Psyllid ID: psy1775

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300----
MICDVTNFINYRLRKLAENCVPETWAFHPILKKGTLRENEGPRCTNCGASDHKSWLCPDKPNITNSTLCSSCGGAGHIARDCREKRPGMGGPPANTHRNRAKIDEEYMSLMAELGEGPPPDKRQRDNDSYRKNNTSGSLSPSPEPIYSSDGKRMNTREYRTRKKLEEERHDLIQKMFKVNPEFKPPPDYKPPVIKVNDKVMIPQDEHPDINFVGLLIGPRGNTLKSMEKDTGAKIIIRGKGSVKEGKVGRKDGQPLPGENEPLHAYVTAHNPENVKKAVDRLVCLVSARPRARFPPGADFILNG
cccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEEEcccccccccccccEEcccccHHHHHHHHHcccEEEEcccccccccccccccccccccccccEEEEEEccHHHHHHHHHHHHHHHcccccccccccccccccc
ccccHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccccccHcccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEcccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEEEEEccccccccEEEEEEcccccHHHHHHHHcccEEEEEEccccccccccccccccccccccccEEEEEEccHHHHHHHHHHHHHHHcccccccccccccEEEcc
MICDVTNFINYRLRKLaencvpetwafhpilkkgtlrenegprctncgasdhkswlcpdkpnitnstlcsscggaghiardcrekrpgmggppanthrnrAKIDEEYMSLMAElgegpppdkrqrdndsyrknntsgslspspepiyssdgkrmntreyRTRKKLEEERHDLIQKMFkvnpefkpppdykppvikvndkvmipqdehpdinfvglligprgntlksmekdTGAKIIirgkgsvkegkvgrkdgqplpgeneplhayvtahnpenVKKAVDRLVCLVsarprarfppgadfilng
MICDVTNFINYRLRKLAENCVPETWAFHPILKKGTLRENEGPRCTNCGASDHKSWLCPDKPNITNSTLCSSCGGAGHIARDCrekrpgmggppanthrnrAKIDEEYMSLMAElgegpppdkrqrdndsyrknntsgslspspepiyssdgkrmntreYRTRKKLEEERHDLIQKMfkvnpefkpppdyKPPVIKVNDKVMIPQDEHPDINFVGLLIGPRGNTLksmekdtgakiiirgkgsvkegkvgrkdgqplpgenEPLHAYVTAHNPENVKKAVDRLVCLVsarprarfppgadfilng
MICDVTNFINYRLRKLAENCVPETWAFHPILKKGTLRENEGPRCTNCGASDHKSWLCPDKPNITNSTLCSSCGGAGHIARDCREKRPGMGGPPANTHRNRAKIDEEYMSLMAELGEGPPPDKRQRDNDSYRKNNTSGSLSPSPEPIYSSDGKRMNTREYRTRKKLEEERHDLIQKMFKVNpefkpppdykppvikVNDKVMIPQDEHPDINFVGLLIGPRGNTLKSMEKDTGAKIIIRGKGSVKEGKVGRKDGQPLPGENEPLHAYVTAHNPENVKKAVDRLVCLVSARPRARFPPGADFILNG
*ICDVTNFINYRLRKLAENCVPETWAFHPILKKGTLRENEGPRCTNCGASDHKSWLCPDKPNITNSTLCSSCGGAGHIA*****************************************************************************************************************VIKVNDKVMIPQDEHPDINFVGLLIGPRGN***********KIII***************************AYVTAHNPENVKKAVDRLVCLVSAR***************
*I*****FINYRLRKLAENCVPETWAFHPILKKGTLRENEGPRCTNCGASD****************LCSSCGGAGHIARDCREKRPGMGGPPANTHRNRAKIDEEYMSLMAELGEG****KRQRDNDSYRKNNTSG**********************RTRKKLEEERHDLIQKM***************PVIKVNDKVMIPQDEHPDINFVGLLIGPRGNTLKSMEKDTGAKIII*************************LHAYVTAHNPENVKKAVDRLVCLVSARPRARFPPG*******
MICDVTNFINYRLRKLAENCVPETWAFHPILKKGTLRENEGPRCTNCGASDHKSWLCPDKPNITNSTLCSSCGGAGHIARDCREKRPGMGGPPANTHRNRAKIDEEYMSLMAELG******************************IYSSDGKRMNTREYRTRKKLEEERHDLIQKMFKVNPEFKPPPDYKPPVIKVNDKVMIPQDEHPDINFVGLLIGPRGNTLKSMEKDTGAKIIIRGKGSVKEGKVGRKDGQPLPGENEPLHAYVTAHNPENVKKAVDRLVCLVSARPRARFPPGADFILNG
MICDVTNFINYRLRKLAENCVPETWAFHPILKKGTLRENEGPRCTNCGASDHKSWLCPDKPNITNSTLCSSCGGAGHIARDCRE********************E***SL*AELGE*************************SPEPIYSSDGKRMNTREYRTRKKLEEERHDLIQKMFKVNPEFKPPPDYKPPVIKVNDKVMIPQDEHPDINFVGLLIGPRGNTLKSMEKDTGAKIIIRGKG******************NEPLHAYVTAHNPENVKKAVDRLVCLVSARPRARFPPGA******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MICDVTNFINYRLRKLAENCVPETWAFHPILKKGTLRENEGPRCTNCGASDHKSWLCPDKPNITNSTLCSSCGGAGHIARDCREKRPGMGGPPANTHRNRAKIDEEYMSLMAELGEGPPPDKRQRDNDSYRKNNTSGSLSPSPEPIYSSDGKRMNTREYRTRKKLEEERHDLIQKMFKVNPEFKPPPDYKPPVIKVNDKVMIPQDEHPDINFVGLLIGPRGNTLKSMEKDTGAKIIIRGKGSVKEGKVGRKDGQPLPGENEPLHAYVTAHNPENVKKAVDRLVCLVSARPRARFPPGADFILNG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query304 2.2.26 [Sep-21-2011]
Q15637 639 Splicing factor 1 OS=Homo yes N/A 0.430 0.205 0.769 3e-60
Q64213 653 Splicing factor 1 OS=Mus no N/A 0.430 0.200 0.769 2e-59
Q8NIW7 607 Branchpoint-bridging prot N/A N/A 0.460 0.230 0.570 6e-38
Q4WXV6 566 Branchpoint-bridging prot yes N/A 0.467 0.250 0.548 9e-37
Q750X2 507 Branchpoint-bridging prot yes N/A 0.496 0.297 0.486 6e-34
O74555 587 Branchpoint-bridging prot yes N/A 0.5 0.258 0.484 2e-32
Q54BM5 501 Branchpoint-bridging prot yes N/A 0.444 0.269 0.510 2e-32
P0CO44 546 Branchpoint-bridging prot yes N/A 0.463 0.258 0.541 7e-32
P0CO45 546 Branchpoint-bridging prot N/A N/A 0.463 0.258 0.541 7e-32
Q4P0H7 625 Branchpoint-bridging prot N/A N/A 0.440 0.214 0.520 4e-31
>sp|Q15637|SF01_HUMAN Splicing factor 1 OS=Homo sapiens GN=SF1 PE=1 SV=4 Back     alignment and function desciption
 Score =  232 bits (591), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 110/143 (76%), Positives = 131/143 (91%)

Query: 140 SPSPEPIYSSDGKRMNTREYRTRKKLEEERHDLIQKMFKVNPEFKPPPDYKPPVIKVNDK 199
           SPSPEPIY+S+GKR+NTRE+RTRKKLEEERH+LI +M  +NP+FKPP DYKPP  +V+DK
Sbjct: 80  SPSPEPIYNSEGKRLNTREFRTRKKLEEERHNLITEMVALNPDFKPPADYKPPATRVSDK 139

Query: 200 VMIPQDEHPDINFVGLLIGPRGNTLKSMEKDTGAKIIIRGKGSVKEGKVGRKDGQPLPGE 259
           VMIPQDE+P+INFVGLLIGPRGNTLK++EK+  AKI+IRGKGSVKEGKVGRKDGQ LPGE
Sbjct: 140 VMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGE 199

Query: 260 NEPLHAYVTAHNPENVKKAVDRL 282
           +EPLHA VTA+  ENVKKAV+++
Sbjct: 200 DEPLHALVTANTMENVKKAVEQI 222
Necessary for the ATP-dependent first step of spliceosome assembly. Binds to the intron branch point sequence (BPS) 5'-UACUAAC-3' of the pre-mRNA. May act as transcription repressor.
Homo sapiens (taxid: 9606)
>sp|Q64213|SF01_MOUSE Splicing factor 1 OS=Mus musculus GN=Sf1 PE=1 SV=6 Back     alignment and function description
>sp|Q8NIW7|BBP_NEUCR Branchpoint-bridging protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bpb-1 PE=3 SV=1 Back     alignment and function description
>sp|Q4WXV6|BBP_ASPFU Branchpoint-bridging protein OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bbp PE=3 SV=1 Back     alignment and function description
>sp|Q750X2|BBP_ASHGO Branchpoint-bridging protein OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BBP PE=3 SV=2 Back     alignment and function description
>sp|O74555|BBP_SCHPO Branchpoint-bridging protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bpb1 PE=1 SV=1 Back     alignment and function description
>sp|Q54BM5|BBP_DICDI Branchpoint-bridging protein OS=Dictyostelium discoideum GN=sf1 PE=3 SV=1 Back     alignment and function description
>sp|P0CO44|BBP_CRYNJ Branchpoint-bridging protein OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BBP PE=3 SV=1 Back     alignment and function description
>sp|P0CO45|BBP_CRYNB Branchpoint-bridging protein OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=BBP PE=3 SV=1 Back     alignment and function description
>sp|Q4P0H7|BBP_USTMA Branchpoint-bridging protein OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BBP PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query304
307168161 577 Splicing factor 1 [Camponotus floridanus 0.444 0.233 0.843 1e-67
383857277 616 PREDICTED: splicing factor 1-like [Megac 0.463 0.228 0.843 1e-67
66509531 615 PREDICTED: splicing factor 1-like [Apis 0.463 0.229 0.843 2e-67
340722352 615 PREDICTED: splicing factor 1-like [Bombu 0.463 0.229 0.843 2e-67
350424540 616 PREDICTED: splicing factor 1-like [Bombu 0.463 0.228 0.843 2e-67
312384676 734 hypothetical protein AND_01779 [Anophele 0.483 0.200 0.829 3e-67
307211904 617 Splicing factor 1 [Harpegnathos saltator 0.444 0.218 0.836 4e-67
332026981 528 Splicing factor 1 [Acromyrmex echinatior 0.444 0.255 0.843 5e-67
157104868 699 zinc finger protein [Aedes aegypti] gi|1 0.476 0.207 0.829 2e-66
170066965 692 zinc finger protein [Culex quinquefascia 0.453 0.199 0.829 3e-66
>gi|307168161|gb|EFN61440.1| Splicing factor 1 [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  262 bits (670), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 124/147 (84%), Positives = 142/147 (96%)

Query: 140 SPSPEPIYSSDGKRMNTREYRTRKKLEEERHDLIQKMFKVNPEFKPPPDYKPPVIKVNDK 199
           SPSPEPIYSSDGKR+NTREYRTR+KLEEERH+LIQK+ K+NPEFKPPPDYKPP+I+V+DK
Sbjct: 106 SPSPEPIYSSDGKRLNTREYRTRRKLEEERHNLIQKILKINPEFKPPPDYKPPIIRVHDK 165

Query: 200 VMIPQDEHPDINFVGLLIGPRGNTLKSMEKDTGAKIIIRGKGSVKEGKVGRKDGQPLPGE 259
           VMIPQ+EHPDINFVGLLIGPRGNTLKSMEK+TGAKIIIRGKGSVKEGKVGRKDGQPLPGE
Sbjct: 166 VMIPQEEHPDINFVGLLIGPRGNTLKSMEKETGAKIIIRGKGSVKEGKVGRKDGQPLPGE 225

Query: 260 NEPLHAYVTAHNPENVKKAVDRLVCLV 286
           +EPLHAY+TA+N + VKKAV+R+  ++
Sbjct: 226 DEPLHAYITANNLDAVKKAVERIHEII 252

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383857277|ref|XP_003704131.1| PREDICTED: splicing factor 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|66509531|ref|XP_394596.2| PREDICTED: splicing factor 1-like [Apis mellifera] gi|380025612|ref|XP_003696564.1| PREDICTED: splicing factor 1-like [Apis florea] Back     alignment and taxonomy information
>gi|340722352|ref|XP_003399571.1| PREDICTED: splicing factor 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350424540|ref|XP_003493829.1| PREDICTED: splicing factor 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|312384676|gb|EFR29347.1| hypothetical protein AND_01779 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|307211904|gb|EFN87831.1| Splicing factor 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332026981|gb|EGI67077.1| Splicing factor 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|157104868|ref|XP_001648609.1| zinc finger protein [Aedes aegypti] gi|108880257|gb|EAT44482.1| AAEL004167-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170066965|ref|XP_001868293.1| zinc finger protein [Culex quinquefasciatus] gi|167863154|gb|EDS26537.1| zinc finger protein [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query304
FB|FBgn0025571 787 SF1 "Splicing factor 1" [Droso 0.470 0.181 0.741 1.6e-55
UNIPROTKB|A2VDM7 639 SF1 "Uncharacterized protein" 0.470 0.223 0.699 2e-49
UNIPROTKB|E2RRT4 638 SF1 "Uncharacterized protein" 0.470 0.224 0.699 2e-49
UNIPROTKB|Q15637 639 SF1 "Splicing factor 1" [Homo 0.470 0.223 0.699 2e-49
UNIPROTKB|F1RQR0 639 SF1 "Uncharacterized protein" 0.470 0.223 0.699 2e-49
ZFIN|ZDB-GENE-030131-2492 663 sf1 "splicing factor 1" [Danio 0.470 0.215 0.706 2.5e-49
MGI|MGI:1095403 653 Sf1 "splicing factor 1" [Mus m 0.470 0.218 0.699 3.2e-49
UNIPROTKB|F1LM37 548 Sf1 "Protein Sf1" [Rattus norv 0.470 0.260 0.699 3.2e-49
UNIPROTKB|F1LSC3 653 Sf1 "Protein Sf1" [Rattus norv 0.470 0.218 0.699 3.2e-49
WB|WBGene00013808 699 sfa-1 [Caenorhabditis elegans 0.467 0.203 0.573 1.1e-42
FB|FBgn0025571 SF1 "Splicing factor 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 552 (199.4 bits), Expect = 1.6e-55, Sum P(2) = 1.6e-55
 Identities = 106/143 (74%), Positives = 121/143 (84%)

Query:   140 SPSPEPIYSSDGKRMNTREYRTRKKLEEERHDLIQKMFKVNXXXXXXXXXXXXXXXVNDK 199
             SPSPEPIYSSDGKR+NTRE+R RK+LEE+RH LI KM  VN               V+DK
Sbjct:   335 SPSPEPIYSSDGKRLNTREFRYRKRLEEQRHQLIVKMQTVNPEFKPPADYKPPVTRVSDK 394

Query:   200 VMIPQDEHPDINFVGLLIGPRGNTLKSMEKDTGAKIIIRGKGSVKEGKVGRKDGQPLPGE 259
             V+IPQ++HPDINFVGLLIGPRGNTLK+MEKDTGAKIIIRGKGSVKEGKVGRKDGQPLPGE
Sbjct:   395 VLIPQEQHPDINFVGLLIGPRGNTLKAMEKDTGAKIIIRGKGSVKEGKVGRKDGQPLPGE 454

Query:   260 NEPLHAYVTAHNPENVKKAVDRL 282
             +EPLHA++TA NPE V+KAVD++
Sbjct:   455 DEPLHAFITAPNPEAVRKAVDKI 477
GO:0005634 "nucleus" evidence=IDA
GO:0005681 "spliceosomal complex" evidence=ISS;NAS
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC;ISS;NAS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0003723 "RNA binding" evidence=IEA
GO:0071011 "precatalytic spliceosome" evidence=IDA
GO:0002121 "inter-male aggressive behavior" evidence=IMP
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|A2VDM7 SF1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RRT4 SF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q15637 SF1 "Splicing factor 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RQR0 SF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-2492 sf1 "splicing factor 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1095403 Sf1 "splicing factor 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1LM37 Sf1 "Protein Sf1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LSC3 Sf1 "Protein Sf1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
WB|WBGene00013808 sfa-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q15637SF01_HUMANNo assigned EC number0.76920.43090.2050yesN/A
P0CO44BBP_CRYNJNo assigned EC number0.54160.46380.2582yesN/A
Q4WXV6BBP_ASPFUNo assigned EC number0.54860.46710.2508yesN/A
Q54BM5BBP_DICDINo assigned EC number0.51070.44400.2694yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query304
COG5176269 COG5176, MSL5, Splicing factor (branch point bindi 3e-39
cd02395120 cd02395, SF1_like-KH, Splicing factor 1 (SF1) K ho 2e-35
cd0010564 cd00105, KH-I, K homology RNA-binding domain, type 4e-08
PTZ00368148 PTZ00368, PTZ00368, universal minicircle sequence 5e-07
smart0032268 smart00322, KH, K homology RNA-binding domain 8e-07
pfam0001359 pfam00013, KH_1, KH domain 3e-05
PTZ00368148 PTZ00368, PTZ00368, universal minicircle sequence 4e-05
pfam1301442 pfam13014, KH_3, KH domain 5e-05
COG5082190 COG5082, AIR1, Arginine methyltransferase-interact 3e-04
PRK11824693 PRK11824, PRK11824, polynucleotide phosphorylase/p 3e-04
PTZ00368148 PTZ00368, PTZ00368, universal minicircle sequence 5e-04
PTZ00368148 PTZ00368, PTZ00368, universal minicircle sequence 7e-04
TIGR02696719 TIGR02696, pppGpp_PNP, guanosine pentaphosphate sy 0.002
cd0239361 cd02393, PNPase_KH, Polynucleotide phosphorylase ( 0.002
>gnl|CDD|227503 COG5176, MSL5, Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information 
 Score =  138 bits (348), Expect = 3e-39
 Identities = 73/185 (39%), Positives = 95/185 (51%), Gaps = 19/185 (10%)

Query: 114 LGEGPPPDKRQRDNDSYRKNNTSGSLSPSPEPIYSSDGKRMNTREYRTRKKLEEERHDLI 173
             +G P  +  R              SPSP P Y   G+R+NTRE R  KKLE+ER  L 
Sbjct: 81  TPDGVPSKRELR--------------SPSPPPRYDEIGRRLNTREARYNKKLEDERLWLK 126

Query: 174 QKMFKVNPEFKPPPDYKPPVIKVNDKVMIPQDEHPDINFVGLLIGPRGNTLKSMEKDTGA 233
           ++  K+ P F  P DY  P  K  +K+ IP  E+P+ NFVGLLIGPRG+TLK +E+ + A
Sbjct: 127 ERAQKILPRFVLPNDYIRPS-KYQNKIYIPVQEYPESNFVGLLIGPRGSTLKQLERISRA 185

Query: 234 KIIIRGKGSVKEGKVGRKDGQPLPGE-NEPLHAYVTAHNPENVKKAVDRLVCLVSARPRA 292
           KI IRG GSVKEGK    D           LH  + A + + + +       L + R   
Sbjct: 186 KIAIRGSGSVKEGK-ISSDTPESLKNAEAVLHCLIEADSEDKICRL--IKSQLNAIREAR 242

Query: 293 RFPPG 297
           R P G
Sbjct: 243 RNPEG 247

Length = 269
>gnl|CDD|239088 cd02395, SF1_like-KH, Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>gnl|CDD|238053 cd00105, KH-I, K homology RNA-binding domain, type I Back     alignment and domain information
>gnl|CDD|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>gnl|CDD|197652 smart00322, KH, K homology RNA-binding domain Back     alignment and domain information
>gnl|CDD|215657 pfam00013, KH_1, KH domain Back     alignment and domain information
>gnl|CDD|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>gnl|CDD|221895 pfam13014, KH_3, KH domain Back     alignment and domain information
>gnl|CDD|227414 COG5082, AIR1, Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|236995 PRK11824, PRK11824, polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>gnl|CDD|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>gnl|CDD|173561 PTZ00368, PTZ00368, universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>gnl|CDD|131743 TIGR02696, pppGpp_PNP, guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>gnl|CDD|239086 cd02393, PNPase_KH, Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 304
KOG0119|consensus 554 100.0
COG5176269 MSL5 Splicing factor (branch point binding protein 100.0
KOG1588|consensus259 99.97
cd02395120 SF1_like-KH Splicing factor 1 (SF1) K homology RNA 99.96
TIGR02696719 pppGpp_PNP guanosine pentaphosphate synthetase I/p 99.56
COG1185692 Pnp Polyribonucleotide nucleotidyltransferase (pol 99.52
PLN00207 891 polyribonucleotide nucleotidyltransferase; Provisi 99.47
TIGR03591684 polynuc_phos polyribonucleotide nucleotidyltransfe 99.46
KOG0119|consensus554 99.4
cd0239361 PNPase_KH Polynucleotide phosphorylase (PNPase) K 99.32
PRK11824693 polynucleotide phosphorylase/polyadenylase; Provis 99.29
PF0001360 KH_1: KH domain syndrome, contains KH motifs.; Int 98.88
KOG1067|consensus760 98.86
PRK13763180 putative RNA-processing protein; Provisional 98.83
cd0010564 KH-I K homology RNA-binding domain, type I. KH bin 98.83
cd0239462 vigilin_like_KH K homology RNA-binding domain_vigi 98.81
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 98.75
COG5082190 AIR1 Arginine methyltransferase-interacting protei 98.71
smart0032269 KH K homology RNA-binding domain. 98.65
cd0239665 PCBP_like_KH K homology RNA-binding domain, PCBP_l 98.62
PTZ00368148 universal minicircle sequence binding protein (UMS 98.49
PTZ00368148 universal minicircle sequence binding protein (UMS 98.37
TIGR03665172 arCOG04150 arCOG04150 universal archaeal KH domain 98.28
PF1301443 KH_3: KH domain 98.26
KOG1960|consensus 531 98.17
PF0009818 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi 98.15
PRK13763180 putative RNA-processing protein; Provisional 98.11
COG5082190 AIR1 Arginine methyltransferase-interacting protei 98.03
PF0009818 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc fi 98.02
KOG4400|consensus261 98.01
PRK04163235 exosome complex RNA-binding protein Rrp4; Provisio 97.97
KOG1676|consensus 600 97.91
KOG1676|consensus 600 97.74
COG1094194 Predicted RNA-binding protein (contains KH domains 97.69
KOG4400|consensus261 97.31
KOG2191|consensus 402 97.31
PF1369632 zf-CCHC_2: Zinc knuckle 97.05
KOG2190|consensus 485 96.87
KOG2193|consensus 584 96.7
PRK00106 535 hypothetical protein; Provisional 96.7
TIGR03319 514 YmdA_YtgF conserved hypothetical protein YmdA/YtgF 96.64
PRK12704 520 phosphodiesterase; Provisional 96.56
PF1369632 zf-CCHC_2: Zinc knuckle 96.09
KOG2193|consensus 584 95.95
KOG2191|consensus 402 95.86
COG1094 194 Predicted RNA-binding protein (contains KH domains 95.81
KOG2814|consensus 345 95.8
PF1391742 zf-CCHC_3: Zinc knuckle 95.7
PF1391742 zf-CCHC_3: Zinc knuckle 95.37
smart0034326 ZnF_C2HC zinc finger. 95.1
KOG1960|consensus 531 94.92
PRK12705 508 hypothetical protein; Provisional 94.82
cd0213461 NusA_KH NusA_K homology RNA-binding domain (KH). N 94.76
smart0034326 ZnF_C2HC zinc finger. 94.65
PF1478736 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 94.58
KOG0109|consensus346 94.11
PF1528840 zf-CCHC_6: Zinc knuckle 93.77
KOG0336|consensus 629 92.57
KOG2190|consensus 485 92.31
KOG2874|consensus 356 91.4
COG1097239 RRP4 RNA-binding protein Rrp4 and related proteins 91.29
PF1528840 zf-CCHC_6: Zinc knuckle 90.48
KOG2192|consensus390 89.87
COG1855604 ATPase (PilT family) [General function prediction 89.68
PF1439249 zf-CCHC_4: Zinc knuckle 89.62
PF1318469 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW 88.85
KOG2192|consensus 390 88.48
PF1439249 zf-CCHC_4: Zinc knuckle 88.28
COG5222427 Uncharacterized conserved protein, contains RING Z 87.11
KOG0109|consensus346 84.84
PRK08406140 transcription elongation factor NusA-like protein; 83.97
COG5222427 Uncharacterized conserved protein, contains RING Z 82.97
PF1478736 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 82.51
KOG0314|consensus448 81.89
cd0240968 KH-II KH-II (K homology RNA-binding domain, type I 80.97
>KOG0119|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.1e-51  Score=399.90  Aligned_cols=188  Identities=52%  Similarity=0.855  Sum_probs=171.8

Q ss_pred             hhHHHHHHHHHhCCCCCCCCcccCCCCCCCCCCCCCCCCCCCCCCCccCCccchHHHHHHHHHHHHHHHHHHHHHHhCCC
Q psy1775         103 IDEEYMSLMAELGEGPPPDKRQRDNDSYRKNNTSGSLSPSPEPIYSSDGKRMNTREYRTRKKLEEERHDLIQKMFKVNPE  182 (304)
Q Consensus       103 ~d~EY~~lmaEL~~~~~e~tr~L~tG~~~~~~~~~~rsPsp~p~yd~~gkr~ntr~~r~~~~Le~er~~~i~~l~~~~p~  182 (304)
                      .+.+.+.++-++    ++++|+|+++|++.+.+.++|||||+|+||+.|+|+||||+|++++||+||+++|++++++||.
T Consensus        50 eq~~~y~l~~~i----ee~t~kLrt~d~~~p~~~e~rSPsp~p~yda~g~R~ntRe~R~r~~Le~er~e~I~~~lk~nP~  125 (554)
T KOG0119|consen   50 EQKESYSLNLRI----EEITRKLRTGDVGVPPPRELRSPSPEPVYDAKGKRLNTREQRARKKLEDERHEIIEEILKLNPG  125 (554)
T ss_pred             hhhhhhhHHHHH----HHhhhhhccccCCCCCCccccCCCcchhhhhhccchhhHHHHHHHHHHHHHHHHHHHHHHhCcC
Confidence            344455555555    4589999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCcceeEEEEeCCCCCCCCcccceeecCCchhHHHHHHHhCCeEEEeCCccccCCCCCCCC-CCCCCCCCC
Q psy1775         183 FKPPPDYKPPVIKVNDKVMIPQDEHPDINFVGLLIGPRGNTLKSMEKDTGAKIIIRGKGSVKEGKVGRKD-GQPLPGENE  261 (304)
Q Consensus       183 ~~~P~~~~~~~~~~~~ki~IP~~~~P~~NfiG~iiGP~G~t~K~ie~etg~kI~IrG~Gs~~~~~~~~~~-g~~~~~~~e  261 (304)
                      |++|.||+++. +++.||||||++||+||||||||||||+|+|+||+||||||.|||||||||+| .+.+ .......+|
T Consensus       126 fkpP~DYk~p~-~~~~Kv~IPvke~Pd~NFvGLiiGPRG~TqK~lE~etgAKI~IRGkgSvkEgk-~~~~d~~~~~~~~e  203 (554)
T KOG0119|consen  126 FKPPADYKPPA-KLHDKVYIPVKEFPDINFVGLIIGPRGNTQKRLERETGAKIAIRGKGSVKEGK-GRSDDLSYIPKENE  203 (554)
T ss_pred             CCCCcccCccc-ccccceecchhhcCCcceeEEEecCCccHHHHHHHHhCCeEEEeccccccccc-cCCccccccccccc
Confidence            99999999995 89999999999999999999999999999999999999999999999999999 5544 556788999


Q ss_pred             CcEEEEEeCCHHHHHHHHHHHHhhhcCCCCCCCCCCc
Q psy1775         262 PLHAYVTAHNPENVKKAVDRLVCLVSARPRARFPPGA  298 (304)
Q Consensus       262 ~LHv~I~a~~~~~v~~A~~~I~~ll~~~~~~~~~~g~  298 (304)
                      ||||+|+|+|+|+|++|++.|++||.+.  .+++|||
T Consensus       204 pLH~~Isadt~eki~~Ai~vienli~~a--v~~~e~~  238 (554)
T KOG0119|consen  204 PLHCLISADTQEKIKKAIAVIENLIQSA--VSVPEGQ  238 (554)
T ss_pred             ceeEEEecchHHHHHHHHHHHHHHHHhh--ccCcccc
Confidence            9999999999999999999999999985  3467774

>COG5176 MSL5 Splicing factor (branch point binding protein) [RNA processing and modification] Back     alignment and domain information
>KOG1588|consensus Back     alignment and domain information
>cd02395 SF1_like-KH Splicing factor 1 (SF1) K homology RNA-binding domain (KH) Back     alignment and domain information
>TIGR02696 pppGpp_PNP guanosine pentaphosphate synthetase I/polynucleotide phosphorylase Back     alignment and domain information
>COG1185 Pnp Polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN00207 polyribonucleotide nucleotidyltransferase; Provisional Back     alignment and domain information
>TIGR03591 polynuc_phos polyribonucleotide nucleotidyltransferase Back     alignment and domain information
>KOG0119|consensus Back     alignment and domain information
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH) Back     alignment and domain information
>PRK11824 polynucleotide phosphorylase/polyadenylase; Provisional Back     alignment and domain information
>PF00013 KH_1: KH domain syndrome, contains KH motifs Back     alignment and domain information
>KOG1067|consensus Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>cd00105 KH-I K homology RNA-binding domain, type I Back     alignment and domain information
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>smart00322 KH K homology RNA-binding domain Back     alignment and domain information
>cd02396 PCBP_like_KH K homology RNA-binding domain, PCBP_like Back     alignment and domain information
>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>PTZ00368 universal minicircle sequence binding protein (UMSBP); Provisional Back     alignment and domain information
>TIGR03665 arCOG04150 arCOG04150 universal archaeal KH domain protein Back     alignment and domain information
>PF13014 KH_3: KH domain Back     alignment and domain information
>KOG1960|consensus Back     alignment and domain information
>PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK13763 putative RNA-processing protein; Provisional Back     alignment and domain information
>COG5082 AIR1 Arginine methyltransferase-interacting protein, contains RING Zn-finger [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>PF00098 zf-CCHC: Zinc knuckle; InterPro: IPR001878 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4400|consensus Back     alignment and domain information
>PRK04163 exosome complex RNA-binding protein Rrp4; Provisional Back     alignment and domain information
>KOG1676|consensus Back     alignment and domain information
>KOG1676|consensus Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>KOG4400|consensus Back     alignment and domain information
>KOG2191|consensus Back     alignment and domain information
>PF13696 zf-CCHC_2: Zinc knuckle Back     alignment and domain information
>KOG2190|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>PRK00106 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03319 YmdA_YtgF conserved hypothetical protein YmdA/YtgF Back     alignment and domain information
>PRK12704 phosphodiesterase; Provisional Back     alignment and domain information
>PF13696 zf-CCHC_2: Zinc knuckle Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG2191|consensus Back     alignment and domain information
>COG1094 Predicted RNA-binding protein (contains KH domains) [General function prediction only] Back     alignment and domain information
>KOG2814|consensus Back     alignment and domain information
>PF13917 zf-CCHC_3: Zinc knuckle Back     alignment and domain information
>PF13917 zf-CCHC_3: Zinc knuckle Back     alignment and domain information
>smart00343 ZnF_C2HC zinc finger Back     alignment and domain information
>KOG1960|consensus Back     alignment and domain information
>PRK12705 hypothetical protein; Provisional Back     alignment and domain information
>cd02134 NusA_KH NusA_K homology RNA-binding domain (KH) Back     alignment and domain information
>smart00343 ZnF_C2HC zinc finger Back     alignment and domain information
>PF14787 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>PF15288 zf-CCHC_6: Zinc knuckle Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG2190|consensus Back     alignment and domain information
>KOG2874|consensus Back     alignment and domain information
>COG1097 RRP4 RNA-binding protein Rrp4 and related proteins (contain S1 domain and KH domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF15288 zf-CCHC_6: Zinc knuckle Back     alignment and domain information
>KOG2192|consensus Back     alignment and domain information
>COG1855 ATPase (PilT family) [General function prediction only] Back     alignment and domain information
>PF14392 zf-CCHC_4: Zinc knuckle Back     alignment and domain information
>PF13184 KH_5: NusA-like KH domain; PDB: 1HH2_P 1L2F_A 2ATW_A 1K0R_B 2ASB_A Back     alignment and domain information
>KOG2192|consensus Back     alignment and domain information
>PF14392 zf-CCHC_4: Zinc knuckle Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>PRK08406 transcription elongation factor NusA-like protein; Validated Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF14787 zf-CCHC_5: GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A Back     alignment and domain information
>KOG0314|consensus Back     alignment and domain information
>cd02409 KH-II KH-II (K homology RNA-binding domain, type II) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query304
1k1g_A131 Structural Basis For Recognition Of The Intron Bran 1e-34
2m09_A121 Structure, Phosphorylation And U2af65 Binding Of Th 5e-16
2m0g_A145 Structure, Phosphorylation And U2af65 Binding Of Th 2e-15
2bl5_A140 Solution Structure Of The Kh-Qua2 Region Of The Xen 1e-12
4fxx_A112 Structure Of Sf1 Coiled-coil Domain Length = 112 2e-12
4fxw_B124 Structure Of Phosphorylated Sf1 Complex With U2af65 8e-08
>pdb|1K1G|A Chain A, Structural Basis For Recognition Of The Intron Branch Site Rna By Splicing Factor 1 Length = 131 Back     alignment and structure 
Iteration: 1

 Score =  143 bits (361), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 69/87 (79%), Positives = 81/87 (93%)
Query: 196 VNDKVMIPQDEHPDINFVGLLIGPRGNTLKSMEKDTGAKIIIRGKGSVKEGKVGRKDGQP 255
           V+DKVMIPQDE+P+INFVGLLIGPRGNTLK++EK+  AKI+IRGKGSVKEGKVGRKDGQ 
Sbjct: 7   VSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQM 66
Query: 256 LPGENEPLHAYVTAHNPENVKKAVDRL 282
           LPGE+EPLHA VTA+  ENVKKAV+++
Sbjct: 67  LPGEDEPLHALVTANTMENVKKAVEQI 93
>pdb|2M09|A Chain A, Structure, Phosphorylation And U2af65 Binding Of The Nterminal Domain Of Splicing Factor 1 During 3 Splice Site Recognition Length = 121 Back     alignment and structure
>pdb|2M0G|A Chain A, Structure, Phosphorylation And U2af65 Binding Of The Nterminal Domain Of Splicing Factor 1 During 3 Splice Site Recognition Length = 145 Back     alignment and structure
>pdb|2BL5|A Chain A, Solution Structure Of The Kh-Qua2 Region Of The Xenopus Star-Gsg Quaking Protein Length = 140 Back     alignment and structure
>pdb|4FXX|A Chain A, Structure Of Sf1 Coiled-coil Domain Length = 112 Back     alignment and structure
>pdb|4FXW|B Chain B, Structure Of Phosphorylated Sf1 Complex With U2af65-uhm Domain Length = 124 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query304
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 2e-36
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 2e-27
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 1e-21
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 8e-08
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 4e-07
2ihx_A61 Nucleocapsid (NC) protein; protein-RNA complex, vi 5e-07
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 1e-06
1x4m_A94 FAR upstream element binding protein 1; KH domain, 2e-06
1cl4_A60 Protein (GAG polyprotein); nucleocapsid protein, R 2e-06
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 2e-06
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 3e-06
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 8e-06
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 4e-06
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 8e-04
3nyb_B83 Protein AIR2; polya RNA polymerase, zinc knuckle p 5e-06
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 5e-06
2lli_A124 Protein AIR2; RNA surveillance, RNA degradation, R 9e-06
2lli_A124 Protein AIR2; RNA surveillance, RNA degradation, R 4e-04
2li8_A74 Protein LIN-28 homolog A; zinc finger, micro RNA, 1e-05
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 1e-05
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 2e-05
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 2e-05
2cqf_A63 RNA-binding protein LIN-28; CCHC zinc-finger, stru 2e-05
1x4n_A92 FAR upstream element binding protein 1; KH domain, 2e-05
1j4w_A174 FUSE binding protein; single-stranded DNA binding 3e-05
1j4w_A174 FUSE binding protein; single-stranded DNA binding 9e-04
2dgr_A83 Ring finger and KH domain-containing protein 1; st 1e-04
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 1e-04
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 2e-04
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 2e-04
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 3e-04
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 3e-04
3ts2_A148 Protein LIN-28 homolog A; microrna biogenesis, pro 4e-04
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 5e-04
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 7e-04
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 7e-04
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 7e-04
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 131 Back     alignment and structure
 Score =  126 bits (317), Expect = 2e-36
 Identities = 70/111 (63%), Positives = 88/111 (79%), Gaps = 2/111 (1%)

Query: 191 PPVIKVNDKVMIPQDEHPDINFVGLLIGPRGNTLKSMEKDTGAKIIIRGKGSVKEGKVGR 250
               +V+DKVMIPQDE+P+INFVGLLIGPRGNTLK++EK+  AKI+IRGKGSVKEGKVGR
Sbjct: 2   AMATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGR 61

Query: 251 KDGQPLPGENEPLHAYVTAHNPENVKKAVDRLVCLVSARPRARFPPGADFI 301
           KDGQ LPGE+EPLHA VTA+  ENVKKAV+++  ++  +     P   + +
Sbjct: 62  KDGQMLPGEDEPLHALVTANTMENVKKAVEQIRNIL--KQGIETPEDQNDL 110
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Length = 140 Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Length = 160 Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Length = 61 Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Length = 178 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Length = 94 Back     alignment and structure
>1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A Length = 60 Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Length = 76 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Length = 164 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Length = 163 Back     alignment and structure
>3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Length = 87 Back     alignment and structure
>2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} Length = 124 Back     alignment and structure
>2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} Length = 124 Back     alignment and structure
>2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Length = 82 Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 95 Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Length = 92 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Length = 174 Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Length = 82 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Length = 104 Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Length = 76 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Length = 89 Back     alignment and structure
>3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Length = 148 Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Length = 630 Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Length = 219 Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Length = 73 Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Length = 71 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query304
1k1g_A131 SF1-BO isoform; splicing, branch point sequence, p 99.97
2bl5_A140 MGC83862 protein, quaking protein; STAR proteins, 99.97
2yqr_A119 KIAA0907 protein; structure genomics, KH domain, s 99.93
4fxw_B124 Splicing factor 1; UHM, protein binding, phosphory 99.86
4aid_A726 Polyribonucleotide nucleotidyltransferase; transfe 99.46
3u1k_A630 Polyribonucleotide nucleotidyltransferase 1, MITO; 99.41
2opv_A85 KHSRP protein; KH domain, RNA binding protein, KSR 99.38
2ihx_A61 Nucleocapsid (NC) protein; protein-RNA complex, vi 99.35
2ec7_A49 GAG polyprotein (PR55GAG); nucleocapsid protein, H 99.33
2a51_A39 Nucleocapsid protein; sivlhoest, structure, NCP8, 99.29
1cl4_A60 Protein (GAG polyprotein); nucleocapsid protein, R 99.28
2li8_A74 Protein LIN-28 homolog A; zinc finger, micro RNA, 99.28
2bl6_A37 Nucleocapsid protein P11; lentivirus, polyprotein, 99.25
1a1t_A55 Nucleocapsid protein; stem-loop RNA, viral protein 99.25
1we8_A104 Tudor and KH domain containing protein; structural 99.25
1x4m_A94 FAR upstream element binding protein 1; KH domain, 99.24
2ctk_A104 Vigilin; K homology type I domain, RNA-binding, ce 99.23
2cqf_A63 RNA-binding protein LIN-28; CCHC zinc-finger, stru 99.23
1dtj_A76 RNA-binding neurooncological ventral antigen 2; KH 99.21
1x4n_A92 FAR upstream element binding protein 1; KH domain, 99.21
1vig_A71 Vigilin; RNA-binding protein, ribonucleoprotein; N 99.19
2axy_A73 Poly(RC)-binding protein 2; protein-DNA complex, D 99.16
2hh3_A106 KH-type splicing regulatory protein; KH-RNA bindin 99.15
1wvn_A82 Poly(RC)-binding protein 1; KH domain, RNA binding 99.14
1zzk_A82 Heterogeneous nuclear ribonucleoprotein K; KH domi 99.14
2cte_A94 Vigilin; K homology type I domain, RNA-binding, ce 99.14
3cdi_A723 Polynucleotide phosphorylase; mRNA turnover, RNAse 99.14
3ts2_A148 Protein LIN-28 homolog A; microrna biogenesis, pro 99.13
2p2r_A76 Poly(RC)-binding protein 2; protein-DNA complex, R 99.12
3nyb_B83 Protein AIR2; polya RNA polymerase, zinc knuckle p 99.12
2cpq_A91 FragIle X mental retardation syndrome related prot 99.11
2hh2_A107 KH-type splicing regulatory protein; KH-RNA bindin 99.11
2ctm_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.1
2ctl_A97 Vigilin; K homology type I domain, RNA-binding, ce 99.08
1ec6_A87 RNA-binding protein NOVA-2; KH domain, alpha-beta 99.08
1e3p_A757 Guanosine pentaphosphate synthetase; polyribonucle 99.03
2ctj_A95 Vigilin; K homology type I domain, RNA-binding, ce 99.03
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 99.02
1j5k_A89 Heterogeneous nuclear ribonucleoprotein K; single- 99.01
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 98.96
2dgr_A83 Ring finger and KH domain-containing protein 1; st 98.95
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 98.92
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 98.91
2jvz_A164 KH type-splicing, FAR upstream element-binding pro 98.81
1j4w_A174 FUSE binding protein; single-stranded DNA binding 98.79
2lli_A124 Protein AIR2; RNA surveillance, RNA degradation, R 98.79
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 98.76
2lli_A124 Protein AIR2; RNA surveillance, RNA degradation, R 98.61
2jzx_A160 Poly(RC)-binding protein 2; PCBP2, KH domains, RNA 98.59
1j4w_A174 FUSE binding protein; single-stranded DNA binding 98.58
3krm_A163 Insulin-like growth factor 2 mRNA-binding protein 98.55
2anr_A178 Neuro-oncological ventral antigen 1; protein-RNA c 98.55
2li8_A74 Protein LIN-28 homolog A; zinc finger, micro RNA, 98.22
1a6b_B40 Momulv, zinc finger protein NCP10; nucleocapsid pr 98.13
1dsq_A26 Nucleic acid binding protein P14; CCHC type zinc f 98.1
1u6p_A56 GAG polyprotein; MLV, A-minor K-turn, stem loop, b 98.03
2ctf_A102 Vigilin; K homology type I domain, RNA-binding, ce 97.9
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 97.86
2e3u_A219 PH-DIM2P, hypothetical protein PH1566; PRE-ribosom 97.84
1dsq_A26 Nucleic acid binding protein P14; CCHC type zinc f 97.8
1nc8_A29 Nucleocapsid protein; HIV-2, RNA recognition, zinc 97.79
1tua_A191 Hypothetical protein APE0754; structural genomics, 97.71
1nc8_A29 Nucleocapsid protein; HIV-2, RNA recognition, zinc 97.68
1a6b_B40 Momulv, zinc finger protein NCP10; nucleocapsid pr 97.56
2ysa_A55 Retinoblastoma-binding protein 6; zinc finger, CCH 97.42
2qnd_A144 FMR1 protein; KH domain, eukaryotic KH domains, ta 97.38
1u6p_A56 GAG polyprotein; MLV, A-minor K-turn, stem loop, b 97.32
1tua_A 191 Hypothetical protein APE0754; structural genomics, 97.25
3n89_A 376 Defective in GERM LINE development protein 3, ISO; 97.25
2a51_A39 Nucleocapsid protein; sivlhoest, structure, NCP8, 97.11
3n89_A376 Defective in GERM LINE development protein 3, ISO; 96.99
2bl6_A37 Nucleocapsid protein P11; lentivirus, polyprotein, 96.86
2ec7_A49 GAG polyprotein (PR55GAG); nucleocapsid protein, H 96.83
2ysa_A55 Retinoblastoma-binding protein 6; zinc finger, CCH 96.73
3v69_A140 Protein filia; RNA-binding, embryogenesis, KH doma 96.65
2ihx_A61 Nucleocapsid (NC) protein; protein-RNA complex, vi 96.61
2cqf_A63 RNA-binding protein LIN-28; CCHC zinc-finger, stru 96.56
1a1t_A55 Nucleocapsid protein; stem-loop RNA, viral protein 96.52
3nyb_B83 Protein AIR2; polya RNA polymerase, zinc knuckle p 96.5
1cl4_A60 Protein (GAG polyprotein); nucleocapsid protein, R 96.19
3ts2_A148 Protein LIN-28 homolog A; microrna biogenesis, pro 95.3
1y14_B171 B16, RPB7, DNA-directed RNA polymerase II 19 kDa p 94.57
1go3_E187 DNA-directed RNA polymerase subunit E; transferase 88.22
2hqh_E26 Restin; beta/BETA structure, zinc finger motif, st 82.49
2z0s_A235 Probable exosome complex RNA-binding protein 1; al 81.96
2cxc_A144 NUSA; transcription termination, RNA binding prote 80.92
>1k1g_A SF1-BO isoform; splicing, branch point sequence, protein/RNA recognition, complex E, KH domain, QUA2 homology; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
Probab=99.97  E-value=1.9e-31  Score=222.89  Aligned_cols=107  Identities=65%  Similarity=0.991  Sum_probs=99.2

Q ss_pred             CcceeEEEEeCCCCCCCCcccceeecCCchhHHHHHHHhCCeEEEeCCccccCCCCCCCCCCCCCCCCCCcEEEEEeCCH
Q psy1775         193 VIKVNDKVMIPQDEHPDINFVGLLIGPRGNTLKSMEKDTGAKIIIRGKGSVKEGKVGRKDGQPLPGENEPLHAYVTAHNP  272 (304)
Q Consensus       193 ~~~~~~ki~IP~~~~P~~NfiG~iiGP~G~t~K~ie~etg~kI~IrG~Gs~~~~~~~~~~g~~~~~~~e~LHv~I~a~~~  272 (304)
                      ..++++|||||+++||+|||||+||||+|+|+|+||++|||+|.|||+||+++++.++.+|.++++++|||||+|+|+++
T Consensus         4 ~~k~~~kv~IP~~~~P~~n~iG~IIGP~G~tiK~Iq~eTG~kI~IrgkgS~~~~~~~~~~~~~~~~~~e~lhV~I~a~~~   83 (131)
T 1k1g_A            4 ATRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTM   83 (131)
T ss_dssp             -CCEEEEEECCTTTCCSHHHHHHHHCSSSHHHHHHHHHSCCEEEEEESTTSSSSSSSSCCCCCSCCSSCCEEEEEEESSH
T ss_pred             CceEEEEEEECCccccCcceeeeEECCCcHHHHHHHHHHCCeEEecCCcccccccccccccccccccCCCeEEEEEECCH
Confidence            35889999999999999999999999999999999999999999999999999988888888899999999999999999


Q ss_pred             HHHHHHHHHHHhhhcCCCCCCCCCCcccc
Q psy1775         273 ENVKKAVDRLVCLVSARPRARFPPGADFI  301 (304)
Q Consensus       273 ~~v~~A~~~I~~ll~~~~~~~~~~g~~~~  301 (304)
                      +++++|+++|+.||.+..  .+|+++|.+
T Consensus        84 e~~~~A~~~I~~ll~~~~--~~p~~~d~~  110 (131)
T 1k1g_A           84 ENVKKAVEQIRNILKQGI--ETPEDQNDL  110 (131)
T ss_dssp             HHHHHHHHHHHHHHTTTT--SCCTTSSGG
T ss_pred             HHHHHHHHHHHHHHhccC--CCCccHHHH
Confidence            999999999999998742  358888864
>2bl5_A MGC83862 protein, quaking protein; STAR proteins, GSG proteins, RNA binding; NMR {Xenopus laevis} SCOP: d.51.1.1 Back     alignment and structure
>2yqr_A KIAA0907 protein; structure genomics, KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4fxw_B Splicing factor 1; UHM, protein binding, phosphorylat; HET: SEP; 2.29A {Homo sapiens} PDB: 4fxx_A Back     alignment and structure
>4aid_A Polyribonucleotide nucleotidyltransferase; transferase-peptide complex; 2.60A {Caulobacter vibrioides} PDB: 4aim_A 4am3_A Back     alignment and structure
>3u1k_A Polyribonucleotide nucleotidyltransferase 1, MITO; RNAse PH, KH domain, exoribonuclease; HET: CIT; 2.13A {Homo sapiens} Back     alignment and structure
>2opv_A KHSRP protein; KH domain, RNA binding protein, KSRP; NMR {Homo sapiens} Back     alignment and structure
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Back     alignment and structure
>2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 Back     alignment and structure
>2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} Back     alignment and structure
>1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A Back     alignment and structure
>2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Back     alignment and structure
>1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A Back     alignment and structure
>1we8_A Tudor and KH domain containing protein; structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>1x4m_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 Back     alignment and structure
>2ctk_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1dtj_A RNA-binding neurooncological ventral antigen 2; KH domain, alpha-beta fold RNA-binding motif, immune system; 2.00A {Homo sapiens} SCOP: d.51.1.1 PDB: 1dt4_A Back     alignment and structure
>1x4n_A FAR upstream element binding protein 1; KH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.51.1.1 PDB: 2opu_A Back     alignment and structure
>1vig_A Vigilin; RNA-binding protein, ribonucleoprotein; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1vih_A Back     alignment and structure
>2axy_A Poly(RC)-binding protein 2; protein-DNA complex, DNA binding protein-DNA complex; 1.70A {Homo sapiens} SCOP: d.51.1.1 PDB: 2pqu_A 2py9_A 1ztg_A 3vke_A* Back     alignment and structure
>2hh3_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1wvn_A Poly(RC)-binding protein 1; KH domain, RNA binding domain, RNA binding protein; 2.10A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1zzk_A Heterogeneous nuclear ribonucleoprotein K; KH domian, alpha-beta fold, DNA binding protein; 0.95A {Homo sapiens} SCOP: d.51.1.1 PDB: 1zzj_A 1zzi_A Back     alignment and structure
>2cte_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3cdi_A Polynucleotide phosphorylase; mRNA turnover, RNAse, RNA degradation, kinase, transferase; 2.60A {Escherichia coli} PDB: 1sro_A Back     alignment and structure
>3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Back     alignment and structure
>2p2r_A Poly(RC)-binding protein 2; protein-DNA complex, RNA and DNA binding protein/DNA complex; 1.60A {Homo sapiens} Back     alignment and structure
>3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2cpq_A FragIle X mental retardation syndrome related protein 1, isoform B'; KH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2hh2_A KH-type splicing regulatory protein; KH-RNA binding domain, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ctm_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2ctl_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1ec6_A RNA-binding protein NOVA-2; KH domain, alpha-beta fold, RNA-binding motif, protein/RNA structure, RNA binding protein/RNA complex; 2.40A {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>1e3p_A Guanosine pentaphosphate synthetase; polyribonucleotide transferase, ATP-GTP diphosphotransferase RNA processing, RNA degradation; 2.5A {Streptomyces antibioticus} SCOP: a.4.9.1 b.40.4.5 d.14.1.4 d.14.1.4 d.52.3.1 d.101.1.1 d.101.1.1 PDB: 1e3h_A Back     alignment and structure
>2ctj_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>1j5k_A Heterogeneous nuclear ribonucleoprotein K; single-stranded DNA binding protein, transcription factor, hnRNP K, CT element, C-MYC oncogene; NMR {Homo sapiens} SCOP: d.51.1.1 PDB: 1khm_A Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>2dgr_A Ring finger and KH domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2jvz_A KH type-splicing, FAR upstream element-binding protein 2; RNA binding protein, KH domain, KSRP, posttranscriptional regulation, mRNA decay; NMR {Homo sapiens} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>2lli_A Protein AIR2; RNA surveillance, RNA degradation, RNA binding, exosome, RNA protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2jzx_A Poly(RC)-binding protein 2; PCBP2, KH domains, RNA binding, DNA-binding, nucleus, phosph ribonucleoprotein, RNA-binding, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1j4w_A FUSE binding protein; single-stranded DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>3krm_A Insulin-like growth factor 2 mRNA-binding protein 1; KH domain, cell projection, cytoplasm, nucleus, phosphoprotein, translation regulation; 2.75A {Homo sapiens} Back     alignment and structure
>2anr_A Neuro-oncological ventral antigen 1; protein-RNA complex, KH domain, hairpin, RNA-binding protein complex; HET: 5BU; 1.94A {Homo sapiens} PDB: 2ann_A* Back     alignment and structure
>2li8_A Protein LIN-28 homolog A; zinc finger, micro RNA, transcription-RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 Back     alignment and structure
>1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A Back     alignment and structure
>2ctf_A Vigilin; K homology type I domain, RNA-binding, cell sterol metabolism, beta-alpha-alpha-beta-BETA-alpha structure, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.51.1.1 Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>2e3u_A PH-DIM2P, hypothetical protein PH1566; PRE-ribosomal RNA processing factor, RNA binding protein; 2.30A {Pyrococcus horikoshii} PDB: 3aev_B Back     alignment and structure
>1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>1nc8_A Nucleocapsid protein; HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus 2} SCOP: g.40.1.1 PDB: 2di2_A Back     alignment and structure
>1a6b_B Momulv, zinc finger protein NCP10; nucleocapsid protein, intercalation, nucleic acid, retrovirus, viral protein/DNA complex; HET: DNA; NMR {Synthetic} SCOP: g.40.1.1 Back     alignment and structure
>2ysa_A Retinoblastoma-binding protein 6; zinc finger, CCHC, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qnd_A FMR1 protein; KH domain, eukaryotic KH domains, tandem KH domains, type I domains, fragIle X mental retardation protein, RNA BI protein; 1.90A {Homo sapiens} PDB: 2fmr_A Back     alignment and structure
>1u6p_A GAG polyprotein; MLV, A-minor K-turn, stem loop, bulge, G-U mismatch, G-A MIS U mismatch, A-C mismatch, zinc finger, NC, viral protein-RN; HET: AP7; NMR {Moloney murine leukemia virus} SCOP: g.40.1.1 PDB: 1wwd_A 1wwe_A 1wwf_A 1wwg_A Back     alignment and structure
>1tua_A Hypothetical protein APE0754; structural genomics, protein structure initiative, MCSG, four layers alpha-beta sandwich, PSI; 1.50A {Aeropyrum pernix} SCOP: d.51.1.1 d.51.1.1 Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>2a51_A Nucleocapsid protein; sivlhoest, structure, NCP8, viral protein, metal binding protein; NMR {Synthetic} Back     alignment and structure
>3n89_A Defective in GERM LINE development protein 3, ISO; KH domains, RNA binding, cell cycle; 2.79A {Caenorhabditis elegans} Back     alignment and structure
>2bl6_A Nucleocapsid protein P11; lentivirus, polyprotein, core protein, retrovirus zinc finger-like domains; NMR {Equine infectious anemia virus} Back     alignment and structure
>2ec7_A GAG polyprotein (PR55GAG); nucleocapsid protein, HIV-2, RNA recognition, zinc finger, viral protein; NMR {Human immunodeficiency virus type 2} SCOP: g.40.1.1 Back     alignment and structure
>2ysa_A Retinoblastoma-binding protein 6; zinc finger, CCHC, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3v69_A Protein filia; RNA-binding, embryogenesis, KH domain, RNA binding, P binding; 2.20A {Mus musculus} Back     alignment and structure
>2ihx_A Nucleocapsid (NC) protein; protein-RNA complex, viral protein/RNA complex; NMR {Rous sarcoma virus} Back     alignment and structure
>2cqf_A RNA-binding protein LIN-28; CCHC zinc-finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1a1t_A Nucleocapsid protein; stem-loop RNA, viral protein/RNA complex; NMR {Human immunodeficiency virus 1} SCOP: g.40.1.1 PDB: 1mfs_A 1f6u_A* 1aaf_A 2l4l_A 2exf_A 2jzw_A* 1bj6_A* 1esk_A 1q3y_A 1q3z_A 2e1x_A 2iwj_A Back     alignment and structure
>3nyb_B Protein AIR2; polya RNA polymerase, zinc knuckle protein, RNA surveillance binds to TRF4P/AIR2P heterodimer; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1cl4_A Protein (GAG polyprotein); nucleocapsid protein, RNA binding protein, retrovirus, viral protein; NMR {Mason-pfizer monkey virus} SCOP: g.40.1.1 PDB: 1dsv_A Back     alignment and structure
>3ts2_A Protein LIN-28 homolog A; microrna biogenesis, protein-RNA complex, PRE-element, CCHC knuckle; HET: GMP; 2.01A {Mus musculus} PDB: 3trz_A* 3ts0_A* Back     alignment and structure
>1y14_B B16, RPB7, DNA-directed RNA polymerase II 19 kDa polypeptide; transferase; 2.30A {Saccharomyces cerevisiae} SCOP: b.40.4.5 d.230.1.1 PDB: 1nt9_G 1wcm_G 1pqv_G 1y1v_G 1y1w_G 1y1y_G 1y77_G* 2b63_G* 2ja5_G* 2ja6_G* 2ja7_G* 2ja8_G* 2r7z_G 2r92_G 2r93_G 2vum_G* 3fki_G 3h3v_H 3hou_G* 3hov_G* ... Back     alignment and structure
>1go3_E DNA-directed RNA polymerase subunit E; transferase, transferase, transcription; 1.75A {Methanococcus jannaschii} SCOP: b.40.4.5 d.230.1.1 Back     alignment and structure
>2hqh_E Restin; beta/BETA structure, zinc finger motif, structural protein, binding; 1.80A {Homo sapiens} Back     alignment and structure
>2z0s_A Probable exosome complex RNA-binding protein 1; alpha/beta protein, cytoplasm, structural genomics, NPPSFA; 3.20A {Aeropyrum pernix} SCOP: b.40.4.5 d.51.1.1 Back     alignment and structure
>2cxc_A NUSA; transcription termination, RNA binding protein, archaeal NUS domain, structural genomics, NPPSFA; 2.00A {Aeropyrum pernix} PDB: 2cy1_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 304
d1k1ga_122 d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo s 6e-32
d2bl5a1134 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {Afric 1e-30
d2exfa142 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunod 2e-07
d2ctka191 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [T 3e-07
d1dtja_74 d.51.1.1 (A:) Neuro-oncological ventral antigen 2, 1e-06
d2ctma181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 5e-06
d2je6i369 d.51.1.1 (I:153-221) Exosome complex RNA-binding p 1e-05
d1x4na179 d.51.1.1 (A:8-86) Far upstream binding element, FB 1e-05
d2ctea181 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [T 1e-05
d1viga_71 d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId 2e-05
d1we8a_104 d.51.1.1 (A:) Tudor and KH domain containing prote 3e-05
d2cpqa178 d.51.1.1 (A:212-289) Fragile X mental retardation 4e-05
d1e3ha454 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/ 9e-05
d1zzka175 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapie 1e-04
d2ctla184 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [T 2e-04
d1tuaa184 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Ae 2e-04
d2z0sa287 d.51.1.1 (A:148-234) Exosome complex RNA-binding p 2e-04
d1wvna170 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Huma 3e-04
d1j4wa174 d.51.1.1 (A:1-74) Far upstream binding element, FB 3e-04
d2ctfa190 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [T 4e-04
d1tuaa2104 d.51.1.1 (A:85-188) Hypothetical protein APE0754 { 4e-04
d1x4ma181 d.51.1.1 (A:8-88) Far upstream binding element, FB 6e-04
d2axya171 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Hum 6e-04
d1j4wa271 d.51.1.1 (A:104-174) Far upstream binding element, 6e-04
d2ba0a384 d.51.1.1 (A:136-219) Exosome complex RNA-binding p 0.001
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: RNA splicing factor 1
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  112 bits (283), Expect = 6e-32
 Identities = 70/107 (65%), Positives = 88/107 (82%), Gaps = 2/107 (1%)

Query: 195 KVNDKVMIPQDEHPDINFVGLLIGPRGNTLKSMEKDTGAKIIIRGKGSVKEGKVGRKDGQ 254
           +V+DKVMIPQDE+P+INFVGLLIGPRGNTLK++EK+  AKI+IRGKGSVKEGKVGRKDGQ
Sbjct: 2   RVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQ 61

Query: 255 PLPGENEPLHAYVTAHNPENVKKAVDRLVCLVSARPRARFPPGADFI 301
            LPGE+EPLHA VTA+  ENVKKAV+++  ++  +     P   + +
Sbjct: 62  MLPGEDEPLHALVTANTMENVKKAVEQIRNIL--KQGIETPEDQNDL 106
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 134 Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Length = 42 Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Length = 69 Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 79 Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Length = 78 Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Length = 54 Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 84 Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Length = 87 Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Length = 104 Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Length = 84 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query304
d1k1ga_122 RNA splicing factor 1 {Human (Homo sapiens) [TaxId 100.0
d2bl5a1134 Quaking protein A (Xqua) {African clawed frog (Xen 99.97
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 99.42
d2z0sa287 Exosome complex RNA-binding protein 1, ECR1 {Aerop 99.26
d2cpqa178 Fragile X mental retardation syndrome related prot 99.26
d2ba0a384 Exosome complex RNA-binding protein 1, ECR1 {Archa 99.13
d2je6i369 Exosome complex RNA-binding protein 1, ECR1 {Sulfo 99.09
d1dtja_74 Neuro-oncological ventral antigen 2, nova-2, KH3 { 99.09
d1we8a_104 Tudor and KH domain containing protein, Tdrkh {Mou 99.08
d1zzka175 HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} 99.08
d1j4wa271 Far upstream binding element, FBP {Human (Homo sap 99.07
d1x4ma181 Far upstream binding element, FBP {Mouse (Mus musc 99.04
d1j4wa174 Far upstream binding element, FBP {Human (Homo sap 99.03
d1e3ha454 Polynucleotide phosphorylase/guanosine pentaphosph 99.02
d1x4na179 Far upstream binding element, FBP {Mouse (Mus musc 99.02
d2ctma181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.98
d1wvna170 Poly(RC)-binding protein 1 {Human (Homo sapiens) [ 98.97
d1tuaa2104 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.96
d2axya171 Poly(RC)-binding protein 2 {Human (Homo sapiens) [ 98.93
d2ctka191 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.92
d1tuaa184 Hypothetical protein APE0754 {Aeropyrum pernix [Ta 98.91
d2ctea181 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.88
d1viga_71 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.83
d2ctla184 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.8
d2ctja182 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.65
d2ctfa190 Vigilin {Human (Homo sapiens) [TaxId: 9606]} 98.65
d1nc8a_29 HIV nucleocapsid {Human immunodeficiency virus typ 98.03
d1nc8a_29 HIV nucleocapsid {Human immunodeficiency virus typ 97.95
d2exfa142 HIV nucleocapsid {Human immunodeficiency virus typ 97.4
d1dsqa_26 Nucleic acid binding protein p14 {Mouse mammary tu 97.2
d1dsqa_26 Nucleic acid binding protein p14 {Mouse mammary tu 97.07
d1a6bb_40 Zinc finger protein ncp10 {Moloney murine leukemia 96.45
d1e3ha696 Polynucleotide phosphorylase/guanosine pentaphosph 94.02
d1a6bb_40 Zinc finger protein ncp10 {Moloney murine leukemia 92.7
d1cl4a_32 Nucleocapsid protein from mason-pfizer monkey viru 92.15
d2ja9a285 Ribosomal RNA-processing protein 40, RRP40 {Saccha 91.84
d1dsva_31 Nucleic acid binding protein p14 {Mouse mammary tu 90.44
>d1k1ga_ d.51.1.1 (A:) RNA splicing factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Eukaryotic type KH-domain (KH-domain type I)
superfamily: Eukaryotic type KH-domain (KH-domain type I)
family: Eukaryotic type KH-domain (KH-domain type I)
domain: RNA splicing factor 1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.3e-33  Score=231.29  Aligned_cols=105  Identities=67%  Similarity=1.000  Sum_probs=95.2

Q ss_pred             cceeEEEEeCCCCCCCCcccceeecCCchhHHHHHHHhCCeEEEeCCccccCCCCCCCCCCCCCCCCCCcEEEEEeCCHH
Q psy1775         194 IKVNDKVMIPQDEHPDINFVGLLIGPRGNTLKSMEKDTGAKIIIRGKGSVKEGKVGRKDGQPLPGENEPLHAYVTAHNPE  273 (304)
Q Consensus       194 ~~~~~ki~IP~~~~P~~NfiG~iiGP~G~t~K~ie~etg~kI~IrG~Gs~~~~~~~~~~g~~~~~~~e~LHv~I~a~~~~  273 (304)
                      +|+++|||||+++||+|||||+||||+|+|+|+||++|||||+|||+||+++++.+..+...+++++|||||+|+|++++
T Consensus         1 ~k~~~Ki~iP~~~~P~fNfvG~IlGPrG~t~K~Le~eTgckI~IrGrGS~kd~~~~~~~~~~~~~~~epLHv~I~a~~~~   80 (122)
T d1k1ga_           1 TRVSDKVMIPQDEYPEINFVGLLIGPRGNTLKNIEKECNAKIMIRGKGSVKEGKVGRKDGQMLPGEDEPLHALVTANTME   80 (122)
T ss_dssp             CCEEEEEECCTTTCCSHHHHHHHHCSSSHHHHHHHHHSCCEEEEEESTTSSSSSSSSCCCCCSCCSSCCEEEEEEESSHH
T ss_pred             CceeEEEecCCccCCCCCeeeeEeCCCCchHHHHHHHHCCEEEEEecCCcccccccccCCCCCCCCCCCceEEEecCChh
Confidence            36899999999999999999999999999999999999999999999999998876666666889999999999999999


Q ss_pred             HHHHHHHHHHhhhcCCCCCCCCCCccc
Q psy1775         274 NVKKAVDRLVCLVSARPRARFPPGADF  300 (304)
Q Consensus       274 ~v~~A~~~I~~ll~~~~~~~~~~g~~~  300 (304)
                      ++++|+++|++||.+..  .++|++|.
T Consensus        81 ~~~~A~~~i~~ll~~~~--~~~e~~d~  105 (122)
T d1k1ga_          81 NVKKAVEQIRNILKQGI--ETPEDQND  105 (122)
T ss_dssp             HHHHHHHHHHHHHTTTT--SCCTTSSG
T ss_pred             hHHHHHHHHHHHHHhcC--CCCCCchH
Confidence            99999999999997642  35777763
>d2bl5a1 d.51.1.1 (A:1-134) Quaking protein A (Xqua) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure
>d2z0sa2 d.51.1.1 (A:148-234) Exosome complex RNA-binding protein 1, ECR1 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2cpqa1 d.51.1.1 (A:212-289) Fragile X mental retardation syndrome related protein 1, FXR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ba0a3 d.51.1.1 (A:136-219) Exosome complex RNA-binding protein 1, ECR1 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2je6i3 d.51.1.1 (I:153-221) Exosome complex RNA-binding protein 1, ECR1 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1dtja_ d.51.1.1 (A:) Neuro-oncological ventral antigen 2, nova-2, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we8a_ d.51.1.1 (A:) Tudor and KH domain containing protein, Tdrkh {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zzka1 d.51.1.1 (A:11-85) HnRNP K, KH3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j4wa2 d.51.1.1 (A:104-174) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ma1 d.51.1.1 (A:8-88) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j4wa1 d.51.1.1 (A:1-74) Far upstream binding element, FBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ha4 d.52.3.1 (A:579-632) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domain 6 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d1x4na1 d.51.1.1 (A:8-86) Far upstream binding element, FBP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ctma1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wvna1 d.51.1.1 (A:5-74) Poly(RC)-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuaa2 d.51.1.1 (A:85-188) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2axya1 d.51.1.1 (A:11-81) Poly(RC)-binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctka1 d.51.1.1 (A:8-98) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tuaa1 d.51.1.1 (A:1-84) Hypothetical protein APE0754 {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2ctea1 d.51.1.1 (A:8-88) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viga_ d.51.1.1 (A:) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctla1 d.51.1.1 (A:8-91) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctja1 d.51.1.1 (A:8-89) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ctfa1 d.51.1.1 (A:7-96) Vigilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
>d1nc8a_ g.40.1.1 (A:) HIV nucleocapsid {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
>d2exfa1 g.40.1.1 (A:12-53) HIV nucleocapsid {Human immunodeficiency virus type 1, different isolates [TaxId: 11676]} Back     information, alignment and structure
>d1dsqa_ g.40.1.1 (A:) Nucleic acid binding protein p14 {Mouse mammary tumor virus [TaxId: 11757]} Back     information, alignment and structure
>d1a6bb_ g.40.1.1 (B:) Zinc finger protein ncp10 {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} Back     information, alignment and structure
>d1e3ha6 d.101.1.1 (A:483-578) Polynucleotide phosphorylase/guanosine pentaphosphate synthase (PNPase/GPSI), domains 2 and 5 {Streptomyces antibioticus [TaxId: 1890]} Back     information, alignment and structure
>d1a6bb_ g.40.1.1 (B:) Zinc finger protein ncp10 {Moloney murine leukemia virus, MoMLV [TaxId: 11801]} Back     information, alignment and structure
>d1cl4a_ g.40.1.1 (A:) Nucleocapsid protein from mason-pfizer monkey virus (MPMV) {Mason-pfizer monkey virus [TaxId: 11855]} Back     information, alignment and structure
>d2ja9a2 d.51.1.1 (A:152-236) Ribosomal RNA-processing protein 40, RRP40 {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1dsva_ g.40.1.1 (A:) Nucleic acid binding protein p14 {Mouse mammary tumor virus [TaxId: 11757]} Back     information, alignment and structure