Psyllid ID: psy17773
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 165 | ||||||
| 270001122 | 570 | hypothetical protein TcasGA2_TC011430 [T | 0.751 | 0.217 | 0.489 | 5e-42 | |
| 158299912 | 889 | AGAP009160-PA [Anopheles gambiae str. PE | 0.642 | 0.119 | 0.616 | 8e-38 | |
| 170060156 | 860 | centaurin-gamma 1A [Culex quinquefasciat | 0.678 | 0.130 | 0.593 | 1e-37 | |
| 157130881 | 759 | centaurin gamma [Aedes aegypti] gi|10888 | 0.642 | 0.139 | 0.616 | 1e-37 | |
| 189241692 | 599 | PREDICTED: similar to AGAP009160-PA [Tri | 0.642 | 0.176 | 0.603 | 3e-37 | |
| 328715502 | 754 | PREDICTED: centaurin-gamma-1A-like [Acyr | 0.690 | 0.151 | 0.548 | 3e-37 | |
| 312385031 | 1502 | hypothetical protein AND_01257 [Anophele | 0.642 | 0.070 | 0.6 | 1e-36 | |
| 427783795 | 867 | Putative gtpase-activating protein centa | 0.654 | 0.124 | 0.568 | 2e-36 | |
| 427780055 | 895 | Putative gtpase-activating protein centa | 0.654 | 0.120 | 0.568 | 2e-36 | |
| 427783793 | 867 | Putative gtpase-activating protein centa | 0.654 | 0.124 | 0.568 | 2e-36 |
| >gi|270001122|gb|EEZ97569.1| hypothetical protein TcasGA2_TC011430 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 175 bits (444), Expect = 5e-42, Method: Compositional matrix adjust.
Identities = 90/184 (48%), Positives = 109/184 (59%), Gaps = 60/184 (32%)
Query: 1 MSHYRNAAEIPIILVGTQDS---------------------------------------- 20
MSHYRN+AEIP+ILVGTQD+
Sbjct: 180 MSHYRNSAEIPLILVGTQDAISENNPRVIDDSRARKLANDLKRCSYYETCATYGLNVERV 239
Query: 21 -----DSFELLIVSLDNKQWQFEAANSEERDDWIAAIQQQILSSLQ-------------- 61
D +E IVSLDNKQW FEA++S+ERDDW+AAI+QQIL+SLQ
Sbjct: 240 FQDDPDGYEFFIVSLDNKQWHFEASSSDERDDWVAAIEQQILNSLQLNESSKGKKQNNPM 299
Query: 62 -TASLQSIRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLEL 120
A++QSIRSRVPGN C DC P WASLNLG+L+CI+C G+HR LG+H+SRVRSL+L
Sbjct: 300 EAATIQSIRSRVPGNGFCVDCDATNPDWASLNLGVLMCIECSGIHRNLGSHISRVRSLDL 359
Query: 121 DEWP 124
DEWP
Sbjct: 360 DEWP 363
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|158299912|ref|XP_319921.4| AGAP009160-PA [Anopheles gambiae str. PEST] gi|157013746|gb|EAA14733.4| AGAP009160-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|170060156|ref|XP_001865678.1| centaurin-gamma 1A [Culex quinquefasciatus] gi|167878685|gb|EDS42068.1| centaurin-gamma 1A [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|157130881|ref|XP_001662044.1| centaurin gamma [Aedes aegypti] gi|108881886|gb|EAT46111.1| AAEL002660-PA, partial [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|189241692|ref|XP_969889.2| PREDICTED: similar to AGAP009160-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|328715502|ref|XP_001951726.2| PREDICTED: centaurin-gamma-1A-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|312385031|gb|EFR29622.1| hypothetical protein AND_01257 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|427783795|gb|JAA57349.1| Putative gtpase-activating protein centaurin gamma [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|427780055|gb|JAA55479.1| Putative gtpase-activating protein centaurin gamma [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|427783793|gb|JAA57348.1| Putative gtpase-activating protein centaurin gamma [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 165 | ||||||
| FB|FBgn0028509 | 995 | CenG1A "Centaurin gamma 1A" [D | 0.642 | 0.106 | 0.566 | 2.1e-37 | |
| UNIPROTKB|F5GXM9 | 696 | AGAP1 "Arf-GAP with GTPase, AN | 0.642 | 0.152 | 0.495 | 1.3e-31 | |
| UNIPROTKB|F1P7C6 | 857 | F1P7C6 "Uncharacterized protei | 0.642 | 0.123 | 0.495 | 2.5e-31 | |
| UNIPROTKB|F1MGL2 | 807 | AGAP1 "Uncharacterized protein | 0.642 | 0.131 | 0.495 | 2.5e-31 | |
| UNIPROTKB|Q9UPQ3 | 857 | AGAP1 "Arf-GAP with GTPase, AN | 0.642 | 0.123 | 0.495 | 3.2e-31 | |
| UNIPROTKB|F1NWZ1 | 860 | AGAP1 "Uncharacterized protein | 0.642 | 0.123 | 0.495 | 3.2e-31 | |
| UNIPROTKB|E7EUN2 | 1069 | AGAP1 "Arf-GAP with GTPase, AN | 0.642 | 0.099 | 0.495 | 6.8e-31 | |
| UNIPROTKB|F1M838 | 750 | Agap1 "Protein Agap1" [Rattus | 0.642 | 0.141 | 0.487 | 1.1e-30 | |
| UNIPROTKB|F1LRF1 | 803 | Agap1 "Protein Agap1" [Rattus | 0.642 | 0.132 | 0.487 | 1.4e-30 | |
| MGI|MGI:2653690 | 857 | Agap1 "ArfGAP with GTPase doma | 0.642 | 0.123 | 0.487 | 1.8e-30 |
| FB|FBgn0028509 CenG1A "Centaurin gamma 1A" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 360 (131.8 bits), Expect = 2.1e-37, Sum P(2) = 2.1e-37
Identities = 68/120 (56%), Positives = 87/120 (72%)
Query: 19 DSDSFELLIVSLDNKQWQFEAANSEERDDWIAAIQQQILSSLQT--------------AS 64
D+D +E IVSLD+KQW FEAANSEERD+W+AA++Q+I SLQ+ A+
Sbjct: 644 DNDGYEFYIVSLDSKQWHFEAANSEERDEWVAAVEQEIFKSLQSIESSKTKQATSTDLAA 703
Query: 65 LQSIRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEWP 124
+ +IR RVPGN C DC P WASLNLG+L+CI+C GVHR LG+H+S+VRSL LD+WP
Sbjct: 704 MLAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWP 763
|
|
| UNIPROTKB|F5GXM9 AGAP1 "Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P7C6 F1P7C6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MGL2 AGAP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UPQ3 AGAP1 "Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NWZ1 AGAP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EUN2 AGAP1 "Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M838 Agap1 "Protein Agap1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LRF1 Agap1 "Protein Agap1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2653690 Agap1 "ArfGAP with GTPase domain, ankyrin repeat and PH domain 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 165 | |||
| pfam01412 | 117 | pfam01412, ArfGap, Putative GTPase activating prot | 3e-28 | |
| smart00105 | 119 | smart00105, ArfGap, Putative GTP-ase activating pr | 2e-24 | |
| cd04103 | 158 | cd04103, Centaurin_gamma, Centaurin gamma (CENTG) | 2e-23 | |
| COG5347 | 319 | COG5347, COG5347, GTPase-activating protein that r | 6e-21 | |
| cd01250 | 114 | cd01250, PH_AGAP, Arf-GAP with GTPase, ANK repeat | 3e-18 | |
| PLN03114 | 395 | PLN03114, PLN03114, ADP-ribosylation factor GTPase | 2e-13 | |
| cd04103 | 158 | cd04103, Centaurin_gamma, Centaurin gamma (CENTG) | 2e-04 | |
| pfam00169 | 101 | pfam00169, PH, PH domain | 5e-04 | |
| cd04177 | 168 | cd04177, RSR1, RSR1/Bud1p family GTPase | 0.001 | |
| smart00233 | 102 | smart00233, PH, Pleckstrin homology domain | 0.002 | |
| PLN03131 | 705 | PLN03131, PLN03131, hypothetical protein; Provisio | 0.004 |
| >gnl|CDD|216485 pfam01412, ArfGap, Putative GTPase activating protein for Arf | Back alignment and domain information |
|---|
Score = 100 bits (252), Expect = 3e-28
Identities = 36/62 (58%), Positives = 46/62 (74%), Gaps = 1/62 (1%)
Query: 65 LQSIRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEWP 124
L+ +R ++PGN CADC PTWASLNLG+ +CI+C GVHR LG H+S+VRSL LD+W
Sbjct: 4 LRELR-KLPGNKVCADCGAPNPTWASLNLGIFICIRCSGVHRSLGVHISKVRSLTLDKWT 62
Query: 125 ES 126
Sbjct: 63 PE 64
|
Putative zinc fingers with GTPase activating proteins (GAPs) towards the small GTPase, Arf. The GAP of ARD1 stimulates GTPase hydrolysis for ARD1 but not ARFs. Length = 117 |
| >gnl|CDD|214518 smart00105, ArfGap, Putative GTP-ase activating proteins for the small GTPase, ARF | Back alignment and domain information |
|---|
| >gnl|CDD|133303 cd04103, Centaurin_gamma, Centaurin gamma (CENTG) GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|227651 COG5347, COG5347, GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >gnl|CDD|241281 cd01250, PH_AGAP, Arf-GAP with GTPase, ANK repeat and PH domain-containing protein Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >gnl|CDD|178661 PLN03114, PLN03114, ADP-ribosylation factor GTPase-activating protein AGD10; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|133303 cd04103, Centaurin_gamma, Centaurin gamma (CENTG) GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|215766 pfam00169, PH, PH domain | Back alignment and domain information |
|---|
| >gnl|CDD|133377 cd04177, RSR1, RSR1/Bud1p family GTPase | Back alignment and domain information |
|---|
| >gnl|CDD|214574 smart00233, PH, Pleckstrin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|178677 PLN03131, PLN03131, hypothetical protein; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 165 | |||
| KOG0703|consensus | 287 | 100.0 | ||
| KOG0705|consensus | 749 | 100.0 | ||
| PF01412 | 116 | ArfGap: Putative GTPase activating protein for Arf | 100.0 | |
| KOG0521|consensus | 785 | 100.0 | ||
| smart00105 | 112 | ArfGap Putative GTP-ase activating proteins for th | 100.0 | |
| COG5347 | 319 | GTPase-activating protein that regulates ARFs (ADP | 100.0 | |
| KOG0706|consensus | 454 | 99.97 | ||
| KOG0704|consensus | 386 | 99.97 | ||
| PLN03114 | 395 | ADP-ribosylation factor GTPase-activating protein | 99.97 | |
| PLN03119 | 648 | putative ADP-ribosylation factor GTPase-activating | 99.95 | |
| PLN03131 | 705 | hypothetical protein; Provisional | 99.94 | |
| KOG1117|consensus | 1186 | 99.93 | ||
| KOG0818|consensus | 669 | 99.76 | ||
| cd01251 | 103 | PH_centaurin_alpha Centaurin alpha Pleckstrin homo | 98.94 | |
| cd01265 | 95 | PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | 98.87 | |
| cd01264 | 101 | PH_melted Melted pleckstrin homology (PH) domain. | 98.83 | |
| cd01238 | 106 | PH_Tec Tec pleckstrin homology (PH) domain. Tec pl | 98.82 | |
| KOG0702|consensus | 524 | 98.81 | ||
| cd01244 | 98 | PH_RasGAP_CG9209 RAS_GTPase activating protein (GA | 98.81 | |
| cd01247 | 91 | PH_GPBP Goodpasture antigen binding protein (GPBP) | 98.76 | |
| cd01260 | 96 | PH_CNK Connector enhancer of KSR (Kinase suppresso | 98.71 | |
| cd01249 | 104 | PH_oligophrenin Oligophrenin Pleckstrin homology ( | 98.71 | |
| cd01233 | 100 | Unc104 Unc-104 pleckstrin homology (PH) domain. Un | 98.67 | |
| cd01250 | 94 | PH_centaurin Centaurin Pleckstrin homology (PH) do | 98.62 | |
| cd01220 | 99 | PH_CDEP Chondrocyte-derived ezrin-like domain cont | 98.61 | |
| cd01219 | 101 | PH_FGD FGD (faciogenital dysplasia protein) plecks | 98.52 | |
| cd01257 | 101 | PH_IRS Insulin receptor substrate (IRS) pleckstrin | 98.52 | |
| cd01246 | 91 | PH_oxysterol_bp Oxysterol binding protein (OSBP) P | 98.44 | |
| cd01218 | 104 | PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | 98.44 | |
| cd01236 | 104 | PH_outspread Outspread Pleckstrin homology (PH) do | 98.36 | |
| cd01253 | 104 | PH_beta_spectrin Beta-spectrin pleckstrin homology | 98.35 | |
| cd01252 | 125 | PH_cytohesin Cytohesin Pleckstrin homology (PH) do | 98.33 | |
| cd01245 | 98 | PH_RasGAP_CG5898 RAS GTPase-activating protein (GA | 98.31 | |
| cd01235 | 101 | PH_SETbf Set binding factor Pleckstrin Homology (P | 98.31 | |
| cd01266 | 108 | PH_Gab Gab (Grb2-associated binder) pleckstrin hom | 98.2 | |
| cd01237 | 106 | Unc112 Unc-112 pleckstrin homology (PH) domain. Un | 98.17 | |
| PF15409 | 89 | PH_8: Pleckstrin homology domain | 98.14 | |
| PF00169 | 104 | PH: PH domain; InterPro: IPR001849 The pleckstrin | 98.08 | |
| cd01230 | 117 | PH_EFA6 EFA6 Pleckstrin Homology (PH) domain. EFA6 | 97.98 | |
| PF15410 | 119 | PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN | 97.86 | |
| cd01261 | 112 | PH_SOS Son of Sevenless (SOS) Pleckstrin homology | 97.82 | |
| cd01241 | 102 | PH_Akt Akt pleckstrin homology (PH) domain. Akt pl | 97.72 | |
| cd01226 | 100 | PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin | 97.71 | |
| cd01254 | 121 | PH_PLD Phospholipase D (PLD) pleckstrin homology ( | 97.68 | |
| cd00821 | 96 | PH Pleckstrin homology (PH) domain. Pleckstrin hom | 97.65 | |
| KOG1451|consensus | 812 | 97.62 | ||
| smart00233 | 102 | PH Pleckstrin homology domain. Domain commonly fou | 97.61 | |
| PF15413 | 112 | PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FE | 97.57 | |
| cd00900 | 99 | PH-like Pleckstrin homology-like domain. Pleckstri | 97.52 | |
| cd01222 | 97 | PH_clg Clg (common-site lymphoma/leukemia guanine | 97.3 | |
| cd01263 | 122 | PH_anillin Anillin Pleckstrin homology (PH) domain | 97.12 | |
| KOG4424|consensus | 623 | 97.05 | ||
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 96.74 | |
| cd01223 | 116 | PH_Vav Vav pleckstrin homology (PH) domain. Vav pl | 96.7 | |
| KOG0930|consensus | 395 | 96.33 | ||
| PF14593 | 104 | PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A. | 96.28 | |
| PTZ00267 | 478 | NIMA-related protein kinase; Provisional | 96.17 | |
| KOG0932|consensus | 774 | 95.94 | ||
| cd01228 | 96 | PH_BCR-related BCR (breakpoint cluster region)-rel | 95.83 | |
| KOG0521|consensus | 785 | 95.72 | ||
| cd01232 | 114 | PH_TRIO Trio pleckstrin homology (PH) domain. Trio | 95.64 | |
| PF15406 | 112 | PH_6: Pleckstrin homology domain | 95.63 | |
| cd01262 | 89 | PH_PDK1 3-Phosphoinositide dependent protein kinas | 95.51 | |
| cd01221 | 125 | PH_ephexin Ephexin Pleckstrin homology (PH) domain | 95.39 | |
| cd01258 | 108 | PH_syntrophin Syntrophin pleckstrin homology (PH) | 94.64 | |
| cd01231 | 107 | PH_Lnk LNK-family Pleckstrin homology (PH) domain. | 94.61 | |
| cd01224 | 109 | PH_Collybistin Collybistin pleckstrin homology (PH | 94.52 | |
| cd01242 | 112 | PH_ROK Rok (Rho- associated kinase) pleckstrin hom | 94.46 | |
| PF12814 | 123 | Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin | 94.32 | |
| cd01256 | 110 | PH_dynamin Dynamin pleckstrin homology (PH) domain | 94.19 | |
| cd01248 | 115 | PH_PLC Phospholipase C (PLC) pleckstrin homology ( | 94.02 | |
| cd01227 | 133 | PH_Dbs Dbs (DBL's big sister) pleckstrin homology | 93.48 | |
| KOG0690|consensus | 516 | 93.21 | ||
| cd01225 | 111 | PH_Cool_Pix Cool (cloned out of library)/Pix (PAK- | 93.15 | |
| PF08458 | 110 | PH_2: Plant pleckstrin homology-like region; Inter | 92.19 | |
| cd01243 | 122 | PH_MRCK MRCK (myotonic dystrophy-related Cdc42-bin | 92.05 | |
| PF15405 | 135 | PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A. | 91.93 | |
| KOG2059|consensus | 800 | 91.47 | ||
| cd01239 | 117 | PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin hom | 90.14 | |
| KOG3551|consensus | 506 | 89.88 | ||
| PF15404 | 185 | PH_4: Pleckstrin homology domain | 86.72 | |
| PRK12495 | 226 | hypothetical protein; Provisional | 83.37 | |
| cd01234 | 117 | PH_CADPS CADPS (Ca2+-dependent activator protein) | 81.62 | |
| PF00643 | 42 | zf-B_box: B-box zinc finger; InterPro: IPR000315 Z | 81.41 | |
| PF08271 | 43 | TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 | 81.25 | |
| PF01286 | 34 | XPA_N: XPA protein N-terminal; InterPro: IPR022652 | 80.8 | |
| KOG3549|consensus | 505 | 80.42 |
| >KOG0703|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.7e-36 Score=250.62 Aligned_cols=95 Identities=34% Similarity=0.736 Sum_probs=90.6
Q ss_pred HHHHHHHHhhCCCCCCCCCCCCCCCCeeeecccceeeeccccccccCCCccceeeeccCCCCCCchHHHHHHHhhHHHHH
Q psy17773 62 TASLQSIRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEWPESNPRIIDEARARRLAS 141 (165)
Q Consensus 62 ~~~l~~l~~~~~~N~~CaDCg~~~p~w~s~n~Gv~lC~~Cs~iHR~lg~~is~VkSl~ld~w~~~~v~~~~~~~GN~~~n 141 (165)
+..|+.|++ .|+|+.|||||++.|.|||+|+|||||+.|+||||+||+|||+|||++||.|++++|+.| ...||.+||
T Consensus 13 ~~~l~~Ll~-~~~N~~CADC~a~~P~WaSwnlGvFiC~~C~giHR~lg~hiSkVkSv~LD~W~~eqv~~m-~~~GN~~an 90 (287)
T KOG0703|consen 13 KRRLRELLR-EPDNKVCADCGAKGPRWASWNLGVFICLRCAGIHRSLGVHISKVKSVTLDEWTDEQVDFM-ISMGNAKAN 90 (287)
T ss_pred HHHHHHHHc-CcccCcccccCCCCCCeEEeecCeEEEeecccccccccchhheeeeeeccccCHHHHHHH-HHHcchhhh
Confidence 567889998 999999999999999999999999999999999999999999999999999999999999 999999999
Q ss_pred HHhhhcCCCCCCCCCCC
Q psy17773 142 DLKRCSYYETCATYGLN 158 (165)
Q Consensus 142 ~~~e~~~~~~~~~~~~~ 158 (165)
.+||+.+|+.+.+|...
T Consensus 91 ~~~ea~~p~~~~~p~~d 107 (287)
T KOG0703|consen 91 SYYEAKLPDPFRRPGPD 107 (287)
T ss_pred hhccccCCccccCCChH
Confidence 99999999999877644
|
|
| >KOG0705|consensus | Back alignment and domain information |
|---|
| >PF01412 ArfGap: Putative GTPase activating protein for Arf; InterPro: IPR001164 This entry describes a family of small GTPase activating proteins, for example ARF1-directed GTPase-activating protein, the cycle control GTPase activating protein (GAP) GCS1 which is important for the regulation of the ADP ribosylation factor ARF, a member of the Ras superfamily of GTP-binding proteins [] | Back alignment and domain information |
|---|
| >KOG0521|consensus | Back alignment and domain information |
|---|
| >smart00105 ArfGap Putative GTP-ase activating proteins for the small GTPase, ARF | Back alignment and domain information |
|---|
| >COG5347 GTPase-activating protein that regulates ARFs (ADP-ribosylation factors), involved in ARF-mediated vesicular transport [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG0706|consensus | Back alignment and domain information |
|---|
| >KOG0704|consensus | Back alignment and domain information |
|---|
| >PLN03114 ADP-ribosylation factor GTPase-activating protein AGD10; Provisional | Back alignment and domain information |
|---|
| >PLN03119 putative ADP-ribosylation factor GTPase-activating protein AGD14; Provisional | Back alignment and domain information |
|---|
| >PLN03131 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1117|consensus | Back alignment and domain information |
|---|
| >KOG0818|consensus | Back alignment and domain information |
|---|
| >cd01251 PH_centaurin_alpha Centaurin alpha Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01265 PH_PARIS-1 PARIS-1 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01264 PH_melted Melted pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01238 PH_Tec Tec pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0702|consensus | Back alignment and domain information |
|---|
| >cd01244 PH_RasGAP_CG9209 RAS_GTPase activating protein (GAP)_CG9209 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01247 PH_GPBP Goodpasture antigen binding protein (GPBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01260 PH_CNK Connector enhancer of KSR (Kinase suppressor of ras) (CNK) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01249 PH_oligophrenin Oligophrenin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01233 Unc104 Unc-104 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01250 PH_centaurin Centaurin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01220 PH_CDEP Chondrocyte-derived ezrin-like domain containing protein (CDEP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01219 PH_FGD FGD (faciogenital dysplasia protein) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01257 PH_IRS Insulin receptor substrate (IRS) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01246 PH_oxysterol_bp Oxysterol binding protein (OSBP) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01218 PH_phafin2 Phafin2 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01236 PH_outspread Outspread Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01253 PH_beta_spectrin Beta-spectrin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01252 PH_cytohesin Cytohesin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01245 PH_RasGAP_CG5898 RAS GTPase-activating protein (GAP) CG5898 Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01235 PH_SETbf Set binding factor Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01266 PH_Gab Gab (Grb2-associated binder) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15409 PH_8: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >PF00169 PH: PH domain; InterPro: IPR001849 The pleckstrin homology (PH) domain is a domain of about 100 residues that occurs in a wide range of proteins involved in intracellular signalling or as constituents of the cytoskeleton [, , , , , , ] | Back alignment and domain information |
|---|
| >cd01230 PH_EFA6 EFA6 Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >PF15410 PH_9: Pleckstrin homology domain; PDB: 1WJM_A 1BTN_A 1MPH_A | Back alignment and domain information |
|---|
| >cd01261 PH_SOS Son of Sevenless (SOS) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01241 PH_Akt Akt pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01226 PH_exo84 Exocyst complex 84-kDa subunit Pleckstrin Homology (PH) domain | Back alignment and domain information |
|---|
| >cd01254 PH_PLD Phospholipase D (PLD) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd00821 PH Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG1451|consensus | Back alignment and domain information |
|---|
| >smart00233 PH Pleckstrin homology domain | Back alignment and domain information |
|---|
| >PF15413 PH_11: Pleckstrin homology domain; PDB: 3MDB_D 3FEH_A 3LJU_X 3FM8_C | Back alignment and domain information |
|---|
| >cd00900 PH-like Pleckstrin homology-like domain | Back alignment and domain information |
|---|
| >cd01222 PH_clg Clg (common-site lymphoma/leukemia guanine nucleotide exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01263 PH_anillin Anillin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG4424|consensus | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd01223 PH_Vav Vav pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0930|consensus | Back alignment and domain information |
|---|
| >PF14593 PH_3: PH domain; PDB: 1W1H_D 1W1D_A 1W1G_A 2VKI_A | Back alignment and domain information |
|---|
| >PTZ00267 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0932|consensus | Back alignment and domain information |
|---|
| >cd01228 PH_BCR-related BCR (breakpoint cluster region)-related pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0521|consensus | Back alignment and domain information |
|---|
| >cd01232 PH_TRIO Trio pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15406 PH_6: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >cd01262 PH_PDK1 3-Phosphoinositide dependent protein kinase 1 (PDK1) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01221 PH_ephexin Ephexin Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01258 PH_syntrophin Syntrophin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01231 PH_Lnk LNK-family Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01224 PH_Collybistin Collybistin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01242 PH_ROK Rok (Rho- associated kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF12814 Mcp5_PH: Meiotic cell cortex C-terminal pleckstrin homology; InterPro: IPR024774 This pleckstrin homology domain is found in eukaryotic proteins, including Mcp5, a fungal protein that anchors dynein at the cell cortex during the horsetail phase (prophase I) of meiosis | Back alignment and domain information |
|---|
| >cd01256 PH_dynamin Dynamin pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01248 PH_PLC Phospholipase C (PLC) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >cd01227 PH_Dbs Dbs (DBL's big sister) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG0690|consensus | Back alignment and domain information |
|---|
| >cd01225 PH_Cool_Pix Cool (cloned out of library)/Pix (PAK-interactive exchange factor) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF08458 PH_2: Plant pleckstrin homology-like region; InterPro: IPR013666 This domain describes a pleckstrin homology (PH)-like region found in several plant proteins of unknown function | Back alignment and domain information |
|---|
| >cd01243 PH_MRCK MRCK (myotonic dystrophy-related Cdc42-binding kinase) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF15405 PH_5: Pleckstrin homology domain; PDB: 2Z0Q_A | Back alignment and domain information |
|---|
| >KOG2059|consensus | Back alignment and domain information |
|---|
| >cd01239 PH_PKD Protein kinase D (PKD/PKCmu) pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >KOG3551|consensus | Back alignment and domain information |
|---|
| >PF15404 PH_4: Pleckstrin homology domain | Back alignment and domain information |
|---|
| >PRK12495 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd01234 PH_CADPS CADPS (Ca2+-dependent activator protein) Pleckstrin homology (PH) domain | Back alignment and domain information |
|---|
| >PF00643 zf-B_box: B-box zinc finger; InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF01286 XPA_N: XPA protein N-terminal; InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer | Back alignment and domain information |
|---|
| >KOG3549|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 165 | ||||
| 3ihw_A | 184 | Crystal Structure Of The Ras-Like Domain Of Centg3 | 2e-15 | ||
| 3t9k_A | 390 | Crystal Structure Of Acap1 C-portion Mutant S554d F | 3e-15 | ||
| 3jue_A | 368 | Crystal Structure Of Arfgap And Ank Repeat Domain O | 4e-15 | ||
| 4f1p_A | 368 | Crystal Structure Of Mutant S554d For Arfgap And An | 4e-15 | ||
| 2iqj_A | 134 | Crystal Structure Of The Gap Domain Of Smap1l (Loc6 | 1e-14 | ||
| 2bmj_A | 178 | Gtpase Like Domain Of Centaurin Gamma 1 (Human) Len | 3e-14 | ||
| 2crr_A | 141 | Solution Structure Of Arfgap Domain From Human Smap | 6e-14 | ||
| 2iwr_A | 178 | Gtpase Like Domain Of Centaurin Gamma 1 (Human) Len | 2e-13 | ||
| 3lvq_E | 497 | The Crystal Structure Of Asap3 In Complex With Arf6 | 5e-13 | ||
| 2b0o_E | 301 | Crystal Structure Of Uplc1 Gap Domain Length = 301 | 1e-12 | ||
| 3sub_A | 163 | Crystal Structure Of The Catalytic Domain Of Plasmo | 3e-12 | ||
| 1dcq_A | 278 | Crystal Structure Of The Arf-Gap Domain And Ankyrin | 3e-12 | ||
| 2p57_A | 144 | Gap Domain Of Znf289, An Id1-Regulated Zinc Finger | 4e-12 | ||
| 3fm8_C | 392 | Crystal Structure Of Full Length Centaurin Alpha-1 | 6e-12 | ||
| 3feh_A | 386 | Crystal Structure Of Full Length Centaurin Alpha-1 | 6e-12 | ||
| 2crw_A | 149 | Solution Structure Of The Arfgap Domain Of Adp-Ribo | 1e-11 | ||
| 2owa_A | 138 | Crystal Structure Of Putative Gtpase Activating Pro | 1e-10 | ||
| 3o47_A | 329 | Crystal Structure Of Arfgap1-Arf1 Fusion Protein Le | 3e-09 | ||
| 3dwd_A | 147 | Crystal Structure Of The Arfgap Domain Of Human Arf | 7e-09 | ||
| 2rlo_A | 128 | Split Ph Domain Of Pi3-Kinase Enhancer Length = 128 | 1e-08 | ||
| 2olm_A | 140 | Arfgap Domain Of Hiv-1 Rev Binding Protein Length = | 5e-04 | ||
| 2d9l_A | 134 | Solution Structure Of The Arfgap Domain Of Human Ri | 8e-04 |
| >pdb|3IHW|A Chain A, Crystal Structure Of The Ras-Like Domain Of Centg3 Length = 184 | Back alignment and structure |
|
| >pdb|3T9K|A Chain A, Crystal Structure Of Acap1 C-portion Mutant S554d Fused With Integrin Beta1 Peptide Length = 390 | Back alignment and structure |
| >pdb|3JUE|A Chain A, Crystal Structure Of Arfgap And Ank Repeat Domain Of Acap1 Length = 368 | Back alignment and structure |
| >pdb|4F1P|A Chain A, Crystal Structure Of Mutant S554d For Arfgap And Ank Repeat Domain Of Acap1 Length = 368 | Back alignment and structure |
| >pdb|2IQJ|A Chain A, Crystal Structure Of The Gap Domain Of Smap1l (Loc64744) Stromal Membrane-Associated Protein 1-Like Length = 134 | Back alignment and structure |
| >pdb|2BMJ|A Chain A, Gtpase Like Domain Of Centaurin Gamma 1 (Human) Length = 178 | Back alignment and structure |
| >pdb|2CRR|A Chain A, Solution Structure Of Arfgap Domain From Human Smap1 Length = 141 | Back alignment and structure |
| >pdb|2IWR|A Chain A, Gtpase Like Domain Of Centaurin Gamma 1 (Human) Length = 178 | Back alignment and structure |
| >pdb|3LVQ|E Chain E, The Crystal Structure Of Asap3 In Complex With Arf6 In Trans State Length = 497 | Back alignment and structure |
| >pdb|2B0O|E Chain E, Crystal Structure Of Uplc1 Gap Domain Length = 301 | Back alignment and structure |
| >pdb|3SUB|A Chain A, Crystal Structure Of The Catalytic Domain Of Plasmodium Falciparum Arf Gtpase Activating Protein Length = 163 | Back alignment and structure |
| >pdb|1DCQ|A Chain A, Crystal Structure Of The Arf-Gap Domain And Ankyrin Repeats Of Papbeta Length = 278 | Back alignment and structure |
| >pdb|2P57|A Chain A, Gap Domain Of Znf289, An Id1-Regulated Zinc Finger Protein Length = 144 | Back alignment and structure |
| >pdb|3FM8|C Chain C, Crystal Structure Of Full Length Centaurin Alpha-1 Bound With The Fha Domain Of Kif13b (Capri Target) Length = 392 | Back alignment and structure |
| >pdb|3FEH|A Chain A, Crystal Structure Of Full Length Centaurin Alpha-1 Length = 386 | Back alignment and structure |
| >pdb|2CRW|A Chain A, Solution Structure Of The Arfgap Domain Of Adp-Ribosylation Factor Gtpaseactivating Protein 3 (Arfgap 3) Length = 149 | Back alignment and structure |
| >pdb|2OWA|A Chain A, Crystal Structure Of Putative Gtpase Activating Protein For Adp Ribosylation Factor From Cryptosporidium Parvum (Cgd5_1040) Length = 138 | Back alignment and structure |
| >pdb|3O47|A Chain A, Crystal Structure Of Arfgap1-Arf1 Fusion Protein Length = 329 | Back alignment and structure |
| >pdb|3DWD|A Chain A, Crystal Structure Of The Arfgap Domain Of Human Arfgap1 Length = 147 | Back alignment and structure |
| >pdb|2RLO|A Chain A, Split Ph Domain Of Pi3-Kinase Enhancer Length = 128 | Back alignment and structure |
| >pdb|2OLM|A Chain A, Arfgap Domain Of Hiv-1 Rev Binding Protein Length = 140 | Back alignment and structure |
| >pdb|2D9L|A Chain A, Solution Structure Of The Arfgap Domain Of Human Rip Length = 134 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 165 | |||
| 2crr_A | 141 | Stromal membrane-associated protein SMAP1B; arfgap | 8e-30 | |
| 2owa_A | 138 | Arfgap-like finger domain containing protein; zinc | 1e-29 | |
| 3sub_A | 163 | ADP-ribosylation factor GTPase-activating protein; | 2e-29 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 3e-29 | |
| 2iqj_A | 134 | Stromal membrane-associated protein 1-like; zinc, | 5e-29 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 1e-28 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 1e-28 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 8e-28 | |
| 3dwd_A | 147 | ADP-ribosylation factor GTPase-activating protein; | 1e-27 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 3e-26 | |
| 2olm_A | 140 | Nucleoporin-like protein RIP; arfgap, GTPase-activ | 2e-25 | |
| 2crw_A | 149 | ARF GAP 3, ADP-ribosylation factor GTPase-activati | 2e-24 | |
| 2p57_A | 144 | GTPase-activating protein ZNF289; zinc finger, GAP | 3e-24 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 6e-20 | |
| 3ihw_A | 184 | Centg3; RAS, centaurin, GTPase, structural genomic | 7e-13 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 1e-12 | |
| 2iwr_A | 178 | Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi | 2e-08 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 7e-05 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 7e-05 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 1e-04 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 3e-04 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 3e-04 | |
| 1v61_A | 132 | RAC/CDC42 guanine nucleotide exchange factor (GEF) | 3e-04 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 4e-04 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 7e-04 | |
| 2gf0_A | 199 | GTP-binding protein DI-RAS1; GDP/GTP binding, GTP | 7e-04 | |
| 2a9k_A | 187 | RAS-related protein RAL-A; bacterial ADP-ribosyltr | 8e-04 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 9e-04 |
| >2crr_A Stromal membrane-associated protein SMAP1B; arfgap domain, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
Score = 105 bits (263), Expect = 8e-30
Identities = 32/77 (41%), Positives = 46/77 (59%), Gaps = 1/77 (1%)
Query: 50 AAIQQQILSSLQTASLQSIRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLG 109
++ + Q L+ L + R N CADC GP WAS N+G+ +CI+C G+HR LG
Sbjct: 5 SSGKAQKLNEQHQLILSKLL-REEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLG 63
Query: 110 AHVSRVRSLELDEWPES 126
H+SRV+S+ LD+W
Sbjct: 64 VHISRVKSVNLDQWTAE 80
|
| >2owa_A Arfgap-like finger domain containing protein; zinc finger protein, cysteine-rich motif, GTPase activation; 2.00A {Cryptosporidium parvum iowa II} Length = 138 | Back alignment and structure |
|---|
| >3sub_A ADP-ribosylation factor GTPase-activating protein; protein trafficking, hydrolase AC; 2.40A {Plasmodium falciparum 3D7} Length = 163 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >2iqj_A Stromal membrane-associated protein 1-like; zinc, structural genomics, structural genomics consortium, SGC, protein transport; 1.90A {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 | Back alignment and structure |
|---|
| >3dwd_A ADP-ribosylation factor GTPase-activating protein; GAP, structural genomics consorti ER-golgi transport, golgi apparatus, GTPase activation; 2.40A {Homo sapiens} Length = 147 | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* Length = 386 | Back alignment and structure |
|---|
| >2olm_A Nucleoporin-like protein RIP; arfgap, GTPase-activating protein, REV-interacting protein, human immunodeficiency virus, AIDS, structural genomics; 1.48A {Homo sapiens} PDB: 2d9l_A Length = 140 | Back alignment and structure |
|---|
| >2crw_A ARF GAP 3, ADP-ribosylation factor GTPase-activating protein 3; arfgap domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 149 | Back alignment and structure |
|---|
| >2p57_A GTPase-activating protein ZNF289; zinc finger, GAP, structural genomics, structural genomics consortium, SGC, metal binding protein; 1.80A {Homo sapiens} Length = 144 | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Length = 329 | Back alignment and structure |
|---|
| >3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} Length = 184 | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} Length = 128 | Back alignment and structure |
|---|
| >2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Length = 178 | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A Length = 112 | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Length = 167 | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A Length = 103 | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 | Back alignment and structure |
|---|
| >1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 Length = 132 | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Length = 172 | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Length = 167 | Back alignment and structure |
|---|
| >2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Length = 199 | Back alignment and structure |
|---|
| >2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Length = 187 | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Length = 181 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 165 | |||
| 2iqj_A | 134 | Stromal membrane-associated protein 1-like; zinc, | 100.0 | |
| 2crr_A | 141 | Stromal membrane-associated protein SMAP1B; arfgap | 100.0 | |
| 3dwd_A | 147 | ADP-ribosylation factor GTPase-activating protein; | 100.0 | |
| 2owa_A | 138 | Arfgap-like finger domain containing protein; zinc | 100.0 | |
| 2crw_A | 149 | ARF GAP 3, ADP-ribosylation factor GTPase-activati | 100.0 | |
| 3sub_A | 163 | ADP-ribosylation factor GTPase-activating protein; | 100.0 | |
| 2olm_A | 140 | Nucleoporin-like protein RIP; arfgap, GTPase-activ | 100.0 | |
| 2p57_A | 144 | GTPase-activating protein ZNF289; zinc finger, GAP | 100.0 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.97 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 99.97 | |
| 3o47_A | 329 | ADP-ribosylation factor GTPase-activating protein | 99.96 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.96 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.96 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.95 | |
| 2da0_A | 114 | 130-kDa phosphatidylinositol 4,5-biphosphate- depe | 98.98 | |
| 2rlo_A | 128 | Centaurin-gamma 1; split PH domain, alternative sp | 98.98 | |
| 1wjm_A | 123 | Beta-spectrin III; PH domain, signal transduction, | 98.91 | |
| 2p0d_A | 129 | RHO GTPase-activating protein 9; protein-phosphoin | 98.86 | |
| 1btn_A | 106 | Beta-spectrin; signal transduction protein; HET: I | 98.85 | |
| 1dro_A | 122 | Beta-spectrin; cytoskeleton; NMR {Drosophila melan | 98.85 | |
| 2rsg_A | 94 | Collagen type IV alpha-3-binding protein; pleckstr | 98.83 | |
| 2d9x_A | 120 | Oxysterol binding protein-related protein 11; PH d | 98.82 | |
| 3rcp_A | 103 | Pleckstrin homology domain-containing family A ME; | 98.78 | |
| 1wg7_A | 150 | Dedicator of cytokinesis protein 9; pleckstrin hom | 98.77 | |
| 2dhk_A | 119 | TBC1 domain family member 2; PH domain, paris-1, s | 98.77 | |
| 2cof_A | 107 | Protein KIAA1914; PH domain, structural genomics, | 98.73 | |
| 2coc_A | 112 | FYVE, rhogef and PH domain containing protein 3; s | 98.69 | |
| 3aj4_A | 112 | Pleckstrin homology domain-containing family B ME; | 98.68 | |
| 1pls_A | 113 | Pleckstrin homology domain; phosphorylation; NMR { | 98.68 | |
| 2j59_M | 168 | RHO-GTPase activating protein 10; ARF, ARF1, ARFBD | 98.68 | |
| 1fao_A | 126 | Dual adaptor of phosphotyrosine and 3- phosphoinos | 98.67 | |
| 2cod_A | 115 | Centaurin-delta 1; ARF GAP and RHO GAP with ankyri | 98.67 | |
| 1v88_A | 130 | Oxysterol binding protein-related protein 8; vesic | 98.67 | |
| 1wgq_A | 109 | FYVE, rhogef and PH domain containing 6; ethanol d | 98.67 | |
| 2i5f_A | 109 | Pleckstrin; PH domain, protein-inositol phosphate | 98.66 | |
| 1x1f_A | 149 | Signal-transducing adaptor protein 1; docking prot | 98.65 | |
| 1unq_A | 125 | RAC-alpha serine/threonine kinase; transferase, pl | 98.63 | |
| 1x05_A | 129 | Pleckstrin; PH domain, structural genomics, NPPSFA | 98.62 | |
| 1wi1_A | 126 | Calcium-dependent activator protein for secretion, | 98.62 | |
| 2dkp_A | 128 | Pleckstrin homology domain-containing family A mem | 98.62 | |
| 3cxb_B | 112 | Pleckstrin homology domain-containing family M mem | 98.62 | |
| 1v89_A | 118 | Hypothetical protein KIAA0053; pleckstrin homology | 98.6 | |
| 2yry_A | 122 | Pleckstrin homology domain-containing family A mem | 98.6 | |
| 4h8s_A | 407 | DCC-interacting protein 13-beta; BAR domain, pleck | 98.6 | |
| 2d9y_A | 117 | Pleckstrin homology domain-containing protein fami | 98.6 | |
| 1v5p_A | 126 | Pleckstrin homology domain-containing, family A; T | 98.59 | |
| 1upq_A | 123 | PEPP1; PH domain, phosphoinositide binding, signal | 98.58 | |
| 2d9v_A | 130 | Pleckstrin homology domain-containing protein fami | 98.56 | |
| 1fgy_A | 127 | GRP1; PH domain, signaling protein; HET: 4IP; 1.50 | 98.56 | |
| 2q13_A | 385 | DCC-interacting protein 13 alpha; APPL1, BAR domai | 98.53 | |
| 2lul_A | 164 | Tyrosine-protein kinase TEC; structural genomics, | 98.53 | |
| 1x1g_A | 129 | Pleckstrin 2; PH domain, structural genomics, rike | 98.51 | |
| 3pp2_A | 124 | RHO GTPase-activating protein 27; PH domain, GTPas | 98.51 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 98.5 | |
| 3a8p_A | 263 | T-lymphoma invasion and metastasis-inducing protei | 98.49 | |
| 1u5f_A | 148 | SRC-associated adaptor protein; PH domain of SKAP- | 98.47 | |
| 1u5d_A | 108 | SKAP55, SRC kinase-associated phosphoprotein of 55 | 98.47 | |
| 1eaz_A | 125 | Tandem PH domain containing protein-1; lipid-bindi | 98.46 | |
| 2dn6_A | 115 | KIAA0640 protein; PH domain, structural genomics, | 98.44 | |
| 1v5u_A | 117 | SBF1, SET binding factor 1; MTMR5, the pleckstrin | 98.43 | |
| 1btk_A | 169 | Bruton'S tyrosine kinase; transferase, PH domain, | 98.43 | |
| 2w2x_D | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 98.42 | |
| 2y7b_A | 134 | Actin-binding protein anillin; cell cycle; 1.90A { | 98.41 | |
| 1qqg_A | 264 | IRS-1, insulin receptor substrate 1; beta-sandwhic | 98.25 | |
| 2r09_A | 347 | Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-ph | 98.22 | |
| 2dtc_A | 126 | RAL guanine nucleotide exchange factor ralgps1A; P | 98.18 | |
| 3mpx_A | 434 | FYVE, rhogef and PH domain-containing protein 5; s | 98.16 | |
| 1u5e_A | 211 | SRC-associated adaptor protein; novel dimerization | 98.13 | |
| 1dyn_A | 125 | Dynamin; signal transduction protein; 2.20A {Homo | 98.13 | |
| 4a6h_A | 120 | Phosphatidylinositol 4,5-bisphosphate-binding Pro | 98.08 | |
| 3lju_X | 386 | ARF-GAP with dual PH domain-containing protein 1; | 97.98 | |
| 3a8n_A | 279 | TIAM-1, T-lymphoma invasion and metastasis-inducin | 97.94 | |
| 2ys3_A | 137 | UNC-112-related protein 2; PH domain, kindlin-3, s | 97.88 | |
| 2rov_A | 117 | RHO-associated protein kinase 2; ATP-binding, coil | 97.75 | |
| 2fjl_A | 150 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 97.71 | |
| 3tca_A | 291 | Amyloid beta A4 precursor protein-binding family 1 | 97.64 | |
| 1v61_A | 132 | RAC/CDC42 guanine nucleotide exchange factor (GEF) | 97.63 | |
| 1zc3_B | 113 | Exocyst complex protein EXO84; exocytosis, small G | 97.62 | |
| 3tfm_A | 228 | Myosin X; split PH domain, motor protein; 2.53A {R | 97.52 | |
| 2d9w_A | 127 | Docking protein 2; PH domain, structural genomics, | 97.29 | |
| 3qwm_A | 140 | Iqsec1, IQ motif and SEC7 domain-containing protei | 97.25 | |
| 1w1g_A | 151 | HPDK1, 3-phosphoinositide dependent protein kinase | 97.18 | |
| 2vrw_B | 406 | P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP | 96.98 | |
| 1xcg_A | 368 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 96.81 | |
| 1z87_A | 263 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 96.42 | |
| 3ky9_A | 587 | Proto-oncogene VAV; calponin homology domain, DBL | 96.4 | |
| 1nty_A | 311 | Triple functional domain protein; DBL, pleckstrin, | 96.35 | |
| 1kz7_A | 353 | Guanine nucleotide exchange factor DBS; guanine nu | 96.25 | |
| 3t06_A | 418 | PDZ-rhogef, RHO guanine nucleotide exchange factor | 96.22 | |
| 1dbh_A | 354 | Protein (human SOS 1); guanine nucleotide exchange | 96.21 | |
| 1foe_A | 377 | T-lymphoma invasion and metastasis inducing protei | 96.04 | |
| 2adz_A | 178 | Alpha-1-syntrophin; protein binding; NMR {Mus musc | 96.04 | |
| 4f7h_A | 173 | Fermitin family homolog 2; beta-barrel, membrane b | 96.03 | |
| 2lg1_A | 185 | A-kinase anchor protein 13; metal binding protein; | 96.03 | |
| 2z0q_A | 346 | XPLN, RHO guanine nucleotide exchange factor 3; DH | 95.9 | |
| 4bbk_A | 165 | Kindlin-1, fermitin family homolog 1; PH domain, c | 95.87 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 95.78 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 95.73 | |
| 2rgn_B | 354 | RHOA/RAC/CDC42 exchange factor; heterotrimeric G-p | 95.72 | |
| 2dfk_A | 402 | Collybistin II; DH domain, PH domain, cell cycle; | 95.71 | |
| 3hk0_A | 256 | Growth factor receptor-bound protein 10; GRB10, RA | 95.63 | |
| 3p6a_A | 377 | RHO guanine nucleotide exchange factor 1; regulati | 95.4 | |
| 3ksy_A | 1049 | SOS-1, SON of sevenless homolog 1; RAS, RAS activa | 95.37 | |
| 2d9z_A | 129 | Protein kinase C, NU type; PH domain, structural g | 95.36 | |
| 2pz1_A | 466 | RHO guanine nucleotide exchange factor 4; helical | 95.36 | |
| 3odw_A | 536 | RHO guanine nucleotide exchange factor 1; regulati | 95.35 | |
| 1txd_A | 385 | RHO guanine nucleotide exchange factor 12; helical | 95.16 | |
| 1mai_A | 131 | Phospholipase C delta-1; pleckstrin, inositol tris | 95.07 | |
| 1v5m_A | 136 | SH2 and PH domain-containing adapter protein APS; | 94.95 | |
| 4gmv_A | 281 | RAS-associated and pleckstrin homology domains-CO | 94.8 | |
| 2coa_A | 125 | Protein kinase C, D2 type; protein kinase D2, PH d | 94.66 | |
| 1gnf_A | 46 | Transcription factor GATA-1; zinc finger, transcri | 89.69 | |
| 2vut_I | 43 | AREA, nitrogen regulatory protein AREA; transcript | 86.79 | |
| 3dfx_A | 63 | Trans-acting T-cell-specific transcription factor | 85.36 | |
| 1fho_A | 119 | UNC-89; pleckstrin homology domain, electrostatics | 83.56 | |
| 4gat_A | 66 | Nitrogen regulatory protein AREA; DNA binding prot | 83.12 | |
| 1u5k_A | 244 | Hypothetical protein; OBD-fold, Zn-binding, recomb | 81.14 | |
| 4hc9_A | 115 | Trans-acting T-cell-specific transcription factor; | 80.3 |
| >2iqj_A Stromal membrane-associated protein 1-like; zinc, structural genomics, structural genomics consortium, SGC, protein transport; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.1e-37 Score=233.41 Aligned_cols=94 Identities=36% Similarity=0.702 Sum_probs=89.2
Q ss_pred HHHHHHHHhhCCCCCCCCCCCCCCCCeeeecccceeeeccccccccCCCccceeeeccCCCCCCchHHHHHHHhhHHHHH
Q psy17773 62 TASLQSIRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEWPESNPRIIDEARARRLAS 141 (165)
Q Consensus 62 ~~~l~~l~~~~~~N~~CaDCg~~~p~w~s~n~Gv~lC~~Cs~iHR~lg~~is~VkSl~ld~w~~~~v~~~~~~~GN~~~n 141 (165)
+.+|+.|++ .|+|+.|||||+++|+|+|+|+|||+|++|||+||.||+|||+||||+||.|++++|+.| +.+||..+|
T Consensus 15 ~~~l~~L~~-~p~N~~CaDCg~~~P~WaS~n~GvfiC~~CsgiHR~lG~hiS~VkSl~ld~w~~~~l~~m-~~~GN~~an 92 (134)
T 2iqj_A 15 QAVLANLLL-EEDNKFCADCQSKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTQEQIQCM-QEMGNGKAN 92 (134)
T ss_dssp HHHHHHHTT-SGGGGBCTTTCCBSCCEEETTTTEEECHHHHHHHHHHCTTTCCEEETTTSCCCHHHHHHH-HTCHHHHHH
T ss_pred HHHHHHHHc-CcCCCcCCcCcCCCCCeEEecCCEEEhHhhhHHHhcCCCCCCceeeccccCCCHHHHHHH-HHHchHHHH
Confidence 567889998 999999999999999999999999999999999999999999999999999999999999 999999999
Q ss_pred HHhhhcCCCCCCCCCC
Q psy17773 142 DLKRCSYYETCATYGL 157 (165)
Q Consensus 142 ~~~e~~~~~~~~~~~~ 157 (165)
++||+++|+...+|..
T Consensus 93 ~~~e~~lp~~~~~P~~ 108 (134)
T 2iqj_A 93 RLYEAYLPETFRRPQI 108 (134)
T ss_dssp HHHTTTCCSSCCCCCS
T ss_pred HHHHhcCCccCCCCCc
Confidence 9999999998766643
|
| >2crr_A Stromal membrane-associated protein SMAP1B; arfgap domain, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3dwd_A ADP-ribosylation factor GTPase-activating protein; GAP, structural genomics consorti ER-golgi transport, golgi apparatus, GTPase activation; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2owa_A Arfgap-like finger domain containing protein; zinc finger protein, cysteine-rich motif, GTPase activation; 2.00A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2crw_A ARF GAP 3, ADP-ribosylation factor GTPase-activating protein 3; arfgap domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3sub_A ADP-ribosylation factor GTPase-activating protein; protein trafficking, hydrolase AC; 2.40A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >2olm_A Nucleoporin-like protein RIP; arfgap, GTPase-activating protein, REV-interacting protein, human immunodeficiency virus, AIDS, structural genomics; 1.48A {Homo sapiens} PDB: 2d9l_A | Back alignment and structure |
|---|
| >2p57_A GTPase-activating protein ZNF289; zinc finger, GAP, structural genomics, structural genomics consortium, SGC, metal binding protein; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* | Back alignment and structure |
|---|
| >2da0_A 130-kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rlo_A Centaurin-gamma 1; split PH domain, alternative splicing, ANK repeat, cytoplasm, GTP-binding, GTPase activation, metal-binding, nucleotide-binding; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wjm_A Beta-spectrin III; PH domain, signal transduction, structural genomics, spectrin beta chain, brain 2, KIAA0302; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2p0d_A RHO GTPase-activating protein 9; protein-phosphoinositide complex, pleckstrin homology domain, ligand binding protein; HET: I3P; 1.81A {Homo sapiens} PDB: 2p0f_A 2p0h_A* | Back alignment and structure |
|---|
| >1btn_A Beta-spectrin; signal transduction protein; HET: I3P; 2.00A {Mus musculus} SCOP: b.55.1.1 PDB: 1mph_A | Back alignment and structure |
|---|
| >1dro_A Beta-spectrin; cytoskeleton; NMR {Drosophila melanogaster} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2rsg_A Collagen type IV alpha-3-binding protein; pleckstrin homology, lipid transport; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9x_A Oxysterol binding protein-related protein 11; PH domain, OSBP-related protein 11, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3rcp_A Pleckstrin homology domain-containing family A ME; FAPP1, PH domain, lipid-binding, membrane, membrane protein; 1.90A {Homo sapiens} PDB: 2kcj_A | Back alignment and structure |
|---|
| >1wg7_A Dedicator of cytokinesis protein 9; pleckstrin homology domain, zizimin1, structural genomics, riken structural genomics/proteomics initiative; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dhk_A TBC1 domain family member 2; PH domain, paris-1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cof_A Protein KIAA1914; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2coc_A FYVE, rhogef and PH domain containing protein 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3aj4_A Pleckstrin homology domain-containing family B ME; antiparallel beta sheet, protein transport; HET: SEP EDO; 1.00A {Homo sapiens} PDB: 3via_A 2dhi_A | Back alignment and structure |
|---|
| >1pls_A Pleckstrin homology domain; phosphorylation; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2j59_M RHO-GTPase activating protein 10; ARF, ARF1, ARFBD, arhgap21, myristate, transport, nucleotide-binding, rhogap protein, hydrolase; HET: GTP; 2.1A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dhj_A | Back alignment and structure |
|---|
| >1fao_A Dual adaptor of phosphotyrosine and 3- phosphoinositides; pleckstrin, inositol tetrakisphosphate signal transduction protein, adaptor protein; HET: 4IP; 1.80A {Homo sapiens} SCOP: b.55.1.1 PDB: 1fb8_A | Back alignment and structure |
|---|
| >2cod_A Centaurin-delta 1; ARF GAP and RHO GAP with ankyrin repeat and PH domains (ARAP) 2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v88_A Oxysterol binding protein-related protein 8; vesicle transport, pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1wgq_A FYVE, rhogef and PH domain containing 6; ethanol decreased 4; pleckstrin homoloy domain, signal transduction, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2i5f_A Pleckstrin; PH domain, protein-inositol phosphate complex, lipid binding protein; HET: 5IP; 1.35A {Homo sapiens} SCOP: b.55.1.1 PDB: 2i5c_A* 1zm0_A | Back alignment and structure |
|---|
| >1x1f_A Signal-transducing adaptor protein 1; docking protein BRDG1, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1unq_A RAC-alpha serine/threonine kinase; transferase, pleckstrin homology domain, PKB, AKT, phosphoinositide, serine/threonine-protein kinase; HET: 4IP; 0.98A {Homo sapiens} SCOP: b.55.1.1 PDB: 1h10_A* 1unr_A 2uzs_A* 2uzr_A 2uvm_A* 1unp_A 2x18_A* 1p6s_A | Back alignment and structure |
|---|
| >1x05_A Pleckstrin; PH domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.55.1.1 PDB: 1xx0_A | Back alignment and structure |
|---|
| >1wi1_A Calcium-dependent activator protein for secretion, CAPS; PH domain, PIP2 binding site, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dkp_A Pleckstrin homology domain-containing family A member 5; PH domain, pleckstrin homology domain-containing protein family A member 5; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cxb_B Pleckstrin homology domain-containing family M member 2; SIFA, SKIP, complex, virulence, cytoplasm, membrane, polymorphism, signaling protein; 2.60A {Homo sapiens} PDB: 3hw2_B | Back alignment and structure |
|---|
| >1v89_A Hypothetical protein KIAA0053; pleckstrin homology domain, phosphatidylinositol binding, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2yry_A Pleckstrin homology domain-containing family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4h8s_A DCC-interacting protein 13-beta; BAR domain, pleckstrin homology domain, adaptor protein, RAB signaling protein; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2d9y_A Pleckstrin homology domain-containing protein family A member 6; PH domain, PEPP-3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v5p_A Pleckstrin homology domain-containing, family A; TAPP2, the pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1upq_A PEPP1; PH domain, phosphoinositide binding, signal transduction; 1.48A {Homo sapiens} SCOP: b.55.1.1 PDB: 1upr_A* | Back alignment and structure |
|---|
| >2d9v_A Pleckstrin homology domain-containing protein family B member 1; PH domain, phret1, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1fgy_A GRP1; PH domain, signaling protein; HET: 4IP; 1.50A {Mus musculus} SCOP: b.55.1.1 PDB: 1fgz_A 1u2b_A 1fhw_A* 1fhx_A* 1u29_A* 1u27_A* | Back alignment and structure |
|---|
| >2q13_A DCC-interacting protein 13 alpha; APPL1, BAR domain, PH domain, BAR-PH domain, protein transpo; 2.05A {Homo sapiens} PDB: 2z0o_A 2elb_A | Back alignment and structure |
|---|
| >2lul_A Tyrosine-protein kinase TEC; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x1g_A Pleckstrin 2; PH domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3pp2_A RHO GTPase-activating protein 27; PH domain, GTPase activator, pleckstrin homology domain, STR genomics consortium, SGC, hydrolase activator; HET: CIT; 1.42A {Homo sapiens} | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3a8p_A T-lymphoma invasion and metastasis-inducing protein 2; guanine nucleotide exchange factor, alternative splicing, cell projection, coiled coil; 2.10A {Mus musculus} PDB: 3a8q_A | Back alignment and structure |
|---|
| >1u5f_A SRC-associated adaptor protein; PH domain of SKAP-HOM, artefactual dimerization induced by V derived sequence, signaling protein; 1.90A {Mus musculus} SCOP: b.55.1.1 PDB: 1u5g_A | Back alignment and structure |
|---|
| >1u5d_A SKAP55, SRC kinase-associated phosphoprotein of 55 kDa; PH domain, signaling protein; 1.70A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1eaz_A Tandem PH domain containing protein-1; lipid-binding protein, lipid degradation, phosphatidylinositol (3, 4)-bisphosphate, signalling; HET: CIT; 1.40A {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >2dn6_A KIAA0640 protein; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v5u_A SBF1, SET binding factor 1; MTMR5, the pleckstrin homology domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1btk_A Bruton'S tyrosine kinase; transferase, PH domain, BTK motif, zinc binding, X-linked agammaglobulinemia, tyrosine-protein kinase; 1.60A {Homo sapiens} SCOP: b.55.1.1 PDB: 1b55_A* 2z0p_A* 1bwn_A* | Back alignment and structure |
|---|
| >2w2x_D 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma-2; hydrolase, phospholipase C, phosphoinositides, RHO gtpases, RAC, SH2 domain; HET: GSP; 2.30A {Homo sapiens} PDB: 2w2w_A* 2w2x_C* 2k2j_A | Back alignment and structure |
|---|
| >2y7b_A Actin-binding protein anillin; cell cycle; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1qqg_A IRS-1, insulin receptor substrate 1; beta-sandwhich, signal transduction; 2.30A {Homo sapiens} SCOP: b.55.1.2 b.55.1.2 PDB: 1irs_A* | Back alignment and structure |
|---|
| >2r09_A Cytohesin-3; autoinhibition, GRP1, PIP3, ARF, 3-phosphoinositide, pleckst homology domain, guanine-nucleotide releasing factor, signa protein; HET: 4IP PGE PE5; 1.90A {Mus musculus} SCOP: a.118.3.1 b.55.1.1 PDB: 2r0d_A* | Back alignment and structure |
|---|
| >2dtc_A RAL guanine nucleotide exchange factor ralgps1A; PH domain, protein binding, structural genomics, NPPSFA; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3mpx_A FYVE, rhogef and PH domain-containing protein 5; structural genomics consortium, DH domain, SGC, L binding protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1u5e_A SRC-associated adaptor protein; novel dimerization domain, PH domain, signaling protein; 2.60A {Mus musculus} SCOP: b.55.1.1 PDB: 2otx_A | Back alignment and structure |
|---|
| >1dyn_A Dynamin; signal transduction protein; 2.20A {Homo sapiens} SCOP: b.55.1.1 PDB: 2dyn_A 3zys_C 2ys1_A | Back alignment and structure |
|---|
| >4a6h_A Phosphatidylinositol 4,5-bisphosphate-binding Pro SLM1; signaling protein; HET: I4C; 1.45A {Saccharomyces cerevisiae} PDB: 3nsu_A* 4a6f_A* 4a6k_A* 4a6f_B* 4a5k_A | Back alignment and structure |
|---|
| >3lju_X ARF-GAP with dual PH domain-containing protein 1; structural genomics consortium, GTPase activation, SGC, binding, nucleus, phosphoprotein; HET: IP9; 1.70A {Homo sapiens} PDB: 3feh_A* 3fm8_C 3mdb_C* | Back alignment and structure |
|---|
| >3a8n_A TIAM-1, T-lymphoma invasion and metastasis-inducing protein 1; guanine nucleotide exchange factor, guanine-nucleotide releasing factor, lipoprotein; 4.50A {Mus musculus} | Back alignment and structure |
|---|
| >2ys3_A UNC-112-related protein 2; PH domain, kindlin-3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rov_A RHO-associated protein kinase 2; ATP-binding, coiled coil, cytoplasm, membrane, metal-binding, nucleotide-binding, phorbol-ester binding; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2fjl_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; beta-barrel, hydrolase; NMR {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >3tca_A Amyloid beta A4 precursor protein-binding family 1-interacting protein; RA domain, RBD, PH domain; 2.35A {Mus musculus} | Back alignment and structure |
|---|
| >1v61_A RAC/CDC42 guanine nucleotide exchange factor (GEF) 6; pleckstrin homology domain, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1zc3_B Exocyst complex protein EXO84; exocytosis, small GTPase, GTP-binding protein,, signaling protein; HET: GNP; 2.00A {Rattus norvegicus} SCOP: b.55.1.1 PDB: 1zc4_B* | Back alignment and structure |
|---|
| >3tfm_A Myosin X; split PH domain, motor protein; 2.53A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2d9w_A Docking protein 2; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qwm_A Iqsec1, IQ motif and SEC7 domain-containing protein 1; structural genomics, structural genomics consortium, SGC; 2.39A {Homo sapiens} | Back alignment and structure |
|---|
| >1w1g_A HPDK1, 3-phosphoinositide dependent protein kinase-1; transferase, PKB, pleckstrin homology domain, inositol phosphate, signal transduction; HET: 4PT; 1.45A {Homo sapiens} SCOP: b.55.1.1 PDB: 1w1d_A* 1w1h_A 2vki_A | Back alignment and structure |
|---|
| >2vrw_B P95VAV, VAV1, proto-oncogene VAV; lipoprotein, GTP-binding, metal-binding, phosphoprotein, exchange factor, RAC, GTPase, membrane domain; 1.85A {Mus musculus} PDB: 3bji_A 1f5x_A | Back alignment and structure |
|---|
| >1xcg_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; X-RAY crystallography, regulation of RHOA GTPase, protein complex; 2.50A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 3kz1_A* | Back alignment and structure |
|---|
| >1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3ky9_A Proto-oncogene VAV; calponin homology domain, DBL homology domain, pleckst homology domain, C1 domain, guanine-nucleotide releasing FA metal-binding; 2.73A {Homo sapiens} PDB: 2d86_A | Back alignment and structure |
|---|
| >1nty_A Triple functional domain protein; DBL, pleckstrin, GEF, RHO, GTPase, guanine-nucleotide releas factor, phosphorylation, signaling protein; 1.70A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 2nz8_B 2kr9_A | Back alignment and structure |
|---|
| >1kz7_A Guanine nucleotide exchange factor DBS; guanine nucleotide exchange factor (GEF), small G-protein, signaling protein; 2.40A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 PDB: 1lb1_A 1kzg_A 1rj2_A | Back alignment and structure |
|---|
| >3t06_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; DH-PH RHOA complex, pdzrhogef, guanine nucleotide exchange F RHOA, signaling protein; 2.84A {Homo sapiens} | Back alignment and structure |
|---|
| >1dbh_A Protein (human SOS 1); guanine nucleotide exchange factor, gene regulation; 2.30A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1pms_A 1awe_A | Back alignment and structure |
|---|
| >1foe_A T-lymphoma invasion and metastasis inducing protein 1; DBL homology domain, pleckstrin homology domain, GTPase, guanine nucleotide exchange factor; 2.80A {Mus musculus} SCOP: a.87.1.1 b.55.1.1 | Back alignment and structure |
|---|
| >2adz_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >4f7h_A Fermitin family homolog 2; beta-barrel, membrane binding, integrin activation, cytoplas membrane, cell adhesion; HET: SRT; 1.90A {Homo sapiens} PDB: 2lko_A* | Back alignment and structure |
|---|
| >2lg1_A A-kinase anchor protein 13; metal binding protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2z0q_A XPLN, RHO guanine nucleotide exchange factor 3; DH-PH domain, alternative splicing, cytoplasm, guanine- nucleotide releasing factor; 1.79A {Mus musculus} PDB: 3eo2_A | Back alignment and structure |
|---|
| >4bbk_A Kindlin-1, fermitin family homolog 1; PH domain, cell adhesion; 2.10A {Mus musculus} | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >2rgn_B RHOA/RAC/CDC42 exchange factor; heterotrimeric G-protein, small molecular weight G-protein, complex, protein-protein complex, rhogef, galphaq; HET: GDP; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2dfk_A Collybistin II; DH domain, PH domain, cell cycle; 2.15A {Rattus norvegicus} SCOP: a.87.1.1 b.55.1.1 | Back alignment and structure |
|---|
| >3hk0_A Growth factor receptor-bound protein 10; GRB10, RA, PH, RAS-associating, pleckstrin-homology, adapter phosphoprotein, SH2 domain; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3p6a_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 2.50A {Homo sapiens} PDB: 3odo_A | Back alignment and structure |
|---|
| >3ksy_A SOS-1, SON of sevenless homolog 1; RAS, RAS activator, disease mutation, guanine-nucleotide releasing factor, signaling protein; 3.18A {Homo sapiens} PDB: 1xd4_A 1xdv_A 1q9c_A | Back alignment and structure |
|---|
| >2d9z_A Protein kinase C, NU type; PH domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D | Back alignment and structure |
|---|
| >3odw_A RHO guanine nucleotide exchange factor 1; regulation of RHOA GTPase, rhogef, DH, PH, signaling PR; 3.20A {Homo sapiens} PDB: 3odx_A | Back alignment and structure |
|---|
| >1txd_A RHO guanine nucleotide exchange factor 12; helical bundle (DH), beta sandwich (PH), signaling protein; 2.13A {Homo sapiens} SCOP: a.87.1.1 b.55.1.1 PDB: 1x86_A | Back alignment and structure |
|---|
| >1mai_A Phospholipase C delta-1; pleckstrin, inositol trisphosphate, signal transduction protein, hydrolase; HET: I3P; 1.90A {Rattus norvegicus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1v5m_A SH2 and PH domain-containing adapter protein APS; adaptor protein, pleckstrin homology domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >4gmv_A RAS-associated and pleckstrin homology domains-CO protein 1; RA-PH, coiled-coil region, RAS-association domain, pleckstri homology domain; 2.40A {Homo sapiens} PDB: 4gn1_A | Back alignment and structure |
|---|
| >2coa_A Protein kinase C, D2 type; protein kinase D2, PH domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >1gnf_A Transcription factor GATA-1; zinc finger, transcription regulation; NMR {Mus musculus} SCOP: g.39.1.1 PDB: 1y0j_A 2l6y_A 2l6z_A | Back alignment and structure |
|---|
| >2vut_I AREA, nitrogen regulatory protein AREA; transcription regulation, protein-protein interactions, metal-binding, nitrate assimilation; HET: NAD; 2.3A {Emericella nidulans} SCOP: g.39.1.1 PDB: 2vus_I* 2vuu_I* | Back alignment and structure |
|---|
| >3dfx_A Trans-acting T-cell-specific transcription factor GATA-3; activator, DNA-binding, metal-binding, nucleus; HET: DNA; 2.70A {Mus musculus} PDB: 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* | Back alignment and structure |
|---|
| >1fho_A UNC-89; pleckstrin homology domain, electrostatics, muscle, signal transduction, signaling protein; NMR {Caenorhabditis elegans} SCOP: b.55.1.1 | Back alignment and structure |
|---|
| >4gat_A Nitrogen regulatory protein AREA; DNA binding protein, transcription factor, zinc binding domain, complex (transcription regulation/DNA); HET: DNA; NMR {Emericella nidulans} SCOP: g.39.1.1 PDB: 5gat_A* 6gat_A* 7gat_A* | Back alignment and structure |
|---|
| >1u5k_A Hypothetical protein; OBD-fold, Zn-binding, recombination,replication; 2.00A {Deinococcus radiodurans} SCOP: b.40.4.13 g.45.1.2 PDB: 1w3s_A 2v1c_C | Back alignment and structure |
|---|
| >4hc9_A Trans-acting T-cell-specific transcription factor; zinc finger, GATA transcription factor, DNA bridging, transc DNA complex; HET: DNA; 1.60A {Homo sapiens} PDB: 4hc7_A* 4hca_A* 3dfx_A* 3dfv_D* 2gat_A* 3gat_A* 1gat_A* 1gau_A* 1gnf_A 1y0j_A 2l6y_A 2l6z_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 165 | ||||
| d1dcqa2 | 122 | g.45.1.1 (A:247-368) Pyk2-associated protein beta | 1e-21 | |
| d2bmja1 | 175 | c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {H | 1e-05 | |
| d2atxa1 | 185 | c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [Tax | 2e-04 | |
| d1wmsa_ | 174 | c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: | 5e-04 | |
| d1u5da1 | 106 | b.55.1.1 (A:108-213) Src kinase-associated phospho | 7e-04 | |
| d1faoa_ | 100 | b.55.1.1 (A:) Dual adaptor of phosphotyrosine and | 9e-04 | |
| d1v61a_ | 132 | b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (M | 0.001 | |
| d1x1ga1 | 116 | b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapie | 0.001 | |
| d1kmqa_ | 177 | c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9 | 0.001 | |
| d1mh1a_ | 183 | c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 96 | 0.001 | |
| d1svsa1 | 195 | c.37.1.8 (A:32-60,A:182-347) Transducin (alpha sub | 0.002 | |
| d1eaza_ | 103 | b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: | 0.002 | |
| d1u5ea1 | 209 | b.55.1.1 (A:14-222) Src-associated adaptor protein | 0.002 | |
| d1fgya_ | 127 | b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 1 | 0.002 | |
| d1upqa_ | 107 | b.55.1.1 (A:) Phosphoinositol 3-phosphate binding | 0.003 | |
| d1v5ma_ | 136 | b.55.1.1 (A:) SH2 and PH domain-containing adapter | 0.004 | |
| d2j59m1 | 133 | b.55.1.1 (M:931-1063) Rho GTPase-activating protei | 0.004 |
| >d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 | Back information, alignment and structure |
|---|
class: Small proteins fold: ArfGap/RecO-like zinc finger superfamily: ArfGap/RecO-like zinc finger family: Pyk2-associated protein beta ARF-GAP domain domain: Pyk2-associated protein beta ARF-GAP domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 82.4 bits (203), Expect = 1e-21
Identities = 33/75 (44%), Positives = 44/75 (58%), Gaps = 9/75 (12%)
Query: 52 IQQQILSSLQTASLQSIRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAH 111
+ ++I+S +Q R+ GN C DC PTW S NLG+L CI+C G+HR LG H
Sbjct: 1 LTKEIISEVQ---------RMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVH 51
Query: 112 VSRVRSLELDEWPES 126
SR++SL LD S
Sbjct: 52 YSRMQSLTLDVLGTS 66
|
| >d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Length = 175 | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Length = 185 | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Length = 174 | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} Length = 132 | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Length = 177 | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Length = 183 | Back information, alignment and structure |
|---|
| >d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 195 | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 209 | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 165 | |||
| d1dcqa2 | 122 | Pyk2-associated protein beta ARF-GAP domain {Mouse | 100.0 | |
| d1faoa_ | 100 | Dual adaptor of phosphotyrosine and 3-phosphoinosi | 98.92 | |
| d1qqga1 | 103 | Insulin receptor substrate 1, IRS-1 {Human (Homo s | 98.77 | |
| d2j59m1 | 133 | Rho GTPase-activating protein 21 {Human (Homo sapi | 98.69 | |
| d2cofa1 | 95 | KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | 98.67 | |
| d2coda1 | 102 | Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 96 | 98.64 | |
| d2coca1 | 99 | FYVE, RhoGEF and PH domain containing protein 3, F | 98.62 | |
| d1omwa2 | 119 | G-protein coupled receptor kinase 2 (beta-adrenerg | 98.59 | |
| d1v5ma_ | 136 | SH2 and PH domain-containing adapter protein APS { | 98.58 | |
| d1u5fa1 | 111 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 98.56 | |
| d2fjla1 | 101 | Phosphoinositide phospholipase C, PLC-gamma-1 {Rat | 98.56 | |
| d1btka_ | 169 | Bruton's tyrosine kinase {Human (Homo sapiens) [Ta | 98.54 | |
| d1wg7a_ | 150 | Dedicator of cytokinesis protein 9, DOCK9 {Human ( | 98.53 | |
| d1x1fa1 | 136 | Signal-transducing adaptor protein 1, STAP-1 {Huma | 98.52 | |
| d1u5da1 | 106 | Src kinase-associated phosphoprotein SKAP55 (SCAP1 | 98.52 | |
| d2elba2 | 101 | DCC-interacting protein 13-alpha, APPL1 {Human (Ho | 98.51 | |
| d1btna_ | 106 | beta-spectrin {Mouse (Mus musculus), brain [TaxId: | 98.51 | |
| d1u5ea1 | 209 | Src-associated adaptor protein Skap2 {Mouse (Mus m | 98.46 | |
| d1wjma_ | 123 | beta-spectrin {Human (Homo sapiens), brain 2 isofo | 98.37 | |
| d1wgqa_ | 109 | FYVE, RhoGEF and PH domain containing protein 6, F | 98.37 | |
| d1droa_ | 122 | beta-spectrin {Fruit fly (Drosophila melanogaster) | 98.36 | |
| d1eaza_ | 103 | Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | 98.35 | |
| d1w1ha_ | 147 | 3-phosphoinositide dependent protein kinase-1 {Hum | 98.34 | |
| d1plsa_ | 113 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 98.34 | |
| d2dyna_ | 111 | Dynamin {Human (Homo sapiens) [TaxId: 9606]} | 98.32 | |
| d1wi1a_ | 126 | Calcium-dependent activator protein for secretion, | 98.32 | |
| d1v89a_ | 118 | Rho-GTPase-activating protein 25 (KIAA0053) {Human | 98.3 | |
| d2i5fa1 | 104 | Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | 98.29 | |
| d1v5pa_ | 126 | Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | 98.29 | |
| d1upqa_ | 107 | Phosphoinositol 3-phosphate binding protein-1, PEP | 98.24 | |
| d1zc3b1 | 109 | Exocyst complex protein EXO84 {Rat (Rattus norvegi | 98.23 | |
| d2coaa1 | 112 | Protein kinase c, d2 type {Human (Homo sapiens) [T | 98.22 | |
| d1v88a_ | 130 | Oxysterol binding protein-related protein 8 (ORP-8 | 98.21 | |
| d1x1ga1 | 116 | Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | 98.18 | |
| d1v5ua_ | 117 | SET binding factor 1, Sbf1 {Mouse (Mus musculus) [ | 98.14 | |
| d1v61a_ | 132 | Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [ | 98.11 | |
| d1unqa_ | 118 | Rac-alpha serine/threonine kinase {Human (Homo sap | 97.86 | |
| d1xcga2 | 140 | Rho guanine nucleotide exchange factor 11, PDZ-Rho | 97.77 | |
| d1dbha2 | 133 | Son of sevenless-1 (sos-1) {Human (Homo sapiens) [ | 97.72 | |
| d1ki1b2 | 142 | GEF of intersectin {Human (Homo sapiens) [TaxId: 9 | 97.64 | |
| d1fgya_ | 127 | Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | 97.62 | |
| d1ntya2 | 121 | Triple functional domain protein TRIO {Human (Homo | 97.34 | |
| d1txda2 | 114 | Rho guanine nucleotide exchange factor 12 {Human ( | 97.28 | |
| d2dfka2 | 162 | Rho guanine nucleotide exchange factor 9, Collybis | 97.26 | |
| d1kz7a2 | 147 | Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId | 96.93 | |
| d1maia_ | 119 | Phospholipase C delta-1 {Rat (Rattus norvegicus) [ | 96.91 | |
| d2adza1 | 105 | Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 1 | 95.85 | |
| d1fhoa_ | 119 | UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: | 94.33 | |
| d1zbdb_ | 124 | Effector domain of rabphilin-3a {Rat (Rattus norve | 93.58 | |
| d1u5ka2 | 157 | Recombinational repair protein RecO, C-terminal do | 92.67 | |
| d1y0ja1 | 39 | Erythroid transcription factor GATA-1 {Mouse (Mus | 90.54 | |
| d2zkmx3 | 131 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 87.92 | |
| d1d4ua2 | 36 | DNA repair factor XPA DNA- and RPA-binding domain, | 85.63 | |
| d1pfta_ | 50 | Transcription initiation factor TFIIB, N-terminal | 80.16 |
| >d1dcqa2 g.45.1.1 (A:247-368) Pyk2-associated protein beta ARF-GAP domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Small proteins fold: ArfGap/RecO-like zinc finger superfamily: ArfGap/RecO-like zinc finger family: Pyk2-associated protein beta ARF-GAP domain domain: Pyk2-associated protein beta ARF-GAP domain species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00 E-value=2.3e-38 Score=232.09 Aligned_cols=99 Identities=31% Similarity=0.584 Sum_probs=91.2
Q ss_pred HHHHHHHHhhCCCCCCCCCCCCCCCCeeeecccceeeeccccccccCCCccceeeeccCCCCCCchHHHHHHHhhHHHHH
Q psy17773 62 TASLQSIRSRVPGNLTCADCAEAGPTWASLNLGLLLCIQCCGVHRCLGAHVSRVRSLELDEWPESNPRIIDEARARRLAS 141 (165)
Q Consensus 62 ~~~l~~l~~~~~~N~~CaDCg~~~p~w~s~n~Gv~lC~~Cs~iHR~lg~~is~VkSl~ld~w~~~~v~~~~~~~GN~~~n 141 (165)
+++|+.|++ .|||+.|||||+++|+|+|+|||||+|++|||+||.||+|||+|||++||.|++++|++| +.+||..+|
T Consensus 3 ~~~l~~l~~-~p~N~~CaDC~~~~p~w~s~n~GvfvC~~CsgiHR~lg~~is~VkS~~ld~w~~~~i~~~-~~~GN~~~n 80 (122)
T d1dcqa2 3 KEIISEVQR-MTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDVLGTSELLLA-KNIGNAGFN 80 (122)
T ss_dssp HHHHHHHHH-STTTTBCTTTCCBSCCEEETTTTEEECHHHHHHHHHHCTTTCCEEETTTSCCCGGGGHHH-HHSCHHHHH
T ss_pred HHHHHHHHh-CCCCCccCCCCCCCCCeEEecCCEEEchhhhHHHhcCCCCceEeeecccCCCCHHHHHHH-HHHhHHHHH
Confidence 467899999 999999999999999999999999999999999999999999999999999999999999 999999999
Q ss_pred HHhhhcCCCCC-CCCCCCCCcc
Q psy17773 142 DLKRCSYYETC-ATYGLNVDRV 162 (165)
Q Consensus 142 ~~~e~~~~~~~-~~~~~~~~~~ 162 (165)
++||+++|+.. .+|....+..
T Consensus 81 ~~~ea~~~~~~~~kp~~~~~~~ 102 (122)
T d1dcqa2 81 EIMECCLPSEDPVKPNPGSDMI 102 (122)
T ss_dssp HHHTTTCCSSSCCSCCTTCCHH
T ss_pred HHHHhhCCcccCcCCCCCccHH
Confidence 99999998753 5666665543
|
| >d1faoa_ b.55.1.1 (A:) Dual adaptor of phosphotyrosine and 3-phosphoinositides DAPP1/PHISH {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qqga1 b.55.1.2 (A:12-114) Insulin receptor substrate 1, IRS-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j59m1 b.55.1.1 (M:931-1063) Rho GTPase-activating protein 21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cofa1 b.55.1.1 (A:8-102) KIAA1914 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coda1 b.55.1.1 (A:8-109) Centaurin-delta 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2coca1 b.55.1.1 (A:8-106) FYVE, RhoGEF and PH domain containing protein 3, FGD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1omwa2 b.55.1.1 (A:550-668) G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1v5ma_ b.55.1.1 (A:) SH2 and PH domain-containing adapter protein APS {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u5fa1 b.55.1.1 (A:109-219) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2fjla1 b.55.1.1 (A:1-37,A:87-150) Phosphoinositide phospholipase C, PLC-gamma-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1btka_ b.55.1.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wg7a_ b.55.1.1 (A:) Dedicator of cytokinesis protein 9, DOCK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1fa1 b.55.1.1 (A:8-143) Signal-transducing adaptor protein 1, STAP-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5da1 b.55.1.1 (A:108-213) Src kinase-associated phosphoprotein SKAP55 (SCAP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2elba2 b.55.1.1 (A:274-374) DCC-interacting protein 13-alpha, APPL1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1btna_ b.55.1.1 (A:) beta-spectrin {Mouse (Mus musculus), brain [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1u5ea1 b.55.1.1 (A:14-222) Src-associated adaptor protein Skap2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wjma_ b.55.1.1 (A:) beta-spectrin {Human (Homo sapiens), brain 2 isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgqa_ b.55.1.1 (A:) FYVE, RhoGEF and PH domain containing protein 6, Fgd6 (KIAA1362) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1droa_ b.55.1.1 (A:) beta-spectrin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1eaza_ b.55.1.1 (A:) Tapp1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w1ha_ b.55.1.1 (A:) 3-phosphoinositide dependent protein kinase-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1plsa_ b.55.1.1 (A:) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dyna_ b.55.1.1 (A:) Dynamin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi1a_ b.55.1.1 (A:) Calcium-dependent activator protein for secretion, CAPS {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v89a_ b.55.1.1 (A:) Rho-GTPase-activating protein 25 (KIAA0053) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2i5fa1 b.55.1.1 (A:244-347) Pleckstrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5pa_ b.55.1.1 (A:) Tapp2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1upqa_ b.55.1.1 (A:) Phosphoinositol 3-phosphate binding protein-1, PEPP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zc3b1 b.55.1.1 (B:171-279) Exocyst complex protein EXO84 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2coaa1 b.55.1.1 (A:8-119) Protein kinase c, d2 type {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v88a_ b.55.1.1 (A:) Oxysterol binding protein-related protein 8 (ORP-8, KIAA1451) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x1ga1 b.55.1.1 (A:8-123) Pleckstrin-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ua_ b.55.1.1 (A:) SET binding factor 1, Sbf1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v61a_ b.55.1.1 (A:) Rac/CDC42 GEF 6, alpha-pix {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1unqa_ b.55.1.1 (A:) Rac-alpha serine/threonine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xcga2 b.55.1.1 (A:942-1081) Rho guanine nucleotide exchange factor 11, PDZ-RhoGEF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dbha2 b.55.1.1 (A:418-550) Son of sevenless-1 (sos-1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ki1b2 b.55.1.1 (B:1439-1580) GEF of intersectin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fgya_ b.55.1.1 (A:) Grp1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ntya2 b.55.1.1 (A:1415-1535) Triple functional domain protein TRIO {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1txda2 b.55.1.1 (A:1020-1133) Rho guanine nucleotide exchange factor 12 {Human (Homo sapiens), gamma isoform [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dfka2 b.55.1.1 (A:240-401) Rho guanine nucleotide exchange factor 9, Collybistin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1kz7a2 b.55.1.1 (A:819-965) Dbl's big sister, Dbs {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1maia_ b.55.1.1 (A:) Phospholipase C delta-1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2adza1 b.55.1.1 (A:1-43,A:117-178) Alpha-1-syntrophin {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1fhoa_ b.55.1.1 (A:) UNC-89 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1u5ka2 g.45.1.2 (A:81-237) Recombinational repair protein RecO, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1y0ja1 g.39.1.1 (A:200-238) Erythroid transcription factor GATA-1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2zkmx3 b.55.1.1 (X:11-141) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d4ua2 g.39.1.5 (A:1-36) DNA repair factor XPA DNA- and RPA-binding domain, N-terminal subdomain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pfta_ g.41.3.1 (A:) Transcription initiation factor TFIIB, N-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|