LT +++ N N++H +ST+++
Sbjct: 295 EVIRLKGYTNWAIGLSVADLTESIMKNLNRVHPVSTMVK 333
|
|
| RGD|2996 Ldha "lactate dehydrogenase A" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P00337 LDHB "L-lactate dehydrogenase B chain" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-991026-5 ldha "lactate dehydrogenase A4" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:96759 Ldha "lactate dehydrogenase A" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-991026-6 ldhba "lactate dehydrogenase Ba" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P19858 LDHA "L-lactate dehydrogenase A chain" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:96763 Ldhb "lactate dehydrogenase B" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|2997 Ldhb "lactate dehydrogenase B" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RA64 LDHA "L-lactate dehydrogenase" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 216 | |||
| cd05293 | 312 | cd05293, LDH_1, A subgroup of L-lactate dehydrogen | 1e-118 | |
| TIGR01771 | 299 | TIGR01771, L-LDH-NAD, L-lactate dehydrogenase | 1e-94 | |
| cd05292 | 308 | cd05292, LDH_2, A subgroup of L-lactate dehydrogen | 3e-94 | |
| PLN02602 | 350 | PLN02602, PLN02602, lactate dehydrogenase | 2e-93 | |
| PRK00066 | 315 | PRK00066, ldh, L-lactate dehydrogenase; Reviewed | 2e-83 | |
| cd00300 | 300 | cd00300, LDH_like, L-lactate dehydrogenase-like en | 2e-82 | |
| cd05291 | 306 | cd05291, HicDH_like, L-2-hydroxyisocapronate dehyd | 3e-73 | |
| COG0039 | 313 | COG0039, Mdh, Malate/lactate dehydrogenases [Energ | 1e-70 | |
| PRK06223 | 307 | PRK06223, PRK06223, malate dehydrogenase; Reviewed | 2e-59 | |
| cd01339 | 300 | cd01339, LDH-like_MDH, L-lactate dehydrogenase-lik | 1e-55 | |
| cd05290 | 307 | cd05290, LDH_3, A subgroup of L-lactate dehydrogen | 1e-50 | |
| cd00650 | 263 | cd00650, LDH_MDH_like, NAD-dependent, lactate dehy | 4e-44 | |
| cd05294 | 309 | cd05294, LDH-like_MDH_nadp, A lactate dehydrogenas | 3e-43 | |
| PTZ00082 | 321 | PTZ00082, PTZ00082, L-lactate dehydrogenase; Provi | 1e-36 | |
| TIGR01763 | 305 | TIGR01763, MalateDH_bact, malate dehydrogenase, NA | 2e-36 | |
| pfam00056 | 142 | pfam00056, Ldh_1_N, lactate/malate dehydrogenase, | 1e-35 | |
| PTZ00117 | 319 | PTZ00117, PTZ00117, malate dehydrogenase; Provisio | 3e-34 | |
| pfam02866 | 173 | pfam02866, Ldh_1_C, lactate/malate dehydrogenase, | 1e-19 | |
| cd01337 | 310 | cd01337, MDH_glyoxysomal_mitochondrial, Glyoxysoma | 6e-13 | |
| PTZ00325 | 321 | PTZ00325, PTZ00325, malate dehydrogenase; Provisio | 1e-10 | |
| cd00704 | 323 | cd00704, MDH, Malate dehydrogenase | 7e-10 | |
| PLN00106 | 323 | PLN00106, PLN00106, malate dehydrogenase | 5e-09 | |
| TIGR01772 | 312 | TIGR01772, MDH_euk_gproteo, malate dehydrogenase, | 8e-09 | |
| PRK05086 | 312 | PRK05086, PRK05086, malate dehydrogenase; Provisio | 4e-08 | |
| TIGR01759 | 323 | TIGR01759, MalateDH-SF1, malate dehydrogenase | 1e-07 | |
| TIGR01758 | 324 | TIGR01758, MDH_euk_cyt, malate dehydrogenase, NAD- | 2e-07 | |
| TIGR01756 | 313 | TIGR01756, LDH_protist, lactate dehydrogenase | 2e-07 | |
| cd01336 | 325 | cd01336, MDH_cytoplasmic_cytosolic, Cytoplasmic an | 4e-06 | |
| PLN00135 | 309 | PLN00135, PLN00135, malate dehydrogenase | 8e-05 |
| >gnl|CDD|133429 cd05293, LDH_1, A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
Score = 338 bits (869), Expect = e-118
Identities = 131/196 (66%), Positives = 169/196 (86%)
Query: 21 YALSEGSRIVIVTAGVRQREGESRLSLVERNVNIFKGIIPNIVKYSPQCTLLIVSNPVDI 80
Y+++ S++VIVTAG RQ EGESRL LV+RNV+IFKGIIP +VKYSP LL+VSNPVDI
Sbjct: 66 YSVTANSKVVIVTAGARQNEGESRLDLVQRNVDIFKGIIPKLVKYSPNAILLVVSNPVDI 125
Query: 81 LTYVSWKLSGFPKNRVIGSGTNLDSMRFRVLLAQKLGLSPESVYGFIIGEHGDSSVPVWS 140
+TYV+WKLSG PK+RVIGSG NLDS RFR L+A++LG++P SV+G+IIGEHGDSSVPVWS
Sbjct: 126 MTYVAWKLSGLPKHRVIGSGCNLDSARFRYLIAERLGVAPSSVHGWIIGEHGDSSVPVWS 185
Query: 141 GVNVAGVNLREVNPAIGTEGDTEEFGKLHTDVVNSAYEIIRLKGYTSWAIGLSIASLTYT 200
GVNVAGV L+++NP IGT+ D E++ ++H VV+SAYE+I+LKGYTSWAIGLS+A L
Sbjct: 186 GVNVAGVRLQDLNPDIGTDKDPEKWKEVHKQVVDSAYEVIKLKGYTSWAIGLSVADLVDA 245
Query: 201 LLNNTNKIHAISTLIQ 216
+L NT ++H++STL++
Sbjct: 246 ILRNTGRVHSVSTLVK 261
|
L-lactate dehydrogenases (LDH) are tetrameric enzymes catalyzing the last step of glycolysis in which pyruvate is converted to L-lactate. This subgroup is composed of eukaryotic LDHs. Vertebrate LDHs are non-allosteric. This is in contrast to some bacterial LDHs that are activated by an allosteric effector such as fructose-1,6-bisphosphate. LDHs are part of the NAD(P)-binding Rossmann fold superfamily, which includes a wide variety of protein families including the NAD(P)-binding domains of alcohol dehydrogenases, tyrosine-dependent oxidoreductases, glyceraldehyde-3-phosphate dehydrogenases, formate/glycerate dehydrogenases, siroheme synthases, 6-phosphogluconate dehydrogenases, aminoacid dehydrogenases, repressor rex, and NAD-binding potassium channel domains, among others. Length = 312 |
| >gnl|CDD|233566 TIGR01771, L-LDH-NAD, L-lactate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|133428 cd05292, LDH_2, A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|178212 PLN02602, PLN02602, lactate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|178836 PRK00066, ldh, L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|133418 cd00300, LDH_like, L-lactate dehydrogenase-like enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|133427 cd05291, HicDH_like, L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|223117 COG0039, Mdh, Malate/lactate dehydrogenases [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|180477 PRK06223, PRK06223, malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >gnl|CDD|133424 cd01339, LDH-like_MDH, L-lactate dehydrogenase-like malate dehydrogenase proteins | Back alignment and domain information |
|---|
| >gnl|CDD|133426 cd05290, LDH_3, A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|133419 cd00650, LDH_MDH_like, NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family | Back alignment and domain information |
|---|
| >gnl|CDD|133430 cd05294, LDH-like_MDH_nadp, A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity | Back alignment and domain information |
|---|
| >gnl|CDD|173376 PTZ00082, PTZ00082, L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233562 TIGR01763, MalateDH_bact, malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >gnl|CDD|200963 pfam00056, Ldh_1_N, lactate/malate dehydrogenase, NAD binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|173409 PTZ00117, PTZ00117, malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|202437 pfam02866, Ldh_1_C, lactate/malate dehydrogenase, alpha/beta C-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|133422 cd01337, MDH_glyoxysomal_mitochondrial, Glyoxysomal and mitochondrial malate dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|240360 PTZ00325, PTZ00325, malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133420 cd00704, MDH, Malate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|215058 PLN00106, PLN00106, malate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|130833 TIGR01772, MDH_euk_gproteo, malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >gnl|CDD|235340 PRK05086, PRK05086, malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|130820 TIGR01759, MalateDH-SF1, malate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|130819 TIGR01758, MDH_euk_cyt, malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >gnl|CDD|130817 TIGR01756, LDH_protist, lactate dehydrogenase | Back alignment and domain information |
|---|
| >gnl|CDD|133421 cd01336, MDH_cytoplasmic_cytosolic, Cytoplasmic and cytosolic Malate dehydrogenases | Back alignment and domain information |
|---|
| >gnl|CDD|177744 PLN00135, PLN00135, malate dehydrogenase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 216 | |||
| COG0039 | 313 | Mdh Malate/lactate dehydrogenases [Energy producti | 100.0 | |
| KOG1495|consensus | 332 | 100.0 | ||
| cd05290 | 307 | LDH_3 A subgroup of L-lactate dehydrogenases. L-la | 100.0 | |
| TIGR01771 | 299 | L-LDH-NAD L-lactate dehydrogenase. This model repr | 100.0 | |
| cd05293 | 312 | LDH_1 A subgroup of L-lactate dehydrogenases. L-la | 100.0 | |
| PLN02602 | 350 | lactate dehydrogenase | 100.0 | |
| PLN00135 | 309 | malate dehydrogenase | 100.0 | |
| PRK00066 | 315 | ldh L-lactate dehydrogenase; Reviewed | 100.0 | |
| TIGR01757 | 387 | Malate-DH_plant malate dehydrogenase, NADP-depende | 100.0 | |
| cd05291 | 306 | HicDH_like L-2-hydroxyisocapronate dehydrogenases | 100.0 | |
| TIGR01756 | 313 | LDH_protist lactate dehydrogenase. This model repr | 100.0 | |
| TIGR01759 | 323 | MalateDH-SF1 malate dehydrogenase. This model repr | 100.0 | |
| PLN00112 | 444 | malate dehydrogenase (NADP); Provisional | 100.0 | |
| PRK05442 | 326 | malate dehydrogenase; Provisional | 100.0 | |
| cd00300 | 300 | LDH_like L-lactate dehydrogenase-like enzymes. Mem | 100.0 | |
| cd05292 | 308 | LDH_2 A subgroup of L-lactate dehydrogenases. L-la | 100.0 | |
| cd00704 | 323 | MDH Malate dehydrogenase. Malate dehydrogenase (MD | 100.0 | |
| TIGR01763 | 305 | MalateDH_bact malate dehydrogenase, NAD-dependent. | 100.0 | |
| TIGR01758 | 324 | MDH_euk_cyt malate dehydrogenase, NAD-dependent. T | 100.0 | |
| PTZ00082 | 321 | L-lactate dehydrogenase; Provisional | 100.0 | |
| cd01338 | 322 | MDH_choloroplast_like Chloroplast-like malate dehy | 100.0 | |
| cd05294 | 309 | LDH-like_MDH_nadp A lactate dehydrogenases-like st | 100.0 | |
| cd01337 | 310 | MDH_glyoxysomal_mitochondrial Glyoxysomal and mito | 100.0 | |
| PTZ00117 | 319 | malate dehydrogenase; Provisional | 100.0 | |
| TIGR01772 | 312 | MDH_euk_gproteo malate dehydrogenase, NAD-dependen | 100.0 | |
| cd05295 | 452 | MDH_like Malate dehydrogenase-like. These MDH-like | 100.0 | |
| cd01336 | 325 | MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli | 100.0 | |
| cd01339 | 300 | LDH-like_MDH L-lactate dehydrogenase-like malate d | 100.0 | |
| PTZ00325 | 321 | malate dehydrogenase; Provisional | 100.0 | |
| PRK06223 | 307 | malate dehydrogenase; Reviewed | 100.0 | |
| PRK05086 | 312 | malate dehydrogenase; Provisional | 100.0 | |
| PLN00106 | 323 | malate dehydrogenase | 100.0 | |
| cd00650 | 263 | LDH_MDH_like NAD-dependent, lactate dehydrogenase- | 100.0 | |
| KOG1494|consensus | 345 | 100.0 | ||
| KOG1496|consensus | 332 | 100.0 | ||
| PF02866 | 174 | Ldh_1_C: lactate/malate dehydrogenase, alpha/beta | 99.97 | |
| PF00056 | 141 | Ldh_1_N: lactate/malate dehydrogenase, NAD binding | 99.94 | |
| cd05197 | 425 | GH4_glycoside_hydrolases Glycoside Hydrases Family | 99.91 | |
| PRK15076 | 431 | alpha-galactosidase; Provisional | 99.89 | |
| cd05296 | 419 | GH4_P_beta_glucosidase Glycoside Hydrolases Family | 99.89 | |
| cd05298 | 437 | GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; | 99.82 | |
| cd05297 | 423 | GH4_alpha_glucosidase_galactosidase Glycoside Hydr | 99.81 | |
| COG1486 | 442 | CelF Alpha-galactosidases/6-phospho-beta-glucosida | 99.44 | |
| PF02056 | 183 | Glyco_hydro_4: Family 4 glycosyl hydrolase; InterP | 99.35 | |
| COG1004 | 414 | Ugd Predicted UDP-glucose 6-dehydrogenase [Cell en | 91.46 | |
| TIGR00640 | 132 | acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal | 90.03 | |
| PRK05808 | 282 | 3-hydroxybutyryl-CoA dehydrogenase; Validated | 88.96 | |
| TIGR01915 | 219 | npdG NADPH-dependent F420 reductase. This model re | 85.84 |
| >COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.9e-65 Score=447.01 Aligned_cols=211 Identities=42% Similarity=0.697 Sum_probs=196.7
Q ss_pred ccccCCCCCCC-ceEEEc-CCccccCCccEEEEcCCCCCCCCcCHHHHHHHhHHHHHHHHHHHHhhCCCeEEEEEcCchh
Q psy17689 2 LTTNDHSSFKG-VNVLTR-LNYALSEGSRIVIVTAGVRQREGESRLSLVERNVNIFKGIIPNIVKYSPQCTLLIVSNPVD 79 (216)
Q Consensus 2 ~~~~d~~~~~~-~~v~~~-~~~~~~~daDivvitag~~~k~g~~r~dll~~N~~i~~~i~~~i~~~~p~~iiivvtNPvd 79 (216)
++++|++++.. ...+.. ++|++|+|||+||||||.||||||+|+||+..|++|++++++++++++|+++++|+|||+|
T Consensus 43 ~DL~~~~~~~~~~~~i~~~~~y~~~~~aDiVvitAG~prKpGmtR~DLl~~Na~I~~~i~~~i~~~~~d~ivlVvtNPvD 122 (313)
T COG0039 43 LDLSHAAAPLGSDVKITGDGDYEDLKGADIVVITAGVPRKPGMTRLDLLEKNAKIVKDIAKAIAKYAPDAIVLVVTNPVD 122 (313)
T ss_pred cchhhcchhccCceEEecCCChhhhcCCCEEEEeCCCCCCCCCCHHHHHHhhHHHHHHHHHHHHhhCCCeEEEEecCcHH
Confidence 56677766643 333333 5699999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhcCCCCCCEEeeccchhHHHHHHHHHHHhCCCCCceeEEEEccCCCCcccceeeeeECCeeccccCccCCCC
Q psy17689 80 ILTYVSWKLSGFPKNRVIGSGTNLDSMRFRVLLAQKLGLSPESVYGFIIGEHGDSSVPVWSGVNVAGVNLREVNPAIGTE 159 (216)
Q Consensus 80 ~~t~~~~~~sg~~~~~viG~Gt~lds~R~~~~la~~l~v~~~~v~~~v~G~HGds~vp~~S~~~v~g~~l~~~~~~~~~~ 159 (216)
+|||++|+.+|+|++||||+||.|||+||+++||++++++|++|++||+|||||||||+||+++|+|+|+.++++.
T Consensus 123 ~~ty~~~k~sg~p~~rvig~gt~LDsaR~~~~lae~~~v~~~~V~~~ViGeHGdt~vp~~S~a~v~G~pl~~~~~~---- 198 (313)
T COG0039 123 ILTYIAMKFSGFPKNRVIGSGTVLDSARFRTFLAEKLGVSPKDVHAYVIGEHGDTMVPLWSQATVGGKPLEELLKE---- 198 (313)
T ss_pred HHHHHHHHhcCCCccceecccchHHHHHHHHHHHHHhCCChhHceeeEeccCCCceEEeeeeeeECCEEHHHHhhc----
Confidence 9999999999999999999999999999999999999999999999999999999999999999999999999863
Q ss_pred CCHHHHHHHHHHHHHHHHHHHHhhCC-CChhHHHHHHHHHHHHHcCCCceEEEEeeeC
Q psy17689 160 GDTEEFGKLHTDVVNSAYEIIRLKGY-TSWAIGLSIASLTYTLLNNTNKIHAISTLIQ 216 (216)
Q Consensus 160 ~~~~~~~~l~~~v~~~g~~ii~~Kg~-t~~~~a~a~~~ii~ail~~~~~ilpvS~~l~ 216 (216)
.++++++++.++||++|++|++.||+ |+||+|.|+++|+++|++|+++++|+|++++
T Consensus 199 ~~~~~~~~i~~~v~~~g~eII~~kG~~t~~~~A~a~a~~~~ail~d~~~vl~~s~~l~ 256 (313)
T COG0039 199 DTEEDLEELIERVRNAGAEIIEAKGAGTYYGPAAALARMVEAILRDEKRVLPVSVYLD 256 (313)
T ss_pred ccHhHHHHHHHHHHhhHHHHHHccCccchhhHHHHHHHHHHHHHcCCCceEEEEEeec
Confidence 24567899999999999999999988 9999999999999999999999999999985
|
|
| >KOG1495|consensus | Back alignment and domain information |
|---|
| >cd05290 LDH_3 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >TIGR01771 L-LDH-NAD L-lactate dehydrogenase | Back alignment and domain information |
|---|
| >cd05293 LDH_1 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >PLN02602 lactate dehydrogenase | Back alignment and domain information |
|---|
| >PLN00135 malate dehydrogenase | Back alignment and domain information |
|---|
| >PRK00066 ldh L-lactate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01757 Malate-DH_plant malate dehydrogenase, NADP-dependent | Back alignment and domain information |
|---|
| >cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >TIGR01756 LDH_protist lactate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01759 MalateDH-SF1 malate dehydrogenase | Back alignment and domain information |
|---|
| >PLN00112 malate dehydrogenase (NADP); Provisional | Back alignment and domain information |
|---|
| >PRK05442 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd00300 LDH_like L-lactate dehydrogenase-like enzymes | Back alignment and domain information |
|---|
| >cd05292 LDH_2 A subgroup of L-lactate dehydrogenases | Back alignment and domain information |
|---|
| >cd00704 MDH Malate dehydrogenase | Back alignment and domain information |
|---|
| >TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >TIGR01758 MDH_euk_cyt malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >PTZ00082 L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd01338 MDH_choloroplast_like Chloroplast-like malate dehydrogenases | Back alignment and domain information |
|---|
| >cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity | Back alignment and domain information |
|---|
| >cd01337 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochondrial malate dehydrogenases | Back alignment and domain information |
|---|
| >PTZ00117 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01772 MDH_euk_gproteo malate dehydrogenase, NAD-dependent | Back alignment and domain information |
|---|
| >cd05295 MDH_like Malate dehydrogenase-like | Back alignment and domain information |
|---|
| >cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases | Back alignment and domain information |
|---|
| >cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins | Back alignment and domain information |
|---|
| >PTZ00325 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PRK06223 malate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK05086 malate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >PLN00106 malate dehydrogenase | Back alignment and domain information |
|---|
| >cd00650 LDH_MDH_like NAD-dependent, lactate dehydrogenase-like, 2-hydroxycarboxylate dehydrogenase family | Back alignment and domain information |
|---|
| >KOG1494|consensus | Back alignment and domain information |
|---|
| >KOG1496|consensus | Back alignment and domain information |
|---|
| >PF02866 Ldh_1_C: lactate/malate dehydrogenase, alpha/beta C-terminal domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR022383 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] | Back alignment and domain information |
|---|
| >cd05197 GH4_glycoside_hydrolases Glycoside Hydrases Family 4 | Back alignment and domain information |
|---|
| >PRK15076 alpha-galactosidase; Provisional | Back alignment and domain information |
|---|
| >cd05296 GH4_P_beta_glucosidase Glycoside Hydrolases Family 4; Phospho-beta-glucosidase | Back alignment and domain information |
|---|
| >cd05298 GH4_GlvA_pagL_like Glycoside Hydrolases Family 4; GlvA- and pagL-like glycosidases | Back alignment and domain information |
|---|
| >cd05297 GH4_alpha_glucosidase_galactosidase Glycoside Hydrolases Family 4; Alpha-glucosidases and alpha-galactosidases | Back alignment and domain information |
|---|
| >COG1486 CelF Alpha-galactosidases/6-phospho-beta-glucosidases, family 4 of glycosyl hydrolases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF02056 Glyco_hydro_4: Family 4 glycosyl hydrolase; InterPro: IPR001088 O-Glycosyl hydrolases 3 | Back alignment and domain information |
|---|
| >COG1004 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR00640 acid_CoA_mut_C methylmalonyl-CoA mutase C-terminal domain | Back alignment and domain information |
|---|
| >PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR01915 npdG NADPH-dependent F420 reductase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 216 | ||||
| 4aj4_A | 332 | Rat Ldha In Complex With 4-((2-Allylsulfanyl-1,3-Be | 2e-80 | ||
| 4aj1_A | 331 | Rat Ldha In Complex With N-(2-(Methylamino)-1,3- Be | 2e-80 | ||
| 2v65_A | 331 | Apo Ldh From The Psychrophile C. Gunnari Length = 3 | 2e-79 | ||
| 9ldt_A | 332 | Design And Synthesis Of New Enzymes Based On The La | 2e-78 | ||
| 1i0z_A | 333 | Human Heart L-Lactate Dehydrogenase H Chain, Ternar | 9e-78 | ||
| 1t2f_A | 333 | Human B Lactate Dehydrogenase Complexed With Nad+ A | 1e-77 | ||
| 1v6a_A | 332 | Crystal Structure Of L-Lactate Dehydrogenase From C | 1e-77 | ||
| 1i10_A | 331 | Human Muscle L-Lactate Dehydrogenase M Chain, Terna | 2e-77 | ||
| 4ajp_A | 337 | Human Ldha In Complex With 2-((4-(4-((3-((2-Methyl- | 2e-77 | ||
| 3h3f_A | 331 | Rabbit Muscle L-Lactate Dehydrogenase In Complex Wi | 3e-77 | ||
| 5ldh_A | 334 | Structure Of The Active Ternary Complex Of Pig Hear | 1e-76 | ||
| 6ldh_A | 330 | Refined Crystal Structure Of Dogfish M4 Apo-Lactate | 7e-71 | ||
| 1ldm_A | 329 | Refined Crystal Structure Of Dogfish M4 Apo-Lactate | 7e-71 | ||
| 2ldx_A | 331 | Characterization Of The Antigenic Sites On The Refi | 6e-66 | ||
| 3ldh_A | 330 | A Comparison Of The Structures Of Apo Dogfish M4 La | 3e-48 | ||
| 3pqd_A | 326 | Crystal Structure Of L-Lactate Dehydrogenase From B | 9e-47 | ||
| 1lld_A | 319 | Molecular Basis Of Allosteric Activation Of Bacteri | 3e-46 | ||
| 3pqe_A | 326 | Crystal Structure Of L-Lactate Dehydrogenase From B | 3e-46 | ||
| 4a73_A | 310 | Single Point Mutant Of Thermus Thermophilus Lactate | 1e-45 | ||
| 2v6m_A | 310 | Crystal Structure Of Lactate Dehydrogenase From The | 2e-45 | ||
| 2xxb_A | 310 | Penta-Mutant Of Thermus Thermophilus Lactate Dehydr | 4e-45 | ||
| 2e37_A | 310 | Structure Of Tt0471 Protein From Thermus Thermophil | 5e-45 | ||
| 3vku_A | 326 | Penta Mutant Of Lactobacillus Casei Lactate Dehydro | 2e-44 | ||
| 2zqy_A | 326 | T-State Structure Of Allosteric L-Lactate Dehydroge | 3e-44 | ||
| 1llc_A | 325 | Structure Determination Of The Allosteric L-Lactate | 9e-44 | ||
| 1y6j_A | 318 | L-Lactate Dehydrogenase From Clostridium Thermocell | 4e-42 | ||
| 1ldn_A | 316 | Structure Of A Ternary Complex Of An Allosteric Lac | 2e-41 | ||
| 1ldb_A | 317 | Structure Determination And Refinement Of Bacillus | 2e-41 | ||
| 1a5z_A | 319 | Lactate Dehydrogenase From Thermotoga Maritima (tml | 3e-41 | ||
| 3h3j_A | 317 | Crystal Structure Of Lactate Dehydrogenase Mutant ( | 4e-41 | ||
| 1ez4_A | 318 | Crystal Structure Of Non-Allosteric L-Lactate Dehyd | 2e-40 | ||
| 3d0o_A | 317 | Crystal Structure Of Lactate Dehydrogenase From Sta | 3e-40 | ||
| 2v6b_A | 304 | Crystal Structure Of Lactate Dehydrogenase From Dei | 3e-34 | ||
| 2i6t_A | 303 | Orthorhombic Structure Of The Ldh Domain Of Human U | 1e-30 | ||
| 3tl2_A | 315 | Crystal Structure Of Bacillus Anthracis Str. Ames M | 1e-27 | ||
| 1gv1_A | 310 | Structural Basis For Thermophilic Protein Stability | 2e-27 | ||
| 1guz_A | 310 | Structural Basis For Thermophilic Protein Stability | 2e-27 | ||
| 1hyg_A | 313 | Crystal Structure Of Mj0490 Gene Product, The Famil | 6e-25 | ||
| 2x0i_A | 294 | 2.9 A Resolution Structure Of Malate Dehydrogenase | 6e-25 | ||
| 2hlp_A | 303 | Crystal Structure Of The E267r Mutant Of A Halophil | 7e-25 | ||
| 1o6z_A | 303 | 1.95 A Resolution Structure Of (r207s,r292s) Mutant | 7e-25 | ||
| 1gv0_A | 310 | Structural Basis For Thermophilic Protein Stability | 7e-25 | ||
| 2x0r_A | 304 | R207s,R292s Mutant Of Malate Dehydrogenase From The | 8e-25 | ||
| 1hlp_A | 303 | Structural Features Stabilizing Halophilic Malate D | 9e-25 | ||
| 2j5k_A | 304 | 2.0 A Resolution Structure Of The Wild Type Malate | 9e-25 | ||
| 2d4a_A | 308 | Structure Of The Malate Dehydrogenase From Aeropyru | 1e-24 | ||
| 3nep_X | 314 | 1.55a Resolution Structure Of Malate Dehydrogenase | 2e-24 | ||
| 3gvh_A | 324 | Crystal Structure Of LactateMALATE DEHYDROGENASE FR | 3e-23 | ||
| 1guy_A | 309 | Structural Basis For Thermophilic Protein Stability | 3e-23 | ||
| 1ur5_A | 309 | Stabilization Of A Tetrameric Malate Dehydrogenase | 5e-23 | ||
| 1uxh_A | 309 | Large Improvement In The Thermal Stability Of A Tet | 8e-23 | ||
| 1uxi_A | 309 | Large Improvement In The Thermal Stability Of A Tet | 1e-22 | ||
| 3czm_A | 326 | T. Gondii Bradyzoite-Specific Ldh (Ldh2) In Complex | 1e-21 | ||
| 1sov_A | 328 | Toxoplasma Gondii Bradyzoite-specific Ldh (ldh2) Ap | 1e-21 | ||
| 1cet_A | 316 | Chloroquine Binds In The Cofactor Binding Site Of P | 3e-21 | ||
| 3p7m_A | 321 | Structure Of Putative Lactate Dehydrogenase From Fr | 4e-21 | ||
| 2hjr_A | 328 | Crystal Structure Of Cryptosporidium Parvum Malate | 6e-21 | ||
| 2fm3_A | 321 | Crystal Structure Of The Lactate Dehydrogenase From | 1e-20 | ||
| 2ewd_A | 317 | Crystal Structure Of The Lactate Dehydrogenase From | 1e-20 | ||
| 1pze_A | 331 | T.gondii Ldh1 Apo Form Length = 331 | 2e-20 | ||
| 3om9_A | 329 | T. Gondii Bradyzoite-Specific Ldh (Ldh1) In Complex | 2e-20 | ||
| 1ceq_A | 316 | Chloroquine Binds In The Cofactor Binding Site Of P | 2e-20 | ||
| 1pzg_A | 331 | T.Gondii Ldh1 Complexed With Apad And Sulfate At 1. | 2e-20 | ||
| 1u4o_A | 321 | Plasmodium Falciparum Lactate Dehydrogenase Complex | 3e-20 | ||
| 1xiv_A | 323 | Plasmodium Falciparum Lactate Dehydrogenase Complex | 4e-20 | ||
| 1t24_A | 322 | Plasmodium Falciparum Lactate Dehydrogenase Complex | 4e-20 | ||
| 2a92_A | 321 | Crystal Structure Of Lactate Dehydrogenase From Pla | 4e-20 | ||
| 1t2e_A | 322 | Plasmodium Falciparum Lactate Dehydrogenase S245a, | 2e-19 | ||
| 1oc4_A | 322 | Lactate Dehydrogenase From Plasmodium Berghei Lengt | 3e-18 | ||
| 1hyh_A | 309 | Crystal Structure Of L-2-hydroxyisocaproate Dehydro | 1e-16 | ||
| 3fi9_A | 343 | Crystal Structure Of Malate Dehydrogenase From Porp | 9e-12 | ||
| 1emd_A | 312 | Crystal Structure Of A Ternary Complex Of Escherich | 4e-11 | ||
| 2pwz_A | 312 | Crystal Structure Of The Apo Form Of E.Coli Malate | 2e-10 | ||
| 1ib6_A | 312 | Crystal Structure Of R153c E. Coli Malate Dehydroge | 2e-09 | ||
| 1smk_A | 326 | Mature And Translocatable Forms Of Glyoxysomal Mala | 6e-09 | ||
| 1sev_A | 362 | Mature And Translocatable Forms Of Glyoxysomal Mala | 6e-09 | ||
| 4e0b_A | 313 | 2.17 Angstrom Resolution Crystal Structure Of Malat | 2e-08 | ||
| 1mld_A | 314 | Refined Structure Of Mitochondrial Malate Dehydroge | 1e-07 | ||
| 2dfd_A | 342 | Crystal Structure Of Human Malate Dehydrogenase Typ | 2e-07 | ||
| 4mdh_A | 334 | Refined Crystal Structure Of Cytoplasmic Malate Deh | 5e-05 | ||
| 5mdh_A | 333 | Crystal Structure Of Ternary Complex Of Porcine Cyt | 5e-05 |
| >pdb|4AJ4|A Chain A, Rat Ldha In Complex With 4-((2-Allylsulfanyl-1,3-Benzothizol-6-Yl) Amino)-4-Oxo-Butanoic Acid Length = 332 | Back alignment and structure |
|
| >pdb|4AJ1|A Chain A, Rat Ldha In Complex With N-(2-(Methylamino)-1,3- Benzothiazol-6-Yl)acetamide Length = 331 | Back alignment and structure |
| >pdb|2V65|A Chain A, Apo Ldh From The Psychrophile C. Gunnari Length = 331 | Back alignment and structure |
| >pdb|9LDT|A Chain A, Design And Synthesis Of New Enzymes Based On The Lactate Dehydrogenase Framework Length = 332 | Back alignment and structure |
| >pdb|1I0Z|A Chain A, Human Heart L-Lactate Dehydrogenase H Chain, Ternary Complex With Nadh And Oxamate Length = 333 | Back alignment and structure |
| >pdb|1T2F|A Chain A, Human B Lactate Dehydrogenase Complexed With Nad+ And 4- Hydroxy-1,2,5-Oxadiazole-3-Carboxylic Acid Length = 333 | Back alignment and structure |
| >pdb|1V6A|A Chain A, Crystal Structure Of L-Lactate Dehydrogenase From Cyprinus Carpio Length = 332 | Back alignment and structure |
| >pdb|1I10|A Chain A, Human Muscle L-Lactate Dehydrogenase M Chain, Ternary Complex With Nadh And Oxamate Length = 331 | Back alignment and structure |
| >pdb|4AJP|A Chain A, Human Ldha In Complex With 2-((4-(4-((3-((2-Methyl-1,3- Benzothiazol-6yl)amino)-3-Oxo-Propyl)amino)-4-Oxo-Butyl) Phenyl)methyl)propanedioic Acid Length = 337 | Back alignment and structure |
| >pdb|3H3F|A Chain A, Rabbit Muscle L-Lactate Dehydrogenase In Complex With Nadh And Oxamate Length = 331 | Back alignment and structure |
| >pdb|5LDH|A Chain A, Structure Of The Active Ternary Complex Of Pig Heart Lactate Dehydrogenase With S-Lac-Nad At 2.7 Angstroms Resolution Length = 334 | Back alignment and structure |
| >pdb|6LDH|A Chain A, Refined Crystal Structure Of Dogfish M4 Apo-Lactate Dehydrogenase Length = 330 | Back alignment and structure |
| >pdb|1LDM|A Chain A, Refined Crystal Structure Of Dogfish M4 Apo-Lactate Dehydrogenase Length = 329 | Back alignment and structure |
| >pdb|2LDX|A Chain A, Characterization Of The Antigenic Sites On The Refined 3- Angstroms Resolution Structure Of Mouse Testicular Lactate Dehydrogenase C4 Length = 331 | Back alignment and structure |
| >pdb|3LDH|A Chain A, A Comparison Of The Structures Of Apo Dogfish M4 Lactate Dehydrogenase And Its Ternary Complexes Length = 330 | Back alignment and structure |
| >pdb|3PQD|A Chain A, Crystal Structure Of L-Lactate Dehydrogenase From Bacillus Subtilis Complexed With Fbp And Nad+ Length = 326 | Back alignment and structure |
| >pdb|1LLD|A Chain A, Molecular Basis Of Allosteric Activation Of Bacterial L-Lactate Dehydrogenase Length = 319 | Back alignment and structure |
| >pdb|3PQE|A Chain A, Crystal Structure Of L-Lactate Dehydrogenase From Bacillus Subtilis With H171c Mutation Length = 326 | Back alignment and structure |
| >pdb|4A73|A Chain A, Single Point Mutant Of Thermus Thermophilus Lactate Dehydrogenase Length = 310 | Back alignment and structure |
| >pdb|2V6M|A Chain A, Crystal Structure Of Lactate Dehydrogenase From Thermus Thermophilus Hb8 (Apo Form) Length = 310 | Back alignment and structure |
| >pdb|2XXB|A Chain A, Penta-Mutant Of Thermus Thermophilus Lactate Dehydrogenase, Complex With Amp Length = 310 | Back alignment and structure |
| >pdb|2E37|A Chain A, Structure Of Tt0471 Protein From Thermus Thermophilus Length = 310 | Back alignment and structure |
| >pdb|3VKU|A Chain A, Penta Mutant Of Lactobacillus Casei Lactate Dehydrogenase Length = 326 | Back alignment and structure |
| >pdb|2ZQY|A Chain A, T-State Structure Of Allosteric L-Lactate Dehydrogenase From Lactobacillus Casei Length = 326 | Back alignment and structure |
| >pdb|1LLC|A Chain A, Structure Determination Of The Allosteric L-Lactate Dehydrogenase From Lactobacillus Casei At 3.0 Angstroms Resolution Length = 325 | Back alignment and structure |
| >pdb|1Y6J|A Chain A, L-Lactate Dehydrogenase From Clostridium Thermocellum Cth-1135 Length = 318 | Back alignment and structure |
| >pdb|1LDN|A Chain A, Structure Of A Ternary Complex Of An Allosteric Lactate Dehydrogenase From Bacillus Stearothermophilus At 2.5 Angstroms Resolution Length = 316 | Back alignment and structure |
| >pdb|1LDB|A Chain A, Structure Determination And Refinement Of Bacillus Stearothermophilus Lactate Dehydrogenase Length = 317 | Back alignment and structure |
| >pdb|1A5Z|A Chain A, Lactate Dehydrogenase From Thermotoga Maritima (tmldh) Length = 319 | Back alignment and structure |
| >pdb|3H3J|A Chain A, Crystal Structure Of Lactate Dehydrogenase Mutant (A85r) Fro Staphylococcus Aureus Complexed With Nad And Pyruvate Length = 317 | Back alignment and structure |
| >pdb|1EZ4|A Chain A, Crystal Structure Of Non-Allosteric L-Lactate Dehydrogenase From Lactobacillus Pentosus At 2.3 Angstrom Resolution Length = 318 | Back alignment and structure |
| >pdb|3D0O|A Chain A, Crystal Structure Of Lactate Dehydrogenase From Staphylococcus Aureus Length = 317 | Back alignment and structure |
| >pdb|2V6B|A Chain A, Crystal Structure Of Lactate Dehydrogenase From Deinococcus Radiodurans (Apo Form) Length = 304 | Back alignment and structure |
| >pdb|2I6T|A Chain A, Orthorhombic Structure Of The Ldh Domain Of Human Ubiquitin- Conjugating Enzyme E2-Like Isoform A Length = 303 | Back alignment and structure |
| >pdb|3TL2|A Chain A, Crystal Structure Of Bacillus Anthracis Str. Ames Malate Dehydrogenase In Closed Conformation Length = 315 | Back alignment and structure |
| >pdb|1GV1|A Chain A, Structural Basis For Thermophilic Protein Stability: Structures Of Thermophilic And Mesophilic Malate Dehydrogenases Length = 310 | Back alignment and structure |
| >pdb|1GUZ|A Chain A, Structural Basis For Thermophilic Protein Stability: Structures Of Thermophilic And Mesophilic Malate Dehydrogenases Length = 310 | Back alignment and structure |
| >pdb|1HYG|A Chain A, Crystal Structure Of Mj0490 Gene Product, The Family Of LactateMALATE DEHYDROGENASE Length = 313 | Back alignment and structure |
| >pdb|2X0I|A Chain A, 2.9 A Resolution Structure Of Malate Dehydrogenase From Archaeoglobus Fulgidus In Complex With Nadh Length = 294 | Back alignment and structure |
| >pdb|2HLP|A Chain A, Crystal Structure Of The E267r Mutant Of A Halophilic Malate Dehydrogenase In The Apo Form Length = 303 | Back alignment and structure |
| >pdb|1O6Z|A Chain A, 1.95 A Resolution Structure Of (r207s,r292s) Mutant Of Malate Dehydrogenase From The Halophilic Archaeon Haloarcula Marismortui (holo Form) Length = 303 | Back alignment and structure |
| >pdb|1GV0|A Chain A, Structural Basis For Thermophilic Protein Stability: Structures Of Thermophilic And Mesophilic Malate Dehydrogenases Length = 310 | Back alignment and structure |
| >pdb|2X0R|A Chain A, R207s,R292s Mutant Of Malate Dehydrogenase From The Halophilic Archaeon Haloarcula Marismortui (Holo Form) Length = 304 | Back alignment and structure |
| >pdb|1HLP|A Chain A, Structural Features Stabilizing Halophilic Malate Dehydrogenase From An Archaebacterium Length = 303 | Back alignment and structure |
| >pdb|2J5K|A Chain A, 2.0 A Resolution Structure Of The Wild Type Malate Dehydrogenase From Haloarcula Marismortui (radiation Damage Series) Length = 304 | Back alignment and structure |
| >pdb|2D4A|A Chain A, Structure Of The Malate Dehydrogenase From Aeropyrum Pernix Length = 308 | Back alignment and structure |
| >pdb|3NEP|X Chain X, 1.55a Resolution Structure Of Malate Dehydrogenase From Salinibacter Ruber Length = 314 | Back alignment and structure |
| >pdb|3GVH|A Chain A, Crystal Structure Of LactateMALATE DEHYDROGENASE FROM Brucella Melitensis Length = 324 | Back alignment and structure |
| >pdb|1GUY|A Chain A, Structural Basis For Thermophilic Protein Stability: Structures Of Thermophilic And Mesophilic Malate Dehydrogenases Length = 309 | Back alignment and structure |
| >pdb|1UR5|A Chain A, Stabilization Of A Tetrameric Malate Dehydrogenase By Introduction Of A Disulfide Bridge At The DimerDIMER Interface Length = 309 | Back alignment and structure |
| >pdb|1UXH|A Chain A, Large Improvement In The Thermal Stability Of A Tetrameric Malate Dehydrogenase By Single Point Mutations At The Dimer-Dimer Interface Length = 309 | Back alignment and structure |
| >pdb|1UXI|A Chain A, Large Improvement In The Thermal Stability Of A Tetrameric Malate Dehydrogenase By Single Point Mutations At The Dimer-Dimer Interface Length = 309 | Back alignment and structure |
| >pdb|3CZM|A Chain A, T. Gondii Bradyzoite-Specific Ldh (Ldh2) In Complex With Nad And Oxq Length = 326 | Back alignment and structure |
| >pdb|1SOV|A Chain A, Toxoplasma Gondii Bradyzoite-specific Ldh (ldh2) Apo Form Length = 328 | Back alignment and structure |
| >pdb|1CET|A Chain A, Chloroquine Binds In The Cofactor Binding Site Of Plasmodium Falciparum Lactate Dehydrogenase. Length = 316 | Back alignment and structure |
| >pdb|3P7M|A Chain A, Structure Of Putative Lactate Dehydrogenase From Francisella Tularensis Subsp. Tularensis Schu S4 Length = 321 | Back alignment and structure |
| >pdb|2HJR|A Chain A, Crystal Structure Of Cryptosporidium Parvum Malate Dehydrogenase Length = 328 | Back alignment and structure |
| >pdb|2FM3|A Chain A, Crystal Structure Of The Lactate Dehydrogenase From Cryptosporidium Parvum Complexed With Substrate (Pyruvic Acid) And Cofactor (B- Nicotinamide Adenine Dinucleotide) Length = 321 | Back alignment and structure |
| >pdb|2EWD|A Chain A, Crystal Structure Of The Lactate Dehydrogenase From Cryptosporidium Parvum Complexed With Substrate (Pyruvic Acid) And Cofactor Analog (3-Acetylpyridine Adenine Dinucleotide). Length = 317 | Back alignment and structure |
| >pdb|1PZE|A Chain A, T.gondii Ldh1 Apo Form Length = 331 | Back alignment and structure |
| >pdb|3OM9|A Chain A, T. Gondii Bradyzoite-Specific Ldh (Ldh1) In Complex With Nad And Oxq Length = 329 | Back alignment and structure |
| >pdb|1CEQ|A Chain A, Chloroquine Binds In The Cofactor Binding Site Of Plasmodium Falciparum Lactate Dehydrogenase Length = 316 | Back alignment and structure |
| >pdb|1PZG|A Chain A, T.Gondii Ldh1 Complexed With Apad And Sulfate At 1.6 Angstroms Length = 331 | Back alignment and structure |
| >pdb|1U4O|A Chain A, Plasmodium Falciparum Lactate Dehydrogenase Complexed With 2,6- Naphthalenedicarboxylic Acid Length = 321 | Back alignment and structure |
| >pdb|1XIV|A Chain A, Plasmodium Falciparum Lactate Dehydrogenase Complexed With 2-({4- Chloro-[hydroxy(Methoxy)methyl]cyclohexyl}amino)ethane- 1,1,2-Triol Length = 323 | Back alignment and structure |
| >pdb|1T24|A Chain A, Plasmodium Falciparum Lactate Dehydrogenase Complexed With Nad+ And 4- Hydroxy-1,2,5-Oxadiazole-3-Carboxylic Acid Length = 322 | Back alignment and structure |
| >pdb|2A92|A Chain A, Crystal Structure Of Lactate Dehydrogenase From Plasmodium Vivax: Complex With Nadh Length = 321 | Back alignment and structure |
| >pdb|1T2E|A Chain A, Plasmodium Falciparum Lactate Dehydrogenase S245a, A327p Mutant Complexed With Nadh And Oxamate Length = 322 | Back alignment and structure |
| >pdb|1OC4|A Chain A, Lactate Dehydrogenase From Plasmodium Berghei Length = 322 | Back alignment and structure |
| >pdb|1HYH|A Chain A, Crystal Structure Of L-2-hydroxyisocaproate Dehydrogenase From Lactobacillus Confusus At 2.2 Angstroms Resolution-an Example Of Strong Asymmetry Between Subunits Length = 309 | Back alignment and structure |
| >pdb|3FI9|A Chain A, Crystal Structure Of Malate Dehydrogenase From Porphyromonas Gingivalis Length = 343 | Back alignment and structure |
| >pdb|1EMD|A Chain A, Crystal Structure Of A Ternary Complex Of Escherichia Coli Malate Dehydrogenase, Citrate And Nad At 1.9 Angstroms Resolution Length = 312 | Back alignment and structure |
| >pdb|2PWZ|A Chain A, Crystal Structure Of The Apo Form Of E.Coli Malate Dehydrogenase Length = 312 | Back alignment and structure |
| >pdb|1IB6|A Chain A, Crystal Structure Of R153c E. Coli Malate Dehydrogenase Length = 312 | Back alignment and structure |
| >pdb|1SMK|A Chain A, Mature And Translocatable Forms Of Glyoxysomal Malate Dehydrogenase Have Different Activities And Stabilities But Similar Crystal Structures Length = 326 | Back alignment and structure |
| >pdb|1SEV|A Chain A, Mature And Translocatable Forms Of Glyoxysomal Malate Dehydrogenase Have Different Activities And Stabilities But Similar Crystal Structures Length = 362 | Back alignment and structure |
| >pdb|4E0B|A Chain A, 2.17 Angstrom Resolution Crystal Structure Of Malate Dehydrogenase From Vibrio Vulnificus Cmcp6 Length = 313 | Back alignment and structure |
| >pdb|1MLD|A Chain A, Refined Structure Of Mitochondrial Malate Dehydrogenase From Porcine Heart And The Consensus Structure For Dicarboxylic Acid Oxidoreductases Length = 314 | Back alignment and structure |
| >pdb|2DFD|A Chain A, Crystal Structure Of Human Malate Dehydrogenase Type 2 Length = 342 | Back alignment and structure |
| >pdb|4MDH|A Chain A, Refined Crystal Structure Of Cytoplasmic Malate Dehydrogenase At 2.5-Angstroms Resolution Length = 334 | Back alignment and structure |
| >pdb|5MDH|A Chain A, Crystal Structure Of Ternary Complex Of Porcine Cytoplasmic Malate Dehydrogenase Alpha-Ketomalonate And Tnad At 2.4 Angstroms Resolution Length = 333 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 216 | |||
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 1e-112 | |
| 1y6j_A | 318 | L-lactate dehydrogenase; southeast collaboratory f | 1e-109 | |
| 2xxj_A | 310 | L-LDH, L-lactate dehydrogenase; oxidoreductase, hy | 1e-108 | |
| 1lld_A | 319 | L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N | 1e-108 | |
| 1ldn_A | 316 | L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA | 1e-107 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 1e-106 | |
| 1a5z_A | 319 | L-lactate dehydrogenase; oxidoreductase, glycolysi | 1e-106 | |
| 3d0o_A | 317 | L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly | 1e-106 | |
| 2zqz_A | 326 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ro | 1e-105 | |
| 1ez4_A | 318 | Lactate dehydrogenase; rossmann fold, oxidoreducta | 1e-105 | |
| 2v6b_A | 304 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ra | 1e-102 | |
| 1o6z_A | 303 | MDH, malate dehydrogenase; halophilic, ION-binding | 2e-99 | |
| 1hyh_A | 309 | L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 | 4e-99 | |
| 2i6t_A | 303 | Ubiquitin-conjugating enzyme E2-like isoform A; L- | 9e-95 | |
| 1oju_A | 294 | MDH, malate dehydrogenase; hyperthermophilic, oxid | 2e-92 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 2e-90 | |
| 1guz_A | 310 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 4e-88 | |
| 3nep_X | 314 | Malate dehydrogenase; halophIle, molecular adpatat | 6e-85 | |
| 1hye_A | 313 | L-lactate/malate dehydrogenase; nucleotide binding | 4e-83 | |
| 2d4a_B | 308 | Malate dehydrogenase; archaea, hyperthermophIle, o | 5e-82 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 1e-80 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 1e-79 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 2e-79 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 8e-79 | |
| 1ur5_A | 309 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 1e-78 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 3e-78 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 1e-77 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 1e-76 | |
| 3fi9_A | 343 | Malate dehydrogenase; structural genomics, oxidore | 3e-47 | |
| 1smk_A | 326 | Malate dehydrogenase, glyoxysomal; tricarboxylic c | 2e-34 | |
| 3hhp_A | 312 | Malate dehydrogenase; MDH, citric acid cycle, TCA | 5e-34 | |
| 1mld_A | 314 | Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D | 2e-33 | |
| 1y7t_A | 327 | Malate dehydrogenase; NAD-dependent-MDH-NADPH comp | 5e-30 | |
| 1b8p_A | 329 | Protein (malate dehydrogenase); oxidoreductase; 1. | 1e-29 | |
| 5mdh_A | 333 | Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH | 7e-29 | |
| 7mdh_A | 375 | Protein (malate dehydrogenase); chloroplastic mala | 1e-28 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-07 | |
| 1obb_A | 480 | Maltase, alpha-glucosidase; glycosidase, sulfinic | 2e-05 | |
| 1s6y_A | 450 | 6-phospho-beta-glucosidase; hydrolase, structural | 5e-05 |
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... Length = 331 | Back alignment and structure |
|---|
Score = 322 bits (828), Expect = e-112
Identities = 130/197 (65%), Positives = 170/197 (86%)
Query: 20 NYALSEGSRIVIVTAGVRQREGESRLSLVERNVNIFKGIIPNIVKYSPQCTLLIVSNPVD 79
+Y+++ S++VI+TAG RQ+EGESRL+LV+RNVNIFK IIPN+VKYSPQC LLIVSNPVD
Sbjct: 81 DYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVD 140
Query: 80 ILTYVSWKLSGFPKNRVIGSGTNLDSMRFRVLLAQKLGLSPESVYGFIIGEHGDSSVPVW 139
ILTYV+WK+SGFPKNRVIGSG NLDS RFR L+ ++LG+ P S +G+++GEHGDSSVPVW
Sbjct: 141 ILTYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVW 200
Query: 140 SGVNVAGVNLREVNPAIGTEGDTEEFGKLHTDVVNSAYEIIRLKGYTSWAIGLSIASLTY 199
SGVNVAGV+L+ +NP +GT+ D E++ +H VV+SAYE+I+LKGYTSWAIGLS+A L
Sbjct: 201 SGVNVAGVSLKSLNPQLGTDADKEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAE 260
Query: 200 TLLNNTNKIHAISTLIQ 216
+++ N ++H IST+I+
Sbjct: 261 SIMKNLRRVHPISTMIK 277
|
| >1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Length = 318 | Back alignment and structure |
|---|
| >2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A Length = 310 | Back alignment and structure |
|---|
| >1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Length = 319 | Back alignment and structure |
|---|
| >1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Length = 316 | Back alignment and structure |
|---|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Length = 326 | Back alignment and structure |
|---|
| >1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Length = 319 | Back alignment and structure |
|---|
| >3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Length = 317 | Back alignment and structure |
|---|
| >2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* Length = 326 | Back alignment and structure |
|---|
| >1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Length = 318 | Back alignment and structure |
|---|
| >2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Length = 304 | Back alignment and structure |
|---|
| >1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A Length = 303 | Back alignment and structure |
|---|
| >1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Length = 309 | Back alignment and structure |
|---|
| >2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Length = 303 | Back alignment and structure |
|---|
| >1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ojs_A* 2x0i_A* 2x0j_A* Length = 294 | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 Length = 330 | Back alignment and structure |
|---|
| >1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Length = 310 | Back alignment and structure |
|---|
| >3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Length = 314 | Back alignment and structure |
|---|
| >1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* Length = 313 | Back alignment and structure |
|---|
| >2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} Length = 308 | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Length = 317 | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Length = 324 | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Length = 328 | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Length = 321 | Back alignment and structure |
|---|
| >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Length = 309 | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Length = 322 | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Length = 315 | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Length = 331 | Back alignment and structure |
|---|
| >3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Length = 343 | Back alignment and structure |
|---|
| >1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A Length = 326 | Back alignment and structure |
|---|
| >3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* Length = 312 | Back alignment and structure |
|---|
| >1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* Length = 314 | Back alignment and structure |
|---|
| >1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Length = 327 | Back alignment and structure |
|---|
| >1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Length = 329 | Back alignment and structure |
|---|
| >5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* Length = 333 | Back alignment and structure |
|---|
| >7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* Length = 375 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 Length = 480 | Back alignment and structure |
|---|
| >1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 Length = 450 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 216 | |||
| 4aj2_A | 331 | L-lactate dehydrogenase A chain; oxidoreductase-in | 100.0 | |
| 3vku_A | 326 | L-LDH, L-lactate dehydrogenase; rossmann fold, NAD | 100.0 | |
| 3pqe_A | 326 | L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas | 100.0 | |
| 3nep_X | 314 | Malate dehydrogenase; halophIle, molecular adpatat | 100.0 | |
| 3tl2_A | 315 | Malate dehydrogenase; center for structural genomi | 100.0 | |
| 1oju_A | 294 | MDH, malate dehydrogenase; hyperthermophilic, oxid | 100.0 | |
| 2x0j_A | 294 | Malate dehydrogenase; oxidoreductase, hyperthermop | 100.0 | |
| 7mdh_A | 375 | Protein (malate dehydrogenase); chloroplastic mala | 100.0 | |
| 3p7m_A | 321 | Malate dehydrogenase; putative dehydrogenase, enzy | 100.0 | |
| 3gvi_A | 324 | Malate dehydrogenase; NAD, oxidoreductase, tricarb | 100.0 | |
| 3fi9_A | 343 | Malate dehydrogenase; structural genomics, oxidore | 100.0 | |
| 2xxj_A | 310 | L-LDH, L-lactate dehydrogenase; oxidoreductase, hy | 100.0 | |
| 1ez4_A | 318 | Lactate dehydrogenase; rossmann fold, oxidoreducta | 100.0 | |
| 2zqz_A | 326 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ro | 100.0 | |
| 2d4a_B | 308 | Malate dehydrogenase; archaea, hyperthermophIle, o | 100.0 | |
| 1y6j_A | 318 | L-lactate dehydrogenase; southeast collaboratory f | 100.0 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 100.0 | |
| 4h7p_A | 345 | Malate dehydrogenase; ssgcid, structural G seattle | 100.0 | |
| 3d0o_A | 317 | L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly | 100.0 | |
| 3hhp_A | 312 | Malate dehydrogenase; MDH, citric acid cycle, TCA | 100.0 | |
| 1ldn_A | 316 | L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA | 100.0 | |
| 1ur5_A | 309 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 100.0 | |
| 1o6z_A | 303 | MDH, malate dehydrogenase; halophilic, ION-binding | 100.0 | |
| 5mdh_A | 333 | Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH | 100.0 | |
| 1t2d_A | 322 | LDH-P, L-lactate dehydrogenase; ternary complex, o | 100.0 | |
| 2hjr_A | 328 | Malate dehydrogenase; malaria, structural genomics | 100.0 | |
| 1hye_A | 313 | L-lactate/malate dehydrogenase; nucleotide binding | 100.0 | |
| 2v6b_A | 304 | L-LDH, L-lactate dehydrogenase; oxidoreductase, ra | 100.0 | |
| 1guz_A | 310 | Malate dehydrogenase; oxidoreductase, tricarboxyli | 100.0 | |
| 1pzg_A | 331 | LDH, lactate dehydrogenase; apicomplexa, APAD, tet | 100.0 | |
| 2i6t_A | 303 | Ubiquitin-conjugating enzyme E2-like isoform A; L- | 100.0 | |
| 1a5z_A | 319 | L-lactate dehydrogenase; oxidoreductase, glycolysi | 100.0 | |
| 1b8p_A | 329 | Protein (malate dehydrogenase); oxidoreductase; 1. | 100.0 | |
| 1mld_A | 314 | Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D | 100.0 | |
| 1hyh_A | 309 | L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 | 100.0 | |
| 1smk_A | 326 | Malate dehydrogenase, glyoxysomal; tricarboxylic c | 100.0 | |
| 2ewd_A | 317 | Lactate dehydrogenase,; protein-substrate_cofactor | 100.0 | |
| 1up7_A | 417 | 6-phospho-beta-glucosidase; hydrolase, family4 hyd | 100.0 | |
| 1lld_A | 319 | L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N | 100.0 | |
| 1y7t_A | 327 | Malate dehydrogenase; NAD-dependent-MDH-NADPH comp | 100.0 | |
| 1s6y_A | 450 | 6-phospho-beta-glucosidase; hydrolase, structural | 100.0 | |
| 1u8x_X | 472 | Maltose-6'-phosphate glucosidase; structural genom | 100.0 | |
| 3fef_A | 450 | Putative glucosidase LPLD; gulosidase, structural | 99.93 | |
| 1obb_A | 480 | Maltase, alpha-glucosidase; glycosidase, sulfinic | 99.91 | |
| 3u95_A | 477 | Glycoside hydrolase, family 4; hydrolysis, cytosol | 99.86 | |
| 1dlj_A | 402 | UDP-glucose dehydrogenase; rossmann fold, ternary | 85.35 | |
| 2o3j_A | 481 | UDP-glucose 6-dehydrogenase; structural genomics, | 85.02 | |
| 3ldh_A | 330 | Lactate dehydrogenase; oxidoreductase, CHOH donor, | 82.28 | |
| 4as2_A | 327 | Phosphorylcholine phosphatase; hydrolase, HAD supe | 80.69 |
| >4aj2_A L-lactate dehydrogenase A chain; oxidoreductase-inhibitor complex, fragment-based LEAD genera inhibitors; HET: 52C; 1.75A {Rattus norvegicus} PDB: 4aj1_A* 4aje_A* 4ajh_A* 4aji_A* 4ajj_A* 4ajk_A* 4ajl_A* 4ajn_A* 4ajo_A* 4al4_A* 4aj4_A* 4ajp_A* 1i10_A* 3h3f_A* 9ldt_A* 9ldb_A* 1t2f_A* 1i0z_A* 5ldh_A* 1ldm_A* ... | Back alignment and structure |
|---|
Probab=100.00 E-value=7.9e-63 Score=437.54 Aligned_cols=214 Identities=61% Similarity=1.056 Sum_probs=202.6
Q ss_pred cccCC-CCCCCceEEEcCCccccCCccEEEEcCCCCCCCCcCHHHHHHHhHHHHHHHHHHHHhhCCCeEEEEEcCchhHH
Q psy17689 3 TTNDH-SSFKGVNVLTRLNYALSEGSRIVIVTAGVRQREGESRLSLVERNVNIFKGIIPNIVKYSPQCTLLIVSNPVDIL 81 (216)
Q Consensus 3 ~~~d~-~~~~~~~v~~~~~~~~~~daDivvitag~~~k~g~~r~dll~~N~~i~~~i~~~i~~~~p~~iiivvtNPvd~~ 81 (216)
+++|+ +|+....++.++||++++|||+||+|+|.||||||+|+||+.+|++|+++++++|+++||+++++++|||+|++
T Consensus 63 DL~~~~~~~~~~~i~~~~d~~~~~~aDiVvi~aG~~~kpG~tR~dL~~~N~~I~~~i~~~i~~~~p~a~vlvvtNPvdi~ 142 (331)
T 4aj2_A 63 DLQHGSLFLKTPKIVSSKDYSVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPQCKLLIVSNPVDIL 142 (331)
T ss_dssp HHHHTGGGCSCCEEEECSSGGGGTTEEEEEECCSCCCCTTCCGGGGHHHHHHHHHHHHHHHHHHCTTCEEEECSSSHHHH
T ss_pred hhhhhhhccCCCeEEEcCCHHHhCCCCEEEEccCCCCCCCccHHHHHHHHHHHHHHHHHHHHHHCCCeEEEEecChHHHH
Confidence 45666 37667778888999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHhcCCCCCCEEeeccchhHHHHHHHHHHHhCCCCCceeEEEEccCCCCcccceeeeeECCeeccccCccCCCCCC
Q psy17689 82 TYVSWKLSGFPKNRVIGSGTNLDSMRFRVLLAQKLGLSPESVYGFIIGEHGDSSVPVWSGVNVAGVNLREVNPAIGTEGD 161 (216)
Q Consensus 82 t~~~~~~sg~~~~~viG~Gt~lds~R~~~~la~~l~v~~~~v~~~v~G~HGds~vp~~S~~~v~g~~l~~~~~~~~~~~~ 161 (216)
|+++++.+|||++||||+||.||++|+++++|+++|++|++|+++||||||+||||+||+++|+|+|+.+++++.+..++
T Consensus 143 t~~~~k~sg~p~~rviG~gt~LD~~R~~~~la~~lgv~~~~V~~~ViGeHG~s~vp~~S~~~v~G~p~~~~~~~~~~~~~ 222 (331)
T 4aj2_A 143 TYVAWKISGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGVNVAGVSLKSLNPQLGTDAD 222 (331)
T ss_dssp HHHHHHHHCCCGGGEEECTTHHHHHHHHHHHHHHHTSCGGGCBCCEEBCSSTTCEECGGGCEETTEEHHHHCTTTTSTTC
T ss_pred HHHHHHHhCCCHHHEEeeccccHHHHHHHHHHHHhCCCHHHCEEeEEecCCCceeEeeecCeECCEEHHHHHhhccCCCC
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999875444456
Q ss_pred HHHHHHHHHHHHHHHHHHHHhhCCCChhHHHHHHHHHHHHHcCCCceEEEEeeeC
Q psy17689 162 TEEFGKLHTDVVNSAYEIIRLKGYTSWAIGLSIASLTYTLLNNTNKIHAISTLIQ 216 (216)
Q Consensus 162 ~~~~~~l~~~v~~~g~~ii~~Kg~t~~~~a~a~~~ii~ail~~~~~ilpvS~~l~ 216 (216)
+++|++|.++|+++|++|+++||+|+||+|+|+++++++|++|+++++|||++++
T Consensus 223 ~~~~~~i~~~v~~~g~eIi~~kg~t~~a~a~a~a~~~~ail~d~~~~~~vs~~~~ 277 (331)
T 4aj2_A 223 KEQWKDVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPISTMIK 277 (331)
T ss_dssp TTCTHHHHHHHHHHHHHHHHHHSSCCHHHHHHHHHHHHHHHTTCCEEEEEEEECT
T ss_pred HHHHHHHHHHHHHhHHHHhhcCCCCchhHHHHHHHHHHHHHhCCCCeEEEEEecC
Confidence 7889999999999999999999999999999999999999999999999999874
|
| >3vku_A L-LDH, L-lactate dehydrogenase; rossmann fold, NADH binding, oxidoreductase; 1.96A {Lactobacillus casei} PDB: 2zqz_A 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* | Back alignment and structure |
|---|
| >3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} | Back alignment and structure |
|---|
| >3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} | Back alignment and structure |
|---|
| >1oju_A MDH, malate dehydrogenase; hyperthermophilic, oxidoreductase; HET: ENA; 2.79A {Archaeoglobus fulgidus} PDB: 1ojs_A* 2x0i_A* 2x0j_A* | Back alignment and structure |
|---|
| >2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* | Back alignment and structure |
|---|
| >7mdh_A Protein (malate dehydrogenase); chloroplastic malate dehydrogenase (NADP+), activated by LIG chloroplastic malate dehydrogenase; 2.40A {Sorghum bicolor} SCOP: c.2.1.5 d.162.1.1 PDB: 1civ_A* | Back alignment and structure |
|---|
| >3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} | Back alignment and structure |
|---|
| >3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* | Back alignment and structure |
|---|
| >3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >2xxj_A L-LDH, L-lactate dehydrogenase; oxidoreductase, hyperthermophIle; HET: NAD; 1.964A {Thermus thermophilus} PDB: 2xxb_A* 3zzn_A* 2v7p_A* 2e37_A* 2v6m_A* 2xxe_A 4a73_A | Back alignment and structure |
|---|
| >1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >2zqz_A L-LDH, L-lactate dehydrogenase; oxidoreductase, rossmann fold, cytoplasm, glycolysis, NAD, phosphoprotein; 2.50A {Lactobacillus casei} PDB: 2zqy_A 3vkv_A* 1llc_A* | Back alignment and structure |
|---|
| >2d4a_B Malate dehydrogenase; archaea, hyperthermophIle, oxidoreductase; 2.87A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 | Back alignment and structure |
|---|
| >4h7p_A Malate dehydrogenase; ssgcid, structural G seattle structural genomics center for infectious disease, oxidoreductase; 1.30A {Leishmania major} | Back alignment and structure |
|---|
| >3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* | Back alignment and structure |
|---|
| >3hhp_A Malate dehydrogenase; MDH, citric acid cycle, TCA cycle, NAD, oxidoreductase, tricarboxylic acid cycle; 1.45A {Escherichia coli k-12} PDB: 2pwz_A 2cmd_A* 1emd_A* 1ib6_A* 1ie3_A* 4e0b_A* | Back alignment and structure |
|---|
| >1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* | Back alignment and structure |
|---|
| >1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* | Back alignment and structure |
|---|
| >1o6z_A MDH, malate dehydrogenase; halophilic, ION-binding, protein-solvent interaction, oxidoreductase; HET: NAD; 1.95A {Haloarcula marismortui} SCOP: c.2.1.5 d.162.1.1 PDB: 1gt2_A* 2x0r_A* 2j5k_A 2j5q_A 2j5r_A 1d3a_A 1hlp_A* 2hlp_A | Back alignment and structure |
|---|
| >5mdh_A Malate dehydrogenase; oxidoreductase, (NAD(A)-CHOH(D)); HET: NAD; 2.40A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 4mdh_A* | Back alignment and structure |
|---|
| >1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* | Back alignment and structure |
|---|
| >2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >1hye_A L-lactate/malate dehydrogenase; nucleotide binding domain, oxidoreductase; HET: NAP; 1.90A {Methanocaldococcus jannaschii} SCOP: c.2.1.5 d.162.1.1 PDB: 1hyg_A* | Back alignment and structure |
|---|
| >2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* | Back alignment and structure |
|---|
| >1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* | Back alignment and structure |
|---|
| >2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A | Back alignment and structure |
|---|
| >1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A | Back alignment and structure |
|---|
| >1mld_A Malate dehydrogenase; oxidoreductase(NAD(A)-CHOH(D)); HET: CIT; 1.83A {Sus scrofa} SCOP: c.2.1.5 d.162.1.1 PDB: 2dfd_A* | Back alignment and structure |
|---|
| >1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 | Back alignment and structure |
|---|
| >1smk_A Malate dehydrogenase, glyoxysomal; tricarboxylic cycle, glyoxysome, NAD, glyoxylate bypass, oxidoreductase; HET: CIT; 2.50A {Citrullus lanatus} PDB: 1sev_A | Back alignment and structure |
|---|
| >2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A | Back alignment and structure |
|---|
| >1up7_A 6-phospho-beta-glucosidase; hydrolase, family4 hydrolase, Na dependent; HET: G6P NAD; 2.4A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 PDB: 1up6_A* 1up4_A | Back alignment and structure |
|---|
| >1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* | Back alignment and structure |
|---|
| >1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* | Back alignment and structure |
|---|
| >1s6y_A 6-phospho-beta-glucosidase; hydrolase, structural genomics, PSI, protein structure initi midwest center for structural genomics; 2.31A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.2 | Back alignment and structure |
|---|
| >1u8x_X Maltose-6'-phosphate glucosidase; structural genomics, PSI, protein structure initiative, MCSG glucosidase, NAD-dependent; HET: G6P NAD; 2.05A {Bacillus subtilis} SCOP: c.2.1.5 d.162.1.2 | Back alignment and structure |
|---|
| >3fef_A Putative glucosidase LPLD; gulosidase, structural genomics, unknown function, glycosidase, hydrolase, manganese, metal-binding, NAD, PSI- 2; 2.20A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1obb_A Maltase, alpha-glucosidase; glycosidase, sulfinic acid, NAD+, maltose, hydrolase; HET: MAL NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.2 | Back alignment and structure |
|---|
| >3u95_A Glycoside hydrolase, family 4; hydrolysis, cytosol; 2.00A {Thermotoga neapolitana} PDB: 1vjt_A* | Back alignment and structure |
|---|
| >1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* | Back alignment and structure |
|---|
| >2o3j_A UDP-glucose 6-dehydrogenase; structural genomics, PSI-2, prote structure initiative, NEW YORK SGX research center for STRU genomics; 1.88A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3ldh_A Lactate dehydrogenase; oxidoreductase, CHOH donor, NAD acceptor; HET: NAD; 3.00A {Squalus acanthias} SCOP: i.12.1.1 | Back alignment and structure |
|---|
| >4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 216 | ||||
| d1llda1 | 143 | c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobac | 4e-25 | |
| d1ldna1 | 148 | c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus | 6e-25 | |
| d1y6ja1 | 142 | c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridi | 9e-25 | |
| d2ldxa2 | 172 | d.162.1.1 (A:160-331) Lactate dehydrogenase {Mouse | 2e-24 | |
| d1i0za2 | 172 | d.162.1.1 (A:161-332) Lactate dehydrogenase {Human | 4e-24 | |
| d1ez4a1 | 146 | c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobac | 5e-24 | |
| d2ldxa1 | 159 | c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mu | 3e-23 | |
| d1a5za1 | 140 | c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermoto | 5e-23 | |
| d1guza1 | 142 | c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium | 5e-23 | |
| d1llda2 | 170 | d.162.1.1 (A:150-319) Lactate dehydrogenase {Bifid | 6e-23 | |
| d1i0za1 | 160 | c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Ho | 7e-23 | |
| d1y6ja2 | 169 | d.162.1.1 (A:149-317) Lactate dehydrogenase {Clost | 7e-23 | |
| d1o6za1 | 142 | c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon | 1e-22 | |
| d1ojua1 | 142 | c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon | 8e-22 | |
| d1hyha1 | 146 | c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydro | 1e-21 | |
| d1t2da1 | 150 | c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria p | 2e-21 | |
| d1pzga1 | 154 | c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplas | 3e-21 | |
| d1a5za2 | 172 | d.162.1.1 (A:164-333) Lactate dehydrogenase {Therm | 4e-21 | |
| d1ldma2 | 169 | d.162.1.1 (A:161-329) Lactate dehydrogenase {Dogfi | 4e-21 | |
| d1ojua2 | 152 | d.162.1.1 (A:164-331) Lactate dehydrogenase {Archa | 1e-20 | |
| d1uxja1 | 142 | c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflex | 2e-20 | |
| d1ez4a2 | 171 | d.162.1.1 (A:163-334) Lactate dehydrogenase {Lacto | 2e-20 | |
| d1hyha2 | 163 | d.162.1.1 (A:167-329) L-2-hydroxyisocapronate dehy | 3e-20 | |
| d1pzga2 | 174 | d.162.1.1 (A:164-334) Lactate dehydrogenase {Toxop | 6e-20 | |
| d1hyea1 | 145 | c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydroge | 6e-20 | |
| d1llca2 | 172 | d.162.1.1 (A:165-334) Lactate dehydrogenase {Lacto | 1e-19 | |
| d1mlda2 | 169 | d.162.1.1 (A:145-313) Malate dehydrogenase {Pig (S | 2e-19 | |
| d1guza2 | 163 | d.162.1.1 (A:143-305) Malate dehydrogenase {Chloro | 2e-19 | |
| d1uxja2 | 164 | d.162.1.1 (A:144-307) Malate dehydrogenase {Chloro | 5e-19 | |
| d7mdha1 | 175 | c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum ( | 7e-19 | |
| d1t2da2 | 165 | d.162.1.1 (A:151-315) Lactate dehydrogenase {Malar | 7e-19 | |
| d1y7ta1 | 154 | c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus th | 3e-18 | |
| d5mdha2 | 179 | d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (S | 3e-18 | |
| d5mdha1 | 154 | c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus s | 4e-18 | |
| d7mdha2 | 188 | d.162.1.1 (A:198-385) Malate dehydrogenase {Sorghu | 6e-18 | |
| d1o6za2 | 161 | d.162.1.1 (A:163-330) Malate dehydrogenase {Archae | 8e-18 | |
| d2cmda1 | 145 | c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichi | 3e-17 | |
| d1mlda1 | 144 | c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus s | 2e-16 | |
| d1hyea2 | 168 | d.162.1.1 (A:146-313) MJ0490, lactate/malate dehyd | 2e-16 | |
| d1ldna2 | 168 | d.162.1.1 (A:163-330) Lactate dehydrogenase {Bacil | 3e-16 | |
| d1up7a1 | 162 | c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Ther | 4e-16 | |
| d2cmda2 | 167 | d.162.1.1 (A:146-312) Malate dehydrogenase {Escher | 6e-16 | |
| d1s6ya1 | 169 | c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Baci | 6e-15 | |
| d1obba1 | 171 | c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermoto | 1e-14 | |
| d1y7ta2 | 173 | d.162.1.1 (A:154-332) Malate dehydrogenase {Thermu | 2e-14 | |
| d1b8pa2 | 171 | d.162.1.1 (A:159-329) Malate dehydrogenase {Aquasp | 2e-13 | |
| d1u8xx1 | 167 | c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase | 3e-13 |
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Length = 143 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: LDH N-terminal domain-like domain: Lactate dehydrogenase species: Bifidobacterium longum, strain am101-2 [TaxId: 216816]
Score = 93.5 bits (232), Expect = 4e-25
Identities = 37/81 (45%), Positives = 58/81 (71%)
Query: 20 NYALSEGSRIVIVTAGVRQREGESRLSLVERNVNIFKGIIPNIVKYSPQCTLLIVSNPVD 79
+ + + +V++TAG RQ+ G+SRL LV VNI K I+PN+VK +P ++++NPVD
Sbjct: 63 DPEICRDADMVVITAGPRQKPGQSRLELVGATVNILKAIMPNLVKVAPNAIYMLITNPVD 122
Query: 80 ILTYVSWKLSGFPKNRVIGSG 100
I T+V+ KL+G P+N++ GSG
Sbjct: 123 IATHVAQKLTGLPENQIFGSG 143
|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 148 | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Length = 142 | Back information, alignment and structure |
|---|
| >d2ldxa2 d.162.1.1 (A:160-331) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 172 | Back information, alignment and structure |
|---|
| >d1i0za2 d.162.1.1 (A:161-332) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Length = 172 | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Length = 146 | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 159 | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 140 | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Length = 142 | Back information, alignment and structure |
|---|
| >d1llda2 d.162.1.1 (A:150-319) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Length = 170 | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Length = 160 | Back information, alignment and structure |
|---|
| >d1y6ja2 d.162.1.1 (A:149-317) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Length = 169 | Back information, alignment and structure |
|---|
| >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 142 | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 142 | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Length = 146 | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 150 | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Length = 154 | Back information, alignment and structure |
|---|
| >d1a5za2 d.162.1.1 (A:164-333) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 172 | Back information, alignment and structure |
|---|
| >d1ldma2 d.162.1.1 (A:161-329) Lactate dehydrogenase {Dogfish (Squalus acanthias) [TaxId: 7797]} Length = 169 | Back information, alignment and structure |
|---|
| >d1ojua2 d.162.1.1 (A:164-331) Lactate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 152 | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Length = 142 | Back information, alignment and structure |
|---|
| >d1ez4a2 d.162.1.1 (A:163-334) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Length = 171 | Back information, alignment and structure |
|---|
| >d1hyha2 d.162.1.1 (A:167-329) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Length = 163 | Back information, alignment and structure |
|---|
| >d1pzga2 d.162.1.1 (A:164-334) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Length = 174 | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 145 | Back information, alignment and structure |
|---|
| >d1llca2 d.162.1.1 (A:165-334) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Length = 172 | Back information, alignment and structure |
|---|
| >d1mlda2 d.162.1.1 (A:145-313) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 169 | Back information, alignment and structure |
|---|
| >d1guza2 d.162.1.1 (A:143-305) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Length = 163 | Back information, alignment and structure |
|---|
| >d1uxja2 d.162.1.1 (A:144-307) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Length = 164 | Back information, alignment and structure |
|---|
| >d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Length = 175 | Back information, alignment and structure |
|---|
| >d1t2da2 d.162.1.1 (A:151-315) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 165 | Back information, alignment and structure |
|---|
| >d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 154 | Back information, alignment and structure |
|---|
| >d5mdha2 d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 179 | Back information, alignment and structure |
|---|
| >d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 154 | Back information, alignment and structure |
|---|
| >d7mdha2 d.162.1.1 (A:198-385) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} Length = 188 | Back information, alignment and structure |
|---|
| >d1o6za2 d.162.1.1 (A:163-330) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Length = 161 | Back information, alignment and structure |
|---|
| >d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 145 | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Length = 144 | Back information, alignment and structure |
|---|
| >d1hyea2 d.162.1.1 (A:146-313) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 168 | Back information, alignment and structure |
|---|
| >d1ldna2 d.162.1.1 (A:163-330) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 168 | Back information, alignment and structure |
|---|
| >d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} Length = 162 | Back information, alignment and structure |
|---|
| >d2cmda2 d.162.1.1 (A:146-312) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Length = 167 | Back information, alignment and structure |
|---|
| >d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} Length = 169 | Back information, alignment and structure |
|---|
| >d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} Length = 171 | Back information, alignment and structure |
|---|
| >d1y7ta2 d.162.1.1 (A:154-332) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 173 | Back information, alignment and structure |
|---|
| >d1b8pa2 d.162.1.1 (A:159-329) Malate dehydrogenase {Aquaspirillum arcticum [TaxId: 87645]} Length = 171 | Back information, alignment and structure |
|---|
| >d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} Length = 167 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 216 | |||
| d1llda1 | 143 | Lactate dehydrogenase {Bifidobacterium longum, str | 99.96 | |
| d1o6za1 | 142 | Malate dehydrogenase {Archaeon Haloarcula marismor | 99.96 | |
| d1y6ja1 | 142 | Lactate dehydrogenase {Clostridium thermocellum [T | 99.96 | |
| d1llda2 | 170 | Lactate dehydrogenase {Bifidobacterium longum, str | 99.96 | |
| d1ojua2 | 152 | Lactate dehydrogenase {Archaeon Archaeoglobus fulg | 99.96 | |
| d1i0za2 | 172 | Lactate dehydrogenase {Human (Homo sapiens), heart | 99.95 | |
| d1y6ja2 | 169 | Lactate dehydrogenase {Clostridium thermocellum [T | 99.95 | |
| d1ldna1 | 148 | Lactate dehydrogenase {Bacillus stearothermophilus | 99.95 | |
| d1ojua1 | 142 | Malate dehydrogenase {Archaeon Archaeoglobus fulgi | 99.95 | |
| d1a5za1 | 140 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 99.95 | |
| d1a5za2 | 172 | Lactate dehydrogenase {Thermotoga maritima [TaxId: | 99.95 | |
| d1hyha2 | 163 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 99.95 | |
| d1ez4a1 | 146 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 99.95 | |
| d1pzga2 | 174 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 99.95 | |
| d1i0za1 | 160 | Lactate dehydrogenase {Human (Homo sapiens), heart | 99.94 | |
| d1hyha1 | 146 | L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La | 99.94 | |
| d1ez4a2 | 171 | Lactate dehydrogenase {Lactobacillus pentosus [Tax | 99.94 | |
| d1uxja2 | 164 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 99.94 | |
| d1guza1 | 142 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 99.94 | |
| d1guza2 | 163 | Malate dehydrogenase {Chlorobium vibrioforme [TaxI | 99.94 | |
| d7mdha2 | 188 | Malate dehydrogenase {Sorghum (Sorghum vulgare), c | 99.94 | |
| d2ldxa1 | 159 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 99.94 | |
| d1uxja1 | 142 | Malate dehydrogenase {Chloroflexus aurantiacus [Ta | 99.94 | |
| d1t2da1 | 150 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 99.94 | |
| d1hyea1 | 145 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 99.94 | |
| d1ldma2 | 169 | Lactate dehydrogenase {Dogfish (Squalus acanthias) | 99.93 | |
| d2ldxa2 | 172 | Lactate dehydrogenase {Mouse (Mus musculus) [TaxId | 99.93 | |
| d1hyea2 | 168 | MJ0490, lactate/malate dehydrogenase {Archaeon Met | 99.93 | |
| d1t2da2 | 165 | Lactate dehydrogenase {Malaria parasite (Plasmodiu | 99.93 | |
| d2cmda1 | 145 | Malate dehydrogenase {Escherichia coli [TaxId: 562 | 99.93 | |
| d7mdha1 | 175 | Malate dehydrogenase {Sorghum (Sorghum vulgare), c | 99.93 | |
| d1llca2 | 172 | Lactate dehydrogenase {Lactobacillus casei [TaxId: | 99.93 | |
| d1ldna2 | 168 | Lactate dehydrogenase {Bacillus stearothermophilus | 99.93 | |
| d1mlda1 | 144 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 99.92 | |
| d5mdha2 | 179 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 99.92 | |
| d1y7ta1 | 154 | Malate dehydrogenase {Thermus thermophilus [TaxId: | 99.92 | |
| d5mdha1 | 154 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 99.91 | |
| d1o6za2 | 161 | Malate dehydrogenase {Archaeon Haloarcula marismor | 99.91 | |
| d1y7ta2 | 173 | Malate dehydrogenase {Thermus thermophilus [TaxId: | 99.91 | |
| d1pzga1 | 154 | Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 | 99.91 | |
| d1b8pa2 | 171 | Malate dehydrogenase {Aquaspirillum arcticum [TaxI | 99.86 | |
| d1s6ya1 | 169 | 6-phospho-beta-glucosidase {Bacillus stearothermop | 99.84 | |
| d1mlda2 | 169 | Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 | 99.82 | |
| d2cmda2 | 167 | Malate dehydrogenase {Escherichia coli [TaxId: 562 | 99.82 | |
| d1u8xx1 | 167 | Maltose-6'-phosphate glucosidase GlvA {Bacillus su | 99.81 | |
| d1up7a1 | 162 | 6-phospho-beta-glucosidase {Thermotoga maritima [T | 99.77 | |
| d1obba1 | 171 | Alpha-glucosidase AglA {Thermotoga maritima [TaxId | 99.69 | |
| d1vjta1 | 193 | Putative alpha-glucosidase TM0752 {Thermotoga mari | 98.39 | |
| d1up7a2 | 253 | 6-phospho-beta-glucosidase {Thermotoga maritima [T | 90.78 | |
| d1s6ya2 | 270 | 6-phospho-beta-glucosidase {Bacillus stearothermop | 89.86 | |
| d1obba2 | 308 | Alpha-glucosidase AglA {Thermotoga maritima [TaxId | 86.86 | |
| d1u8xx2 | 276 | Maltose-6'-phosphate glucosidase GlvA {Bacillus su | 85.33 | |
| d7reqb2 | 163 | Methylmalonyl-CoA mutase beta subunit, C-terminal | 84.95 |
| >d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NAD(P)-binding Rossmann-fold domains superfamily: NAD(P)-binding Rossmann-fold domains family: LDH N-terminal domain-like domain: Lactate dehydrogenase species: Bifidobacterium longum, strain am101-2 [TaxId: 216816]
Probab=99.96 E-value=4.4e-30 Score=200.56 Aligned_cols=97 Identities=40% Similarity=0.682 Sum_probs=91.0
Q ss_pred ccCC-CCCCCceEEEcCCccccCCccEEEEcCCCCCCCCcCHHHHHHHhHHHHHHHHHHHHhhCCCeEEEEEcCchhHHH
Q psy17689 4 TNDH-SSFKGVNVLTRLNYALSEGSRIVIVTAGVRQREGESRLSLVERNVNIFKGIIPNIVKYSPQCTLLIVSNPVDILT 82 (216)
Q Consensus 4 ~~d~-~~~~~~~v~~~~~~~~~~daDivvitag~~~k~g~~r~dll~~N~~i~~~i~~~i~~~~p~~iiivvtNPvd~~t 82 (216)
++|. +|.....+..+++|++++|||+||+|+|.|++|||+|+|++..|++|+++++++|++++|+++++++|||+|+||
T Consensus 46 l~~a~~~~~~~~i~~~~~~~~~~daDvVVitaG~~~~~g~~R~dl~~~N~~i~~~i~~~i~~~~p~ai~ivvtNPvDvmt 125 (143)
T d1llda1 46 MQHGSSFYPTVSIDGSDDPEICRDADMVVITAGPRQKPGQSRLELVGATVNILKAIMPNLVKVAPNAIYMLITNPVDIAT 125 (143)
T ss_dssp HHHTGGGSTTCEEEEESCGGGGTTCSEEEECCCCCCCTTCCHHHHHHHHHHHHHHHHHHHHHHCTTSEEEECCSSHHHHH
T ss_pred HHhccccCCCceeecCCCHHHhhCCcEEEEecccccCCCCchhhhhhhhHHHHHHHHHHHHhhCCCeEEEEeCCchHHHH
Confidence 4443 466677787889999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHhcCCCCCCEEeec
Q psy17689 83 YVSWKLSGFPKNRVIGSG 100 (216)
Q Consensus 83 ~~~~~~sg~~~~~viG~G 100 (216)
|++|+.||||++||||+|
T Consensus 126 ~~~~~~sg~p~~rViG~G 143 (143)
T d1llda1 126 HVAQKLTGLPENQIFGSG 143 (143)
T ss_dssp HHHHHHHTCCTTSEEECT
T ss_pred HHHHHHHCCChhhccCCC
Confidence 999999999999999997
|
| >d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1llda2 d.162.1.1 (A:150-319) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} | Back information, alignment and structure |
|---|
| >d1ojua2 d.162.1.1 (A:164-331) Lactate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1i0za2 d.162.1.1 (A:161-332) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y6ja2 d.162.1.1 (A:149-317) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1a5za2 d.162.1.1 (A:164-333) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1hyha2 d.162.1.1 (A:167-329) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1pzga2 d.162.1.1 (A:164-334) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} | Back information, alignment and structure |
|---|
| >d1ez4a2 d.162.1.1 (A:163-334) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} | Back information, alignment and structure |
|---|
| >d1uxja2 d.162.1.1 (A:144-307) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d1guza2 d.162.1.1 (A:143-305) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} | Back information, alignment and structure |
|---|
| >d7mdha2 d.162.1.1 (A:198-385) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} | Back information, alignment and structure |
|---|
| >d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1ldma2 d.162.1.1 (A:161-329) Lactate dehydrogenase {Dogfish (Squalus acanthias) [TaxId: 7797]} | Back information, alignment and structure |
|---|
| >d2ldxa2 d.162.1.1 (A:160-331) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1hyea2 d.162.1.1 (A:146-313) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1t2da2 d.162.1.1 (A:151-315) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d7mdha1 c.2.1.5 (A:23-197) Malate dehydrogenase {Sorghum (Sorghum vulgare), chloroplast [TaxId: 4558]} | Back information, alignment and structure |
|---|
| >d1llca2 d.162.1.1 (A:165-334) Lactate dehydrogenase {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1ldna2 d.162.1.1 (A:163-330) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d5mdha2 d.162.1.1 (A:155-333) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1y7ta1 c.2.1.5 (A:0-153) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d5mdha1 c.2.1.5 (A:1-154) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1o6za2 d.162.1.1 (A:163-330) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} | Back information, alignment and structure |
|---|
| >d1y7ta2 d.162.1.1 (A:154-332) Malate dehydrogenase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} | Back information, alignment and structure |
|---|
| >d1b8pa2 d.162.1.1 (A:159-329) Malate dehydrogenase {Aquaspirillum arcticum [TaxId: 87645]} | Back information, alignment and structure |
|---|
| >d1s6ya1 c.2.1.5 (A:4-172) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1mlda2 d.162.1.1 (A:145-313) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2cmda2 d.162.1.1 (A:146-312) Malate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1u8xx1 c.2.1.5 (X:3-169) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1up7a1 c.2.1.5 (A:1-162) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1obba1 c.2.1.5 (A:2-172) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1up7a2 d.162.1.2 (A:163-415) 6-phospho-beta-glucosidase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1s6ya2 d.162.1.2 (A:173-445) 6-phospho-beta-glucosidase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1obba2 d.162.1.2 (A:173-480) Alpha-glucosidase AglA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1u8xx2 d.162.1.2 (X:170-445) Maltose-6'-phosphate glucosidase GlvA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d7reqb2 c.23.6.1 (B:476-638) Methylmalonyl-CoA mutase beta subunit, C-terminal domain {Propionibacterium freudenreichii, subsp. shermanii [TaxId: 1744]} | Back information, alignment and structure |
|---|