Participates in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. Binds to single and double stranded DNA and exhibits DNA-dependent ATPase activity. Underwinds duplex DNA and forms helical nucleoprotein filaments. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51C and XRCC3.
Oryctolagus cuniculus (taxid: 9986)
>sp|P70099|RAD51_CRIGR DNA repair protein RAD51 homolog 1 OS=Cricetulus griseus GN=RAD51 PE=2 SV=1
Participates in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. Binds to single and double stranded DNA and exhibits DNA-dependent ATPase activity. Underwinds duplex DNA and forms helical nucleoprotein filaments. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51C and XRCC3.
Cricetulus griseus (taxid: 10029)
>sp|Q8MKI8|RAD51_CANFA DNA repair protein RAD51 homolog 1 OS=Canis familiaris GN=RAD51 PE=2 SV=1
Participates in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. Binds to single and double stranded DNA and exhibits DNA-dependent ATPase activity. Underwinds duplex DNA and forms helical nucleoprotein filaments. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51C and XRCC3.
Canis familiaris (taxid: 9615)
>sp|Q2KJ94|RAD51_BOVIN DNA repair protein RAD51 homolog 1 OS=Bos taurus GN=RAD51 PE=2 SV=1
Participates in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. Binds to single and double stranded DNA and exhibits DNA-dependent ATPase activity. Underwinds duplex DNA and forms helical nucleoprotein filaments. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51C and XRCC3.
Bos taurus (taxid: 9913)
>sp|Q06609|RAD51_HUMAN DNA repair protein RAD51 homolog 1 OS=Homo sapiens GN=RAD51 PE=1 SV=1
Participates in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. Binds to single and double stranded DNA and exhibits DNA-dependent ATPase activity. Underwinds duplex DNA and forms helical nucleoprotein filaments. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51C and XRCC3.
Homo sapiens (taxid: 9606)
>sp|Q08297|RAD51_MOUSE DNA repair protein RAD51 homolog 1 OS=Mus musculus GN=Rad51 PE=1 SV=1
Participates in a common DNA damage response pathway associated with the activation of homologous recombination and double-strand break repair. Binds to single and double stranded DNA and exhibits DNA-dependent ATPase activity. Underwinds duplex DNA and forms helical nucleoprotein filaments. Plays a role in regulating mitochondrial DNA copy number under conditions of oxidative stress in the presence of RAD51C and XRCC3.
Mus musculus (taxid: 10090)
>sp|Q91918|RA51A_XENLA DNA repair protein RAD51 homolog A OS=Xenopus laevis GN=rad51-a PE=2 SV=1
Binds to single and double stranded DNA and exhibits DNA-dependent ATPase activity. Unwinds duplex DNA (By similarity). Component of the meiotic recombination pathway. Seems to play a role in mediating chromosome homology search, chromosome pairing and synapsis at early stages and probably chromosome crossing-over at later stages in meiosis. Probably is involved in the repair of meiotic double strand breaks (DBSs) generated by AtSPO11-1 and in homologous recombination. Its function is dispensable for vegetative growth and root mitosis.
Arabidopsis thaliana (taxid: 3702)
Close Homologs in the Non-Redundant Database Detected by BLAST
>gi|241007827|ref|XP_002405184.1| DNA repair protein RAD51/RHP55, putative [Ixodes scapularis] gi|215491711|gb|EEC01352.1| DNA repair protein RAD51/RHP55, putative [Ixodes scapularis]
This eukaryotic sequence family consists of RAD51, a protein involved in DNA homologous recombination and repair. It is similar in sequence the exclusively meiotic recombinase DMC1 (TIGR02238), to archaeal families RadA (TIGR02236) and RadB (TIGR02237), and to bacterial RecA (TIGR02012). Length = 316
This group of recombinases includes the eukaryotic proteins RAD51, RAD55/57 and the meiosis-specific protein DMC1, and the archaeal proteins radA and radB. They are closely related to the bacterial RecA group. Rad51 proteins catalyze a similiar recombination reaction as RecA, using ATP-dependent DNA binding activity and a DNA-dependent ATPase. However, this reaction is less efficient and requires accessory proteins such as RAD55/57 . Length = 235
>gnl|CDD|238687 cd01393, recA_like, RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response
RecA couples ATP hydrolysis to DNA strand exchange. While prokaryotes have a single RecA protein, eukaryotes have multiple RecA homologs such as Rad51, DMC1 and Rad55/57. Archaea have the RecA-like homologs radA and radB. Length = 226
This model describes DMC1, a subfamily of a larger family of DNA repair and recombination proteins. It is eukaryotic only and most closely related to eukaryotic RAD51. It also resembles archaeal RadA (TIGR02236) and RadB (TIGR02237) and bacterial RecA (TIGR02012). It has been characterized for human as a recombinase active only in meiosis. Length = 313
>gnl|CDD|215620 PLN03187, PLN03187, meiotic recombination protein DMC1 homolog; Provisional
Score = 51.9 bits (125), Expect = 2e-09
Identities = 19/44 (43%), Positives = 25/44 (56%)
Query: 2 KYALLIVDSAMALYRTDYSGRGELSARQMHLARFLRMLLRLADE 45
K LL+VDS AL R + G L R L++ LR L RLA++
Sbjct: 141 KIDLLVVDSVAALVRAEEIEDGHLGLRARLLSKALRKLTRLANK 184
Length = 279
>gnl|CDD|235273 PRK04301, radA, DNA repair and recombination protein RadA; Validated
This family consists exclusively of archaeal RadA protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239), and archaeal RadB (TIGR02237). This protein is involved in DNA repair and recombination. The member from Pyrococcus horikoshii contains an intein [DNA metabolism, DNA replication, recombination, and repair]. Length = 310
This is a family of fungal and plant proteins and contains many hypothetical proteins. VID27 is a cytoplasmic protein that plays a potential role in vacuolar protein degradation. Length = 794
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein
The YqfQ-like protein family includes the B. subtilis YqfQ protein, also known as VrrA, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 146 and 237 amino acids in length. There are two conserved sequence motifs: QYGP and PKLY. Length = 155
Score = 38.4 bits (90), Expect = 2e-04
Identities = 21/59 (35%), Positives = 27/59 (45%), Gaps = 6/59 (10%)
Query: 28 RQMHLARFLRMLLRLADEQKRRKRKGEEEEENEENEE-EEEEEEEEEEQEEEEEEEKEQ 85
R + +AR R RLA E+ + KR + EE EE E E EE E + E Q
Sbjct: 249 RWLLIAR--R---RLAYERAKAKRAEILAQRAEEEEESSEGAAETIEEPELDLETISAQ 302
The small mechanosensitive channel, MscS, is a part of the turgor-driven solute efflux system that protects bacteria from lysis in the event of osmotic shock. The MscS protein alone is sufficient to form a functional mechanosensitive channel gated directly by tension in the lipid bilayer. The MscS proteins are heptamers of three transmembrane subunits with seven converging M3 domains, and this domain is one of the inner membrane domains. Length = 339
>gnl|CDD|217049 pfam02459, Adeno_terminal, Adenoviral DNA terminal protein
Human SGLT1 (hSGLT1) is a high-affinity/low-capacity glucose transporter, which can also transport galactose. In the transport mechanism, two Na+ ions first bind to the extracellular side of the transporter and induce a conformational change in the glucose binding site. This results in an increased affinity for glucose. A second conformational change in the transporter follows, bringing the Na+ and glucose binding sites to the inner surface of the membrane. Glucose is then released, followed by the Na+ ions. In the process, hSGLT1 is also able to transport water and urea and may be a major pathway for transport of these across the intestinal brush-border membrane. hSGLT1 is encoded by the SLC5A1 gene and expressed mostly in the intestine, but also in the trachea, kidney, heart, brain, testis, and prostate. The WHO/UNICEF oral rehydration solution (ORS) for the treatment of secretory diarrhea contains salt and glucose. The glucose, along with sodium ions, is transported by hSGLT1 and water is either co-transported along with these or follows by osmosis. Mutations in SGLT1 are associated with intestinal glucose galactose malabsorption (GGM). Up-regulation of intestinal SGLT1 may protect against enteric infections. SGLT1 is expressed in colorectal, head and neck, and prostate tumors. Epidermal growth factor receptor (EGFR) functions in cell survival by stabilizing SGLT1, and thereby maintaining intracellular glucose levels. SGLT1 is predicted to have 14 membrane-spanning regions. This subgroup belongs to the solute carrier 5 (SLC5)transporter family. Length = 635
Score = 37.6 bits (87), Expect = 3e-04
Identities = 24/43 (55%), Positives = 31/43 (72%)
Query: 52 KGEEEEENEENEEEEEEEEEEEEQEEEEEEEKEQEEEDQTNEE 94
+ EE E EE EEEEEEEEE+E +EEE E+E+E+EE + N
Sbjct: 440 EEEESVEEEEEEEEEEEEEEQESEEEEGEDEEEEEEVEADNGS 482
The Daxx protein (also known as the Fas-binding protein) is thought to play a role in apoptosis, but precise role played by Daxx remains to be determined. Daxx forms a complex with Axin. Length = 715
Score = 37.3 bits (87), Expect = 4e-04
Identities = 14/53 (26%), Positives = 26/53 (49%)
Query: 42 LADEQKRRKRKGEEEEENEENEEEEEEEEEEEEQEEEEEEEKEQEEEDQTNEE 94
L + + +R+ E + E E E + ++E+E EE+ +E+ED E
Sbjct: 226 LKETSETEEREEETDVEIETTSETKGTKQEQEGSTEEDPSLFSEEKEDPDKTE 278
The chloroplast genomes of most higher plants contain two giant open reading frames designated ycf1 and ycf2. Although the function of Ycf1 is unknown, it is known to be an essential gene. Length = 832
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional
This is a family of fungal and plant proteins and contains many hypothetical proteins. VID27 is a cytoplasmic protein that plays a potential role in vacuolar protein degradation. Length = 794
>gnl|CDD|222581 pfam14181, YqfQ, YqfQ-like protein
The YqfQ-like protein family includes the B. subtilis YqfQ protein, also known as VrrA, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 146 and 237 amino acids in length. There are two conserved sequence motifs: QYGP and PKLY. Length = 155
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family
Score = 36.6 bits (84), Expect = 7e-04
Identities = 18/53 (33%), Positives = 30/53 (56%)
Query: 45 EQKRRKRKGEEEEENEENEEEEEEEEEEEEQEEEEEEEKEQEEEDQTNEERVG 97
E+ K K E E++ E E E+E+E+E E+E E E E+ + ++E R+
Sbjct: 582 EEAVEKAKREAEQKAREEREREKEKEKEREREREREAERAAKASSSSHESRMS 634
Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity. Length = 979
>gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein
This is a family of fungal and plant proteins and contains many hypothetical proteins. VID27 is a cytoplasmic protein that plays a potential role in vacuolar protein degradation. Length = 794
Score = 35.7 bits (82), Expect = 0.001
Identities = 21/49 (42%), Positives = 26/49 (53%)
Query: 45 EQKRRKRKGEEEEENEENEEEEEEEEEEEEQEEEEEEEKEQEEEDQTNE 93
E K KGE E E E+E E E E E+E E E EE E+ E++ E
Sbjct: 700 EAKEADHKGETEAEEVEHEGETEAEGTEDEGEIETGEEGEEVEDEGEGE 748
[Transport and binding proteins, Cations and iron carrying compounds]. Length = 1096
Score = 36.0 bits (83), Expect = 0.001
Identities = 8/31 (25%), Positives = 16/31 (51%)
Query: 59 NEENEEEEEEEEEEEEQEEEEEEEKEQEEED 89
N E + + ++ E E+E E E ++E +
Sbjct: 539 NSTEERIDLDADDWTEDEDENEMETDEERKK 569
Human SGLT1 (hSGLT1) is a high-affinity/low-capacity glucose transporter, which can also transport galactose. In the transport mechanism, two Na+ ions first bind to the extracellular side of the transporter and induce a conformational change in the glucose binding site. This results in an increased affinity for glucose. A second conformational change in the transporter follows, bringing the Na+ and glucose binding sites to the inner surface of the membrane. Glucose is then released, followed by the Na+ ions. In the process, hSGLT1 is also able to transport water and urea and may be a major pathway for transport of these across the intestinal brush-border membrane. hSGLT1 is encoded by the SLC5A1 gene and expressed mostly in the intestine, but also in the trachea, kidney, heart, brain, testis, and prostate. The WHO/UNICEF oral rehydration solution (ORS) for the treatment of secretory diarrhea contains salt and glucose. The glucose, along with sodium ions, is transported by hSGLT1 and water is either co-transported along with these or follows by osmosis. Mutations in SGLT1 are associated with intestinal glucose galactose malabsorption (GGM). Up-regulation of intestinal SGLT1 may protect against enteric infections. SGLT1 is expressed in colorectal, head and neck, and prostate tumors. Epidermal growth factor receptor (EGFR) functions in cell survival by stabilizing SGLT1, and thereby maintaining intracellular glucose levels. SGLT1 is predicted to have 14 membrane-spanning regions. This subgroup belongs to the solute carrier 5 (SLC5)transporter family. Length = 635
>gnl|CDD|179712 PRK04019, rplP0, acidic ribosomal protein P0; Validated
Score = 36.0 bits (83), Expect = 0.001
Identities = 17/63 (26%), Positives = 35/63 (55%)
Query: 32 LARFLRMLLRLADEQKRRKRKGEEEEENEENEEEEEEEEEEEEQEEEEEEEKEQEEEDQT 91
+ L+ + Q+ + + E+E++ EE +++E+E E E+ E E E + E EED+
Sbjct: 628 ILDVLKADENKSRHQQLFEGEEEDEDDLEETDDDEDECEAIEDSESESESDGEDGEEDEQ 687
Query: 92 NEE 94
++
Sbjct: 688 EDD 690
This family includes the fifth essential DNA polymerase in yeast EC:2.7.7.7. Pol5p is localised exclusively to the nucleolus and binds near or at the enhancer region of rRNA-encoding DNA repeating units. Length = 784
Score = 35.9 bits (83), Expect = 0.002
Identities = 17/53 (32%), Positives = 30/53 (56%)
Query: 40 LRLADEQKRRKRKGEEEEENEENEEEEEEEEEEEEQEEEEEEEKEQEEEDQTN 92
L + D R + EE+EE EE E+E+E +E +EE EE+ + + + ++
Sbjct: 379 LEIEDANTERDDEEEEDEEEEEEEDEDEGPSKEHSDDEEFEEDDVESKYEDSD 431
This is a family of fungal and plant proteins and contains many hypothetical proteins. VID27 is a cytoplasmic protein that plays a potential role in vacuolar protein degradation. Length = 794
>gnl|CDD|219900 pfam08553, VID27, VID27 cytoplasmic protein
Score = 35.1 bits (81), Expect = 0.002
Identities = 17/42 (40%), Positives = 26/42 (61%)
Query: 54 EEEEENEENEEEEEEEEEEEEQEEEEEEEKEQEEEDQTNEER 95
E ++E EE+EEEEEEE+E E +E + EE ++ + E
Sbjct: 384 ANTERDDEEEEDEEEEEEEDEDEGPSKEHSDDEEFEEDDVES 425
This is a family of fungal and plant proteins and contains many hypothetical proteins. VID27 is a cytoplasmic protein that plays a potential role in vacuolar protein degradation. Length = 794
Score = 35.7 bits (82), Expect = 0.002
Identities = 24/41 (58%), Positives = 29/41 (70%)
Query: 54 EEEEENEENEEEEEEEEEEEEQEEEEEEEKEQEEEDQTNEE 94
E EE EE EEEEEEEE+E E+EE E+EE+E+E E E
Sbjct: 443 ESVEEEEEEEEEEEEEEQESEEEEGEDEEEEEEVEADNGSE 483
The Daxx protein (also known as the Fas-binding protein) is thought to play a role in apoptosis, but precise role played by Daxx remains to be determined. Daxx forms a complex with Axin. Length = 715
Score = 35.7 bits (82), Expect = 0.002
Identities = 26/45 (57%), Positives = 33/45 (73%)
Query: 54 EEEEENEENEEEEEEEEEEEEQEEEEEEEKEQEEEDQTNEERVGG 98
EEE EE EEEEEEE+E EE+E E+EEE+E+ E D +EE + G
Sbjct: 444 SVEEEEEEEEEEEEEEQESEEEEGEDEEEEEEVEADNGSEEEMEG 488
The Daxx protein (also known as the Fas-binding protein) is thought to play a role in apoptosis, but precise role played by Daxx remains to be determined. Daxx forms a complex with Axin. Length = 715
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family
Score = 35.4 bits (81), Expect = 0.002
Identities = 17/45 (37%), Positives = 28/45 (62%)
Query: 41 RLADEQKRRKRKGEEEEENEENEEEEEEEEEEEEQEEEEEEEKEQ 85
+LA +++ K + E E + EE E E+E+E+E+E E E E E+
Sbjct: 576 KLAKKREEAVEKAKREAEQKAREEREREKEKEKEREREREREAER 620
Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity. Length = 979
>gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein
CDC45 is an essential gene required for initiation of DNA replication in S. cerevisiae, forming a complex with MCM5/CDC46. Homologues of CDC45 have been identified in human, mouse and smut fungus among others. Length = 583
>gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein
CDC45 is an essential gene required for initiation of DNA replication in S. cerevisiae, forming a complex with MCM5/CDC46. Homologues of CDC45 have been identified in human, mouse and smut fungus among others. Length = 583
Members of this family are components of the RNA polymerase II associated Paf1 complex. The Paf1 complex functions during the elongation phase of transcription in conjunction with Spt4-Spt5 and Spt16-Pob3i. Length = 431
Score = 34.3 bits (79), Expect = 0.003
Identities = 13/44 (29%), Positives = 25/44 (56%)
Query: 52 KGEEEEENEENEEEEEEEEEEEEQEEEEEEEKEQEEEDQTNEER 95
++EEE E E +E E+E+ + + E +EK++ E + E+
Sbjct: 93 SSDDEEEETEEESTDETEQEDPPETKTESKEKKKREVPKPKTEK 136
The YqfQ-like protein family includes the B. subtilis YqfQ protein, also known as VrrA, which is functionally uncharacterized. This family of proteins is found in bacteria. Proteins in this family are typically between 146 and 237 amino acids in length. There are two conserved sequence motifs: QYGP and PKLY. Length = 155
Score = 35.3 bits (81), Expect = 0.003
Identities = 25/47 (53%), Positives = 33/47 (70%)
Query: 52 KGEEEEENEENEEEEEEEEEEEEQEEEEEEEKEQEEEDQTNEERVGG 98
+E EE E EEEEEEEEEEEE+E+E EEE+ ++EE++ E G
Sbjct: 435 ASQESEEEESVEEEEEEEEEEEEEEQESEEEEGEDEEEEEEVEADNG 481
The Daxx protein (also known as the Fas-binding protein) is thought to play a role in apoptosis, but precise role played by Daxx remains to be determined. Daxx forms a complex with Axin. Length = 715
Score = 34.9 bits (80), Expect = 0.003
Identities = 27/54 (50%), Positives = 37/54 (68%)
Query: 46 QKRRKRKGEEEEENEENEEEEEEEEEEEEQEEEEEEEKEQEEEDQTNEERVGGQ 99
Q+ + + EEEE EE EEEEEE+E EEE+ E+EEEE+E E ++ + EE G
Sbjct: 437 QESEEEESVEEEEEEEEEEEEEEQESEEEEGEDEEEEEEVEADNGSEEEMEGSS 490
The Daxx protein (also known as the Fas-binding protein) is thought to play a role in apoptosis, but precise role played by Daxx remains to be determined. Daxx forms a complex with Axin. Length = 715
>gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional
Human SGLT1 (hSGLT1) is a high-affinity/low-capacity glucose transporter, which can also transport galactose. In the transport mechanism, two Na+ ions first bind to the extracellular side of the transporter and induce a conformational change in the glucose binding site. This results in an increased affinity for glucose. A second conformational change in the transporter follows, bringing the Na+ and glucose binding sites to the inner surface of the membrane. Glucose is then released, followed by the Na+ ions. In the process, hSGLT1 is also able to transport water and urea and may be a major pathway for transport of these across the intestinal brush-border membrane. hSGLT1 is encoded by the SLC5A1 gene and expressed mostly in the intestine, but also in the trachea, kidney, heart, brain, testis, and prostate. The WHO/UNICEF oral rehydration solution (ORS) for the treatment of secretory diarrhea contains salt and glucose. The glucose, along with sodium ions, is transported by hSGLT1 and water is either co-transported along with these or follows by osmosis. Mutations in SGLT1 are associated with intestinal glucose galactose malabsorption (GGM). Up-regulation of intestinal SGLT1 may protect against enteric infections. SGLT1 is expressed in colorectal, head and neck, and prostate tumors. Epidermal growth factor receptor (EGFR) functions in cell survival by stabilizing SGLT1, and thereby maintaining intracellular glucose levels. SGLT1 is predicted to have 14 membrane-spanning regions. This subgroup belongs to the solute carrier 5 (SLC5)transporter family. Length = 635
Score = 34.5 bits (79), Expect = 0.004
Identities = 9/32 (28%), Positives = 17/32 (53%)
Query: 49 RKRKGEEEEENEENEEEEEEEEEEEEQEEEEE 80
R E + + ++ E+E+E E E EE ++
Sbjct: 538 RNSTEERIDLDADDWTEDEDENEMETDEERKK 569
Human SGLT1 (hSGLT1) is a high-affinity/low-capacity glucose transporter, which can also transport galactose. In the transport mechanism, two Na+ ions first bind to the extracellular side of the transporter and induce a conformational change in the glucose binding site. This results in an increased affinity for glucose. A second conformational change in the transporter follows, bringing the Na+ and glucose binding sites to the inner surface of the membrane. Glucose is then released, followed by the Na+ ions. In the process, hSGLT1 is also able to transport water and urea and may be a major pathway for transport of these across the intestinal brush-border membrane. hSGLT1 is encoded by the SLC5A1 gene and expressed mostly in the intestine, but also in the trachea, kidney, heart, brain, testis, and prostate. The WHO/UNICEF oral rehydration solution (ORS) for the treatment of secretory diarrhea contains salt and glucose. The glucose, along with sodium ions, is transported by hSGLT1 and water is either co-transported along with these or follows by osmosis. Mutations in SGLT1 are associated with intestinal glucose galactose malabsorption (GGM). Up-regulation of intestinal SGLT1 may protect against enteric infections. SGLT1 is expressed in colorectal, head and neck, and prostate tumors. Epidermal growth factor receptor (EGFR) functions in cell survival by stabilizing SGLT1, and thereby maintaining intracellular glucose levels. SGLT1 is predicted to have 14 membrane-spanning regions. This subgroup belongs to the solute carrier 5 (SLC5)transporter family. Length = 635
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family
Score = 34.7 bits (79), Expect = 0.004
Identities = 16/46 (34%), Positives = 28/46 (60%)
Query: 47 KRRKRKGEEEEENEENEEEEEEEEEEEEQEEEEEEEKEQEEEDQTN 92
K K++ E E+ + E++ EE E E+E+E+E E+E+E E +
Sbjct: 576 KLAKKREEAVEKAKREAEQKAREEREREKEKEKEREREREREAERA 621
Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity. Length = 979
>gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family
Score = 34.7 bits (79), Expect = 0.004
Identities = 16/41 (39%), Positives = 25/41 (60%)
Query: 46 QKRRKRKGEEEEENEENEEEEEEEEEEEEQEEEEEEEKEQE 86
+KR + + + E E+ EE E E+E+E+E E E E+E E
Sbjct: 579 KKREEAVEKAKREAEQKAREEREREKEKEKEREREREREAE 619
Atrophin-1 is the protein product of the dentatorubral-pallidoluysian atrophy (DRPLA) gene. DRPLA OMIM:125370 is a progressive neurodegenerative disorder. It is caused by the expansion of a CAG repeat in the DRPLA gene on chromosome 12p. This results in an extended polyglutamine region in atrophin-1, that is thought to confer toxicity to the protein, possibly through altering its interactions with other proteins. The expansion of a CAG repeat is also the underlying defect in six other neurodegenerative disorders, including Huntington's disease. One interaction of expanded polyglutamine repeats that is thought to be pathogenic is that with the short glutamine repeat in the transcriptional coactivator CREB binding protein, CBP. This interaction draws CBP away from its usual nuclear location to the expanded polyglutamine repeat protein aggregates that are characteristic of the polyglutamine neurodegenerative disorders. This interferes with CBP-mediated transcription and causes cytotoxicity. Length = 979
>gnl|CDD|217203 pfam02724, CDC45, CDC45-like protein
CDC45 is an essential gene required for initiation of DNA replication in S. cerevisiae, forming a complex with MCM5/CDC46. Homologues of CDC45 have been identified in human, mouse and smut fungus among others. Length = 583
>gnl|CDD|235396 PRK05299, rpsB, 30S ribosomal protein S2; Provisional
Score = 34.7 bits (80), Expect = 0.004
Identities = 18/30 (60%), Positives = 25/30 (83%)
Query: 59 NEENEEEEEEEEEEEEQEEEEEEEKEQEEE 88
N E ++EEEE+E+EEE+EEEEE E+ + EE
Sbjct: 343 NPEQKDEEEEQEDEEEEEEEEEPEEPEPEE 372
This family includes the radial spoke head proteins RSP4 and RSP6 from Chlamydomonas reinhardtii, and several eukaryotic homologues, including mammalian RSHL1, the protein product of a familial ciliary dyskinesia candidate gene. Length = 481
It is critical for DNA binding []. Rad51 is a homologue of the bacterial RecA protein. Rad51 and RecA share a core ATPase domain.; PDB: 2ZUC_A 2Z43_C 2ZUD_B 2DFL_A 2ZUB_A 2BKE_A 2KZ3_A 2CVH_B 2CVF_B 1SZP_D ....
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional
This model describes DMC1, a subfamily of a larger family of DNA repair and recombination proteins. It is eukaryotic only and most closely related to eukaryotic RAD51. It also resembles archaeal RadA (TIGR02236) and RadB (TIGR02237) and bacterial RecA (TIGR02012). It has been characterized for human as a recombinase active only in meiosis.
This eukaryotic sequence family consists of RAD51, a protein involved in DNA homologous recombination and repair. It is similar in sequence the exclusively meiotic recombinase DMC1 (TIGR02238), to archaeal families RadA (TIGR02236) and RadB (TIGR02237), and to bacterial RecA (TIGR02012).
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair]
This family consists exclusively of archaeal RadA protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239), and archaeal RadB (TIGR02237). This protein is involved in DNA repair and recombination. The member from Pyrococcus horikoshii contains an intein.
>PRK04301 radA DNA repair and recombination protein RadA; Validated
This group of recombinases includes the eukaryotic proteins RAD51, RAD55/57 and the meiosis-specific protein DMC1, and the archaeal proteins radA and radB. They are closely related to the bacterial RecA group. Rad51 proteins catalyze a similiar recombination reaction as RecA, using ATP-dependent DNA binding activity and a DNA-dependent ATPase. However, this reaction is less efficient and requires accessory proteins such as RAD55/57 .
>PRK09361 radB DNA repair and recombination protein RadB; Provisional
RecA couples ATP hydrolysis to DNA strand exchange. While prokaryotes have a single RecA protein, eukaryotes have multiple RecA homologs such as Rad51, DMC1 and Rad55/57. Archaea have the RecA-like homologs radA and radB.
This family consists exclusively of archaeal RadB protein, a homolog of bacterial RecA (TIGR02012), eukaryotic RAD51 (TIGR02239) and DMC1 (TIGR02238), and archaeal RadA (TIGR02236).
>PRK09519 recA DNA recombination protein RecA; Reviewed
This model describes orthologs of the recA protein. RecA promotes hybridization of homolgous regions of DNA. A segment of ssDNA can be hybridized to another ssDNA region, or to a dsDNA region. ATP is hydrolyzed in the process. Part of the SOS respones, it is regulated by LexA via autocatalytic cleavage.
This KaiC domain-containing protein family occurs sporadically across a broad taxonomic range (Euryarchaeota, Aquificae, Dictyoglomi, Epsilonproteobacteria, and Firmicutes), but exclusively in thermophiles.
The gene protuct codes for a probable ATP-dependent protease involved in both DNA repair and degradation of proteins, peptides, glycopeptides. Also known as sms. Residues 11-28 of the SEED alignment contain a putative Zn binding domain. Residues 110-117 of the seed contain a putative ATP binding site both documented in Haemophilus and in Listeria monocytogenes. for E.coli see ( J. BACTERIOL. 178:5045-5048(1996)).
>cd01121 Sms Sms (bacterial radA) DNA repair protein
This protein is not related to archael radA any more than is to other RecA-like NTPases. Sms has a role in recombination and recombinational repair and is responsible for the stabilization or processing of branched DNA molecules.
The hexameric helicase DnaB unwinds the DNA duplex at the chromosome replication fork. Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis.
This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.
Members of this family contain a single copy of the KaiC domain (pfam06745) that occurs in two copies of the circadian clock protein kinase KaiC itself. Members occur primarily in thermophilic archaea and in Thermotoga.
This model describes the helicase DnaB, a homohexameric protein required for DNA replication. The homohexamer can form a ring around a single strand of DNA near a replication fork. An intein of 400 residues is found at a conserved location in DnaB of Synechocystis PCC6803, Rhodothermus marinus (both experimentally confirmed), and Mycobacterium tuberculosis. The intein removes itself by a self-splicing reaction. The seed alignment contains inteins so that the model built from the seed alignment will model a low cost at common intein insertion sites.
Members of this family are phage (or prophage-region) homologs of the bacterial homohexameric replicative helicase DnaB. Some phage may rely on host DnaB, while others encode their own verions. This model describes the largest phage-specific clade among the close homologs of DnaB, but there are, or course, other DnaB homologs from phage that fall outside the scope of this model.
RepA is encoded by a plasmid, which is found in most Gram negative bacteria. RepA is a 5'-3' DNA helicase which can utilize ATP, GTP and CTP to a lesser extent.
>PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response []
In homologous recombination, the protein functions as a DNA-dependent ATPase, promoting synapsis, heteroduplex formation and strand exchange between homologous DNAs []. RecA also acts as a protease cofactor that promotes autodigestion of the lexA product and phage repressors. The proteolytic inactivation of the lexA repressor by an activated form of recA may cause a derepression of the 20 or so genes involved in the SOS response, which regulates DNA repair, induced mutagenesis, delayed cell division and prophage induction in response to DNA damage []. RecA is a protein of about 350 amino-acid residues. Its sequence is very well conserved [, , ] among eubacterial species. It is also found in the chloroplast of plants []. RecA-like proteins are found in archaea and diverse eukaryotic organisms, like fission yeast, mouse or human. In the filament visualised by X-ray crystallography, beta-strand 3, the loop C-terminal to beta-strand 2, and alpha-helix D of the core domain form one surface that packs against alpha-helix A and beta-strand 0 (the N-terminal domain) of an adjacent monomer during polymerisation []. The core ATP-binding site domain is well conserved, with 14 invariant residues. It contains the nucleotide binding loop between beta-strand 1 and alpha-helix C. The Escherichia coli sequence GPESSGKT matches the consensus sequence of amino acids (G/A)XXXXGK(T/S) for the Walker A box (also referred to as the P-loop) found in a number of nucleoside triphosphate (NTP)-binding proteins. Another nucleotide binding motif, the Walker B box is found at beta-strand 4 in the RecA structure. The Walker B box is characterised by four hydrophobic amino acids followed by an acidic residue (usually aspartate). Nucleotide specificity and additional ATP binding interactions are contributed by the amino acid residues at beta-strand 2 and the loop C-terminal to that strand, all of which are greater than 90% conserved among bacterial RecA proteins.; GO: 0003697 single-stranded DNA binding, 0005524 ATP binding, 0006281 DNA repair; PDB: 2IN0_A 1MO3_A 3IFJ_A 2IN8_A 2IMZ_B 1G18_A 1MO4_A 3IGD_A 2L8L_A 2IN9_A ....
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family
This model represents a rather narrowly distributed archaeal protein family in which members have a single copy of the KaiC domain. This stands in contrast to the circadian clock protein KaiC itself, with two copies of the domain. Members are expected to have weak ATPase activity, by homology to the autokinase/autophosphorylase KaiC itself.
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork
Although the mechanism by which DnaB both couples ATP hydrolysis to translocation along DNA and denatures the duplex is unknown, a change in the quaternary structure of the protein involving dimerization of the N-terminal domain has been observed and may occur during the enzymatic cycle. This C-terminal domain contains an ATP-binding site and is therefore probably the site of ATP hydrolysis. ; GO: 0003678 DNA helicase activity, 0005524 ATP binding, 0006260 DNA replication; PDB: 1Q57_E 1E0K_D 1E0J_B 1CR2_A 1CR4_A 1CR1_A 1CR0_A 1MI8_A 2R6D_B 2R6C_C ....
More than one copy is sometimes found in each protein in this entry. These include KaiC, which is one of the Kai proteins among which direct protein-protein association may be a critical process in the generation of circadian rhythms in cyanobacteria []. The circadian clock protein KaiC, is encoded in the kaiABC operon that controls circadian rhythms and may be universal in Cyanobacteria. Each member contains two copies of this domain, which is also found in other proteins. KaiC performs autophosphorylation and acts as its own transcriptional repressor. RadA/Sms is a highly conserved eubacterial protein that shares sequence similarity with both RecA strand transferase and lon protease. The RadA/Sms family are probable ATP-dependent proteases involved in both DNA repair and degradation of proteins, peptides, glycopeptides. They are classified in as non-peptidase homologues and unassigned peptidases in MEROPS peptidase family S16 (lon protease family, clan SJ). RadA/Sms is involved in recombination and recombinational repair, most likely involving the stabilisation or processing of branched DNA molecules or blocked replication forks because of its genetic redundancy with RecG and RuvABC [].; PDB: 2W0M_A 2ZTS_C 4DUG_B 3K0E_B 3K09_B 3S1A_E 3JZM_E 2GBL_B 3DVL_A 1TF7_C ....
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A*
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima}
