Psyllid ID: psy17779


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-
MCGLPLGGSLDPYWSNLALEYFKSHEQSMKAKNQRPKKFNCPHCNVAFSNNGQLKGHIRIHTGERPYKCDAENCGKSFTRNEELTRHKRIHSGLRPYPCTHCGKKFGRKDHLKKHLRTHFPQPRYVSCYPYMYGGYTSVIL
cccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccc
ccccEEccccccccccHHcHHHHHHHHHHHHHccccccEEccccccEEccHHHHHHHHHHccccccEEccccccccEEccHHHHHHHcHHHHccccEEccccccEEccHHHHHHHHHccHccccEcccccccccccccccc
mcglplggsldpywSNLALEYFKSHEQSMkaknqrpkkfncphcnvafsnngqlkghirihtgerpykcdaencgksftrneeltrhkrihsglrpypcthcgkkfgrkdhLKKHlrthfpqpryvscypymyggytsvil
mcglplggsldpYWSNLALEYFKSHEQSMKAKNQRPKKFNCPHCNVAFSNNGQLKGHIRIHTgerpykcdaencgksftrneeltrhkrihsglrpypcthcGKKFGRKDHLKKHlrthfpqpryvscypyMYGGYTSVIL
MCGLPLGGSLDPYWSNLALEYFKSHEQSMKAKNQRPKKFNCPHCNVAFSNNGQLKGHIRIHTGERPYKCDAENCGKSFTRNEELTRHKRIHSGLRPYPCTHCGKKFGRKDHLKKHLRTHFPQPRYVSCYPYMYGGYTSVIL
*******GSLDPYWSNLALEYF****************FNCPHCNVAFSNNGQLKGHIRIHTGERPYKCDAENCGKSFTRNEELTRHKRIHSGLRPYPCTHCGKKFGRKDHLKKHLRTHFPQPRYVSCYPYMYGGYTSVI*
*CGLPLGGSLDPYWSNLALEYFKSHEQSMKAKNQRPKKFNCPHCNVAFSNNGQLKGHIRIHTGERPYKCDAENCGKSFTRNEELTRHKRIHSGLRPYPCTHCGKKFGRKDHLKKHLRTHFPQPRYVSCYPYMYGGYTSVIL
MCGLPLGGSLDPYWSNLALEYFKSH***********KKFNCPHCNVAFSNNGQLKGHIRIHTGERPYKCDAENCGKSFTRNEELTRHKRIHSGLRPYPCTHCGKKFGRKDHLKKHLRTHFPQPRYVSCYPYMYGGYTSVIL
*CGLPLGGSLDPYWSNLALEYFKSHEQSMKAKNQRPKKFNCPHCNVAFSNNGQLKGHIRIHTGERPYKCDAENCGKSFTRNEELTRHKRIHSGLRPYPCTHCGKKFGRKDHLKKHLRTHFPQPRYVSCYPYMYG*******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCGLPLGGSLDPYWSNLALEYFKSHEQSMKAKNQRPKKFNCPHCNVAFSNNGQLKGHIRIHTGERPYKCDAENCGKSFTRNEELTRHKRIHSGLRPYPCTHCGKKFGRKDHLKKHLRTHFPQPRYVSCYPYMYGGYTSVIL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query141 2.2.26 [Sep-21-2011]
O89090784 Transcription factor Sp1 no N/A 0.425 0.076 0.486 4e-20
Q5E9U0613 Transcription factor Sp2 no N/A 0.645 0.148 0.451 8e-20
Q9D2H6612 Transcription factor Sp2 no N/A 0.645 0.148 0.451 1e-19
Q02086613 Transcription factor Sp2 no N/A 0.645 0.148 0.451 1e-19
Q9UDV7671 Zinc finger protein 282 O no N/A 0.659 0.138 0.453 2e-19
A0MS83 808 Zinc finger protein 148 O no N/A 0.758 0.132 0.394 4e-19
Q96BV0 537 Zinc finger protein 775 O yes N/A 0.645 0.169 0.494 4e-19
P18714 675 Gastrula zinc finger prot N/A N/A 0.602 0.125 0.511 4e-19
Q8BI73 538 Zinc finger protein 775 O no N/A 0.808 0.211 0.408 7e-19
Q9EPW2415 Krueppel-like factor 15 O no N/A 0.574 0.195 0.487 1e-18
>sp|O89090|SP1_MOUSE Transcription factor Sp1 OS=Mus musculus GN=Sp1 PE=1 SV=2 Back     alignment and function desciption
 Score = 96.7 bits (239), Expect = 4e-20,   Method: Composition-based stats.
 Identities = 37/76 (48%), Positives = 50/76 (65%)

Query: 44  CNVAFSNNGQLKGHIRIHTGERPYKCDAENCGKSFTRNEELTRHKRIHSGLRPYPCTHCG 103
           C   +     L+ H+R HTGERP+ C+   CGK FTR++EL RHKR H+G + + C  C 
Sbjct: 634 CGKVYGKTSHLRAHLRWHTGERPFMCNWSYCGKRFTRSDELQRHKRTHTGEKKFACPECP 693

Query: 104 KKFGRKDHLKKHLRTH 119
           K+F R DHL KH++TH
Sbjct: 694 KRFMRSDHLSKHIKTH 709




Transcription factor that can activate or repress transcription in response to physiological and pathological stimuli. Binds with high affinity to GC-rich motifs and regulates the expression of a large number of genes involved in a variety of processes such as cell growth, apoptosis, differentiation and immune responses. Highly regulated by post-translational modifications (phosphorylations, sumoylation, proteolytic cleavage, glycosylation and acetylation). Binds also the PDGFR-alpha G-box promoter. May have a role in modulating the cellular response to DNA damage. Implicated in chromatin remodeling. Plays a role in the recruitment of SMARCA4/BRG1 on the c-FOS promoter Plays an essential role in the regulation of FE65 gene expression.
Mus musculus (taxid: 10090)
>sp|Q5E9U0|SP2_BOVIN Transcription factor Sp2 OS=Bos taurus GN=SP2 PE=2 SV=1 Back     alignment and function description
>sp|Q9D2H6|SP2_MOUSE Transcription factor Sp2 OS=Mus musculus GN=Sp2 PE=2 SV=2 Back     alignment and function description
>sp|Q02086|SP2_HUMAN Transcription factor Sp2 OS=Homo sapiens GN=SP2 PE=1 SV=3 Back     alignment and function description
>sp|Q9UDV7|ZN282_HUMAN Zinc finger protein 282 OS=Homo sapiens GN=ZNF282 PE=2 SV=3 Back     alignment and function description
>sp|A0MS83|ZN148_DANRE Zinc finger protein 148 OS=Danio rerio GN=znf148 PE=2 SV=2 Back     alignment and function description
>sp|Q96BV0|ZN775_HUMAN Zinc finger protein 775 OS=Homo sapiens GN=ZNF775 PE=2 SV=2 Back     alignment and function description
>sp|P18714|ZG20_XENLA Gastrula zinc finger protein xFG20-1 OS=Xenopus laevis PE=3 SV=2 Back     alignment and function description
>sp|Q8BI73|ZN775_MOUSE Zinc finger protein 775 OS=Mus musculus GN=Znf775 PE=2 SV=1 Back     alignment and function description
>sp|Q9EPW2|KLF15_MOUSE Krueppel-like factor 15 OS=Mus musculus GN=Klf15 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
195451027 284 GK13762 [Drosophila willistoni] gi|19416 0.907 0.450 0.628 8e-47
195036202 288 GH18734 [Drosophila grimshawi] gi|193893 0.886 0.434 0.635 5e-46
194743628 300 GF16814 [Drosophila ananassae] gi|190627 0.907 0.426 0.628 7e-46
195400138 295 GJ14181 [Drosophila virilis] gi|19414223 0.886 0.423 0.635 8e-46
195156806 292 GL12325 [Drosophila persimilis] gi|19845 0.907 0.438 0.621 8e-46
195110447 291 GI22886 [Drosophila mojavensis] gi|19391 0.886 0.429 0.635 8e-46
195568159 297 GD19684 [Drosophila simulans] gi|1941980 0.907 0.430 0.628 1e-44
195343395 297 GM10707 [Drosophila sechellia] gi|194133 0.907 0.430 0.628 1e-44
194898460 300 GG11643 [Drosophila erecta] gi|190650513 0.907 0.426 0.628 1e-44
195497044 295 GE25358 [Drosophila yakuba] gi|194182035 0.907 0.433 0.621 6e-44
>gi|195451027|ref|XP_002072737.1| GK13762 [Drosophila willistoni] gi|194168822|gb|EDW83723.1| GK13762 [Drosophila willistoni] Back     alignment and taxonomy information
 Score =  191 bits (485), Expect = 8e-47,   Method: Compositional matrix adjust.
 Identities = 88/140 (62%), Positives = 108/140 (77%), Gaps = 12/140 (8%)

Query: 7   GGSLDPYWSNLALEYF------KSHEQSMKAKNQRPKKFNCPHCNVAFSNNGQLKGHIRI 60
           G ++DP+   L  + +       +  ++M A+ QRPKKF CPHC+VAFSNNGQLKGHIRI
Sbjct: 144 GFAMDPFTLGLMEQEYARVMAEDAQLKAMNARKQRPKKFKCPHCDVAFSNNGQLKGHIRI 203

Query: 61  HTGERPYKCDAENCGKSFTRNEELTRHKRIHSGLRPYPCTHCGKKFGRKDHLKKHLRTHF 120
           HTGERP+KCD + CGK+FTRNEELTRHKRIH+GLRPYPC+ CGKKFGR+DHLKKH++TH 
Sbjct: 204 HTGERPFKCDVDTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKHMKTHM 263

Query: 121 PQPR------YVSCYPYMYG 134
           PQ R      +V  YPY+YG
Sbjct: 264 PQERQLAPAIFVPMYPYLYG 283




Source: Drosophila willistoni

Species: Drosophila willistoni

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|195036202|ref|XP_001989560.1| GH18734 [Drosophila grimshawi] gi|193893756|gb|EDV92622.1| GH18734 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|194743628|ref|XP_001954302.1| GF16814 [Drosophila ananassae] gi|190627339|gb|EDV42863.1| GF16814 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195400138|ref|XP_002058675.1| GJ14181 [Drosophila virilis] gi|194142235|gb|EDW58643.1| GJ14181 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195156806|ref|XP_002019287.1| GL12325 [Drosophila persimilis] gi|198454488|ref|XP_001359609.2| GA22020 [Drosophila pseudoobscura pseudoobscura] gi|194115878|gb|EDW37921.1| GL12325 [Drosophila persimilis] gi|198132816|gb|EAL28759.2| GA22020 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195110447|ref|XP_001999791.1| GI22886 [Drosophila mojavensis] gi|193916385|gb|EDW15252.1| GI22886 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195568159|ref|XP_002102085.1| GD19684 [Drosophila simulans] gi|194198012|gb|EDX11588.1| GD19684 [Drosophila simulans] Back     alignment and taxonomy information
>gi|195343395|ref|XP_002038283.1| GM10707 [Drosophila sechellia] gi|194133304|gb|EDW54820.1| GM10707 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|194898460|ref|XP_001978810.1| GG11643 [Drosophila erecta] gi|190650513|gb|EDV47768.1| GG11643 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195497044|ref|XP_002095934.1| GE25358 [Drosophila yakuba] gi|194182035|gb|EDW95646.1| GE25358 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query141
FB|FBgn0261434297 hkb "huckebein" [Drosophila me 0.907 0.430 0.635 1e-45
UNIPROTKB|Q26364296 hkb "Hkb protein" [Drosophila 0.907 0.432 0.635 1e-45
UNIPROTKB|E1BNM7640 ZNF398 "Uncharacterized protei 0.624 0.137 0.510 8.3e-23
ZFIN|ZDB-GENE-071004-66346 zgc:173816 "zgc:173816" [Danio 0.716 0.291 0.462 1e-22
ZFIN|ZDB-GENE-080219-37339 zgc:171604 "zgc:171604" [Danio 0.723 0.300 0.444 1.3e-22
UNIPROTKB|F1MP77833 F1MP77 "Uncharacterized protei 0.617 0.104 0.571 1.5e-22
UNIPROTKB|H9L1H6 738 LOC100858045 "Uncharacterized 0.602 0.115 0.529 1.6e-22
UNIPROTKB|F1NVC4275 LOC419834 "Uncharacterized pro 0.638 0.327 0.489 2.1e-22
UNIPROTKB|H9L1H7 869 LOC100858045 "Uncharacterized 0.602 0.097 0.529 2.1e-22
UNIPROTKB|I3L7P6634 ZNF398 "Uncharacterized protei 0.645 0.143 0.494 2.1e-22
FB|FBgn0261434 hkb "huckebein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 480 (174.0 bits), Expect = 1.0e-45, P = 1.0e-45
 Identities = 89/140 (63%), Positives = 106/140 (75%)

Query:     7 GGSLDPYWSNLA-LEYFK--SHEQSMKAKN---QRPKKFNCPHCNVAFSNNGQLKGHIRI 60
             G  +DP+   L   EY +  + +  +KA N   QRPKKF CP+C+VAFSNNGQLKGHIRI
Sbjct:   157 GFGMDPFTMGLMEQEYARVMAEDAQLKALNSRKQRPKKFKCPNCDVAFSNNGQLKGHIRI 216

Query:    61 HTGERPYKCDAENCGKSFTRNEELTRHKRIHSGLRPYPCTHCGKKFGRKDHLKKHLRTHF 120
             HTGERP+KCD   CGK+FTRNEELTRHKRIH+GLRPYPC+ CGKKFGR+DHLKKH++TH 
Sbjct:   217 HTGERPFKCDVNTCGKTFTRNEELTRHKRIHTGLRPYPCSACGKKFGRRDHLKKHMKTHM 276

Query:   121 PQPR------YVSCYPYMYG 134
             PQ R      +V  Y Y+YG
Sbjct:   277 PQERQLGPSIFVPMYSYLYG 296




GO:0007375 "anterior midgut invagination" evidence=NAS
GO:0000122 "negative regulation of transcription from RNA polymerase II promoter" evidence=IMP
GO:0007374 "posterior midgut invagination" evidence=NAS
GO:0005634 "nucleus" evidence=ISS;IDA
GO:0007417 "central nervous system development" evidence=IGI
GO:0008354 "germ cell migration" evidence=IMP;TAS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0008134 "transcription factor binding" evidence=IPI
GO:0006351 "transcription, DNA-dependent" evidence=NAS
GO:0009948 "anterior/posterior axis specification" evidence=TAS
GO:0007369 "gastrulation" evidence=NAS
GO:0008293 "torso signaling pathway" evidence=TAS
GO:0007362 "terminal region determination" evidence=TAS
GO:0001708 "cell fate specification" evidence=TAS
GO:0007435 "salivary gland morphogenesis" evidence=IGI;IMP;TAS
GO:0007499 "ectoderm and mesoderm interaction" evidence=NAS
GO:0001706 "endoderm formation" evidence=TAS
GO:0035239 "tube morphogenesis" evidence=IMP
GO:0016044 "cellular membrane organization" evidence=IMP;TAS
GO:0007431 "salivary gland development" evidence=TAS
GO:0007419 "ventral cord development" evidence=TAS
GO:0007400 "neuroblast fate determination" evidence=TAS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IDA
GO:0010001 "glial cell differentiation" evidence=IMP
GO:0007492 "endoderm development" evidence=IMP
GO:0046331 "lateral inhibition" evidence=IMP
UNIPROTKB|Q26364 hkb "Hkb protein" [Drosophila sp. (taxid:7242)] Back     alignment and assigned GO terms
UNIPROTKB|E1BNM7 ZNF398 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071004-66 zgc:173816 "zgc:173816" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080219-37 zgc:171604 "zgc:171604" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MP77 F1MP77 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|H9L1H6 LOC100858045 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NVC4 LOC419834 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H9L1H7 LOC100858045 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3L7P6 ZNF398 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
COG5048 467 COG5048, COG5048, FOG: Zn-finger [General function 6e-06
COG5048467 COG5048, COG5048, FOG: Zn-finger [General function 3e-05
COG5189423 COG5189, SFP1, Putative transcriptional repressor 2e-04
COG5048 467 COG5048, COG5048, FOG: Zn-finger [General function 5e-04
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 6e-04
pfam1346526 pfam13465, zf-H2C2_2, Zinc-finger double domain 0.002
pfam0009622 pfam00096, zf-C2H2, Zinc finger, C2H2 type 0.004
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
 Score = 44.3 bits (104), Expect = 6e-06
 Identities = 28/69 (40%), Positives = 42/69 (60%)

Query: 24 SHEQSMKAKNQRPKKFNCPHCNVAFSNNGQLKGHIRIHTGERPYKCDAENCGKSFTRNEE 83
          + + ++K+ +  P+  +CP+C  +FS    L  HIR HTGE+P +C    C KSF+R  E
Sbjct: 19 TPKSTLKSLSNAPRPDSCPNCTDSFSRLEHLTRHIRSHTGEKPSQCSYSGCDKSFSRPLE 78

Query: 84 LTRHKRIHS 92
          L+RH R H 
Sbjct: 79 LSRHLRTHH 87


Length = 467

>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|227516 COG5189, SFP1, Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|227381 COG5048, COG5048, FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|222150 pfam13465, zf-H2C2_2, Zinc-finger double domain Back     alignment and domain information
>gnl|CDD|200998 pfam00096, zf-C2H2, Zinc finger, C2H2 type Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 141
KOG2462|consensus279 99.91
KOG2462|consensus279 99.85
KOG1074|consensus 958 99.54
KOG3576|consensus267 99.53
KOG3623|consensus1007 99.5
KOG3623|consensus 1007 99.43
KOG3576|consensus267 99.42
KOG3608|consensus467 99.4
KOG3608|consensus 467 99.27
KOG1074|consensus 958 98.96
PHA00733128 hypothetical protein 98.94
PHA00733128 hypothetical protein 98.75
PLN03086567 PRLI-interacting factor K; Provisional 98.71
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.7
PHA0276855 hypothetical protein; Provisional 98.66
PHA0276855 hypothetical protein; Provisional 98.66
PLN03086567 PRLI-interacting factor K; Provisional 98.48
PHA0061644 hypothetical protein 98.37
PHA0061644 hypothetical protein 98.32
PF1346526 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 98.21
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.92
PHA0073279 hypothetical protein 97.83
PF0009623 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR0070 97.82
PHA0073279 hypothetical protein 97.76
KOG3993|consensus500 97.75
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.68
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 97.68
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.61
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.55
PF1389424 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP 97.55
PF1391227 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9 97.44
COG5189423 SFP1 Putative transcriptional repressor regulating 97.41
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 97.26
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 97.14
smart0035526 ZnF_C2H2 zinc finger. 96.92
smart0035526 ZnF_C2H2 zinc finger. 96.9
PF0923754 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger 96.86
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.62
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 96.27
PF1287425 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG 96.2
KOG3993|consensus500 96.11
PF1390924 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W 95.94
COG5189423 SFP1 Putative transcriptional repressor regulating 95.83
PF1217127 zf-C2H2_jaz: Zinc-finger double-stranded RNA-bindi 95.68
PRK04860160 hypothetical protein; Provisional 94.71
PRK04860160 hypothetical protein; Provisional 94.51
PF1391325 zf-C2HC_2: zinc-finger of a C2HC-type 93.88
smart0045135 ZnF_U1 U1-like zinc finger. Family of C2H2-type zi 93.2
PF12756100 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 91.54
COG5048467 FOG: Zn-finger [General function prediction only] 87.98
KOG1146|consensus1406 86.48
KOG4173|consensus253 85.11
KOG2231|consensus 669 84.67
KOG4173|consensus253 82.22
KOG2893|consensus 341 81.05
COG404965 Uncharacterized protein containing archaeal-type C 80.05
>KOG2462|consensus Back     alignment and domain information
Probab=99.91  E-value=2.1e-25  Score=148.95  Aligned_cols=123  Identities=29%  Similarity=0.543  Sum_probs=107.3

Q ss_pred             CCCchhhHHHHHHHHhhHHHHHhh-----cCCCCccccCcchhccCChHHHHHHHHHhCCCCCccccCCccCcccCChHh
Q psy17779          9 SLDPYWSNLALEYFKSHEQSMKAK-----NQRPKKFNCPHCNVAFSNNGQLKGHIRIHTGERPYKCDAENCGKSFTRNEE   83 (141)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~~~~~~~~   83 (141)
                      ..+.+.|..|++.+.+...+-.++     ....+.+.|++|++.|.+...|+.|+++|.  .+..|.  +||+.|...+-
T Consensus       127 ~~~r~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~--iCGKaFSRPWL  202 (279)
T KOG2462|consen  127 KHPRYKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECG--ICGKAFSRPWL  202 (279)
T ss_pred             cCCceeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccc--cccccccchHH
Confidence            356788889999888765443322     234677999999999999999999999998  567787  99999999999


Q ss_pred             HHHHHHHhCCCCCeeCccchhccCChHHHHHHHHhhCCCCCccccccccccccc
Q psy17779         84 LTRHKRIHSGLRPYPCTHCGKKFGRKDHLKKHLRTHFPQPRYVSCYPYMYGGYT  137 (141)
Q Consensus        84 l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h~~~~~~~~~~~~~~~~~~  137 (141)
                      |+.|++.|+|||||.|..|+++|...++|+.|+++|.+.|+|.|-  -|.++|+
T Consensus       203 LQGHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~--~C~KsFs  254 (279)
T KOG2462|consen  203 LQGHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCP--RCGKSFA  254 (279)
T ss_pred             hhcccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCc--chhhHHH
Confidence            999999999999999999999999999999999999999999877  8888884



>KOG2462|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>KOG3576|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG3608|consensus Back     alignment and domain information
>KOG1074|consensus Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PHA00733 hypothetical protein Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PHA02768 hypothetical protein; Provisional Back     alignment and domain information
>PLN03086 PRLI-interacting factor K; Provisional Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PHA00616 hypothetical protein Back     alignment and domain information
>PF13465 zf-H2C2_2: Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>PF00096 zf-C2H2: Zinc finger, C2H2 type; InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA00732 hypothetical protein Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13894 zf-C2H2_4: C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A Back     alignment and domain information
>PF13912 zf-C2H2_6: C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>smart00355 ZnF_C2H2 zinc finger Back     alignment and domain information
>PF09237 GAGA: GAGA factor; InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>PF12874 zf-met: Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A Back     alignment and domain information
>KOG3993|consensus Back     alignment and domain information
>PF13909 zf-H2C2_5: C2H2-type zinc-finger domain; PDB: 1X5W_A Back     alignment and domain information
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning] Back     alignment and domain information
>PF12171 zf-C2H2_jaz: Zinc-finger double-stranded RNA-binding; InterPro: IPR022755 This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PRK04860 hypothetical protein; Provisional Back     alignment and domain information
>PF13913 zf-C2HC_2: zinc-finger of a C2HC-type Back     alignment and domain information
>smart00451 ZnF_U1 U1-like zinc finger Back     alignment and domain information
>PF12756 zf-C2H2_2: C2H2 type zinc-finger (2 copies); PDB: 2DMI_A Back     alignment and domain information
>COG5048 FOG: Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>KOG2231|consensus Back     alignment and domain information
>KOG4173|consensus Back     alignment and domain information
>KOG2893|consensus Back     alignment and domain information
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
1mey_C87 Crystal Structure Of A Designed Zinc Finger Protein 4e-20
2i13_A190 Aart, A Six Finger Zinc Finger Designed To Recogniz 2e-18
2wbu_A90 Crystal Structure Of The Zinc Finger Domain Of Klf4 3e-18
2wbs_A89 Crystal Structure Of The Zinc Finger Domain Of Klf4 3e-18
2jp9_A119 Structure Of The Wilms Tumor Suppressor Protein Zin 6e-18
2ebt_A100 Solution Structure Of Three Tandem Repeats Of Zf-C2 4e-17
1a1h_A90 Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 9e-16
1jk1_A90 Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 2e-15
1a1f_A90 Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc 2e-15
1aay_A90 Zif268 Zinc Finger-Dna Complex Length = 90 3e-15
1a1i_A90 Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac 3e-15
1p47_A87 Crystal Structure Of Tandem Zif268 Molecules Comple 3e-15
1zaa_C87 Zinc Finger-Dna Recognition: Crystal Structure Of A 1e-14
1ubd_C124 Co-Crystal Structure Of Human Yy1 Zinc Finger Domai 2e-14
1f2i_G73 Cocrystal Structure Of Selected Zinc Finger Dimer B 2e-13
2rpc_A155 Solution Structure Of The Tandem Zf-C2h2 Domains Fr 3e-12
1g2f_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 2e-11
1g2d_C90 Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX 4e-11
2kmk_A82 Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 1e-10
2gli_A155 Five-Finger GliDNA COMPLEX Length = 155 5e-10
2ee8_A106 Solution Structure Of Three Zf-C2h2 Domains From Mo 5e-10
1tf3_A92 Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures 1e-09
2csh_A110 Solution Structure Of Tandem Repeat Of The Zf-C2h2 1e-09
1tf6_A190 Co-crystal Structure Of Xenopus Tfiiia Zinc Finger 2e-09
2cot_A77 Solution Structure Of The First And Second Zf-C2h2 2e-09
1x6e_A72 Solution Structures Of The C2h2 Type Zinc Finger Do 2e-09
2dmd_A96 Solution Structure Of The N-Terminal C2h2 Type Zinc 6e-09
2yt9_A95 Solution Structure Of C2h2 Type Zinc Finger Domain 1e-08
2lce_A74 Chemical Shift Assignment Of Hr4436b From Homo Sapi 2e-08
2epa_A72 Solution Structure Of The First And Second Zf-C2h2 7e-08
1llm_C88 Crystal Structure Of A Zif23-Gcn4 Chimera Bound To 1e-07
2dlq_A124 Solution Structure Of The Tandem Four Zf-C2h2 Domai 1e-06
4gzn_C60 Mouse Zfp57 Zinc Fingers In Complex With Methylated 2e-06
1un6_B87 The Crystal Structure Of A Zinc Finger - Rna Comple 3e-06
2j7j_A85 Invariance Of The Zinc Finger Module: A Comparison 3e-06
2adr_A60 Adr1 Dna-Binding Domain From Saccharomyces Cerevisi 4e-06
2lt7_A133 Solution Nmr Structure Of Kaiso Zinc Finger Dna Bin 3e-05
2ent_A48 Solution Structure Of The Second C2h2-Type Zinc Fin 6e-05
2eoe_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 7e-05
2yu8_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 1e-04
2ytr_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
2ytk_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 2e-04
1sp2_A31 Nmr Structure Of A Zinc Finger Domain From Transcri 3e-04
2enf_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2eme_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2yti_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2el5_A42 Solution Structure Of The 18th Zf-C2h2 Domain From 4e-04
2em1_A44 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2en1_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 4e-04
2dlk_A79 Solution Structure Of The First And The Second Zf-C 7e-04
2ytd_A46 Solution Structure Of The C2h2 Type Zinc Finger (Re 9e-04
>pdb|1MEY|C Chain C, Crystal Structure Of A Designed Zinc Finger Protein Bound To Dna Length = 87 Back     alignment and structure

Iteration: 1

Score = 93.2 bits (230), Expect = 4e-20, Method: Compositional matrix adjust. Identities = 42/83 (50%), Positives = 56/83 (67%), Gaps = 2/83 (2%) Query: 37 KKFNCPHCNVAFSNNGQLKGHIRIHTGERPYKCDAENCGKSFTRNEELTRHKRIHSGLRP 96 K + CP C +FS + L+ H R HTGE+PYKC CGKSF+++ +L +H+R H+G +P Sbjct: 3 KPYKCPECGKSFSQSSNLQKHQRTHTGEKPYKCP--ECGKSFSQSSDLQKHQRTHTGEKP 60 Query: 97 YPCTHCGKKFGRKDHLKKHLRTH 119 Y C CGK F R DHL +H RTH Sbjct: 61 YKCPECGKSFSRSDHLSRHQRTH 83
>pdb|2I13|A Chain A, Aart, A Six Finger Zinc Finger Designed To Recognize Ann Triplets Length = 190 Back     alignment and structure
>pdb|2WBU|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 90 Back     alignment and structure
>pdb|2WBS|A Chain A, Crystal Structure Of The Zinc Finger Domain Of Klf4 Bound To Its Target Dna Length = 89 Back     alignment and structure
>pdb|2JP9|A Chain A, Structure Of The Wilms Tumor Suppressor Protein Zinc Finger Domain Bound To Dna Length = 119 Back     alignment and structure
>pdb|2EBT|A Chain A, Solution Structure Of Three Tandem Repeats Of Zf-C2h2 Domains From Human Kruppel-Like Factor 5 Length = 100 Back     alignment and structure
>pdb|1A1H|A Chain A, Qgsr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1JK1|A Chain A, Zif268 D20a Mutant Bound To Wt Dna Site Length = 90 Back     alignment and structure
>pdb|1A1F|A Chain A, Dsnr (Zif268 Variant) Zinc Finger-Dna Complex (Gacc Site) Length = 90 Back     alignment and structure
>pdb|1AAY|A Chain A, Zif268 Zinc Finger-Dna Complex Length = 90 Back     alignment and structure
>pdb|1A1I|A Chain A, Radr (Zif268 Variant) Zinc Finger-Dna Complex (Gcac Site) Length = 90 Back     alignment and structure
>pdb|1P47|A Chain A, Crystal Structure Of Tandem Zif268 Molecules Complexed To Dna Length = 87 Back     alignment and structure
>pdb|1ZAA|C Chain C, Zinc Finger-Dna Recognition: Crystal Structure Of A Zif268- Dna Complex At 2.1 Angstroms Length = 87 Back     alignment and structure
>pdb|1UBD|C Chain C, Co-Crystal Structure Of Human Yy1 Zinc Finger Domain Bound To The Adeno-Associated Virus P5 Initiator Element Length = 124 Back     alignment and structure
>pdb|1F2I|G Chain G, Cocrystal Structure Of Selected Zinc Finger Dimer Bound To Dna Length = 73 Back     alignment and structure
>pdb|2RPC|A Chain A, Solution Structure Of The Tandem Zf-C2h2 Domains From The Human Zinc Finger Protein Zic 3 Length = 155 Back     alignment and structure
>pdb|1G2F|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (Tatazf;clone #6) Length = 90 Back     alignment and structure
>pdb|1G2D|C Chain C, Structure Of A Cys2his2 Zinc FingerTATA BOX COMPLEX (CLONE #2) Length = 90 Back     alignment and structure
>pdb|2KMK|A Chain A, Gfi-1 Zinc Fingers 3-5 Complexed With Dna Length = 82 Back     alignment and structure
>pdb|2GLI|A Chain A, Five-Finger GliDNA COMPLEX Length = 155 Back     alignment and structure
>pdb|2EE8|A Chain A, Solution Structure Of Three Zf-C2h2 Domains From Mouse Protein Odd-Skipped-Related 2 Splicing Isoform 2 Length = 106 Back     alignment and structure
>pdb|1TF3|A Chain A, Tfiiia Finger 1-3 Bound To Dna, Nmr, 22 Structures Length = 92 Back     alignment and structure
>pdb|2CSH|A Chain A, Solution Structure Of Tandem Repeat Of The Zf-C2h2 Domains Of Human Zinc Finger Protein 297b Length = 110 Back     alignment and structure
>pdb|1TF6|A Chain A, Co-crystal Structure Of Xenopus Tfiiia Zinc Finger Domain Bound To The 5s Ribosomal Rna Gene Internal Control Region Length = 190 Back     alignment and structure
>pdb|2COT|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domain Of Zinc Finger Protein 435 Length = 77 Back     alignment and structure
>pdb|1X6E|A Chain A, Solution Structures Of The C2h2 Type Zinc Finger Domain Of Human Zinc Finger Protein 24 Length = 72 Back     alignment and structure
>pdb|2DMD|A Chain A, Solution Structure Of The N-Terminal C2h2 Type Zinc-Binding Domain Of The Zinc Finger Protein 64, Isoforms 1 And 2 Length = 96 Back     alignment and structure
>pdb|2YT9|A Chain A, Solution Structure Of C2h2 Type Zinc Finger Domain 345 In Zinc Finger Protein 278 Length = 95 Back     alignment and structure
>pdb|2LCE|A Chain A, Chemical Shift Assignment Of Hr4436b From Homo Sapiens, Northeast Structural Genomics Consortium Length = 74 Back     alignment and structure
>pdb|2EPA|A Chain A, Solution Structure Of The First And Second Zf-C2h2 Domains From Human Krueppel-Like Factor 10 Length = 72 Back     alignment and structure
>pdb|1LLM|C Chain C, Crystal Structure Of A Zif23-Gcn4 Chimera Bound To Dna Length = 88 Back     alignment and structure
>pdb|2DLQ|A Chain A, Solution Structure Of The Tandem Four Zf-C2h2 Domain Repeats Of Murine Gli-Kruppel Family Member Hkr3 Length = 124 Back     alignment and structure
>pdb|4GZN|C Chain C, Mouse Zfp57 Zinc Fingers In Complex With Methylated Dna Length = 60 Back     alignment and structure
>pdb|1UN6|B Chain B, The Crystal Structure Of A Zinc Finger - Rna Complex Reveals Two Modes Of Molecular Recognition Length = 87 Back     alignment and structure
>pdb|2J7J|A Chain A, Invariance Of The Zinc Finger Module: A Comparison Of The Free Structure With Those In Nucleic-Acid Complexes Length = 85 Back     alignment and structure
>pdb|2ADR|A Chain A, Adr1 Dna-Binding Domain From Saccharomyces Cerevisiae, Nmr, 25 Structures Length = 60 Back     alignment and structure
>pdb|2LT7|A Chain A, Solution Nmr Structure Of Kaiso Zinc Finger Dna Binding Domain In Complex With Kaiso Binding Site Dna Length = 133 Back     alignment and structure
>pdb|2ENT|A Chain A, Solution Structure Of The Second C2h2-Type Zinc Finger Domain From Human Krueppel-Like Factor 15 Length = 48 Back     alignment and structure
>pdb|2EOE|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 508- 540) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2YU8|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 648- 680) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2YTR|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 760- 792) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2YTK|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 396- 428) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|1SP2|A Chain A, Nmr Structure Of A Zinc Finger Domain From Transcription Factor Sp1f2, Minimized Average Structure Length = 31 Back     alignment and structure
>pdb|2ENF|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 340- 372) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EME|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 725- 757) Of Human Zinc Finger Protein 473 Length = 46 Back     alignment and structure
>pdb|2YTI|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 564- 596) Of Human Zinc Finger Protein 347 Length = 46 Back     alignment and structure
>pdb|2EL5|A Chain A, Solution Structure Of The 18th Zf-C2h2 Domain From Human Zinc Finger Protein 268 Length = 42 Back     alignment and structure
>pdb|2EM1|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 637- 667) Of Human Zinc Finger Protein 268 Length = 44 Back     alignment and structure
>pdb|2EN1|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 563- 595) Of Human Zinc Finger Protein 224 Length = 46 Back     alignment and structure
>pdb|2DLK|A Chain A, Solution Structure Of The First And The Second Zf-C2h2 Domains Of Zinc Finger Protein 692 Length = 79 Back     alignment and structure
>pdb|2YTD|A Chain A, Solution Structure Of The C2h2 Type Zinc Finger (Region 426- 458) Of Human Zinc Finger Protein 473 Length = 46 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query141
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 2e-40
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 6e-39
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 1e-20
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 5e-34
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 3e-29
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 7e-22
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 5e-32
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 6e-24
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 1e-19
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 2e-04
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 6e-32
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 2e-26
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 8e-20
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 9e-06
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 3e-31
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 9e-27
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 8e-21
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-19
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 5e-12
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 2e-07
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 2e-30
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 3e-23
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 9e-21
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 6e-30
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 4e-26
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 1e-20
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 9e-07
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 8e-30
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 6e-14
1tf6_A190 Protein (transcription factor IIIA); complex (tran 8e-30
1tf6_A190 Protein (transcription factor IIIA); complex (tran 3e-26
1tf6_A190 Protein (transcription factor IIIA); complex (tran 1e-25
1tf6_A 190 Protein (transcription factor IIIA); complex (tran 5e-25
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-29
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 1e-17
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 1e-29
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-29
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 3e-29
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 2e-27
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 4e-17
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 2e-29
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-26
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-25
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 4e-16
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 1e-13
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 5e-29
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 6e-07
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 7e-29
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 7e-24
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 1e-28
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 2e-18
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 5e-09
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 2e-28
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 7e-27
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 1e-20
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 1e-27
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 4e-17
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 7e-07
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 2e-26
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 1e-25
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 4e-23
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 7e-10
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 2e-26
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 3e-24
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 3e-26
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-14
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 1e-08
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 8e-04
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 9e-26
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-19
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 4e-06
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 1e-25
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 8e-20
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-25
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 2e-19
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 1e-24
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 2e-23
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 8e-11
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 5e-23
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 3e-17
2epa_A72 Krueppel-like factor 10; transforming growth facto 2e-22
2epa_A72 Krueppel-like factor 10; transforming growth facto 6e-19
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 2e-21
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 1e-16
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 2e-20
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 1e-09
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 9e-06
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 2e-20
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 1e-17
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-16
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-10
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 2e-07
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-16
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-07
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-16
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-16
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 3e-16
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 5e-09
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-07
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-16
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 1e-11
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-07
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-16
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-09
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-16
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-16
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-09
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 4e-16
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-08
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-07
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-16
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-08
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 5e-16
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 6e-09
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 3e-07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-16
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-09
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-07
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-16
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 6e-16
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-08
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-07
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 6e-16
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-07
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-16
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 9e-09
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-16
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-16
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-09
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 7e-16
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 1e-08
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 7e-08
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-16
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-09
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-07
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-16
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-09
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-07
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 8e-16
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 2e-09
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-07
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 9e-16
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-09
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 9e-16
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 8e-09
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 5e-07
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 9e-16
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-16
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 9e-10
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 9e-16
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 4e-09
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 3e-07
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-15
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-08
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-07
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-15
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-08
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-07
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-15
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 6e-09
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-07
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-15
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-09
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-15
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 5e-09
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-15
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-07
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 1e-15
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-08
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-07
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-15
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-08
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-15
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 8e-09
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-15
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-07
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-15
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-08
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-07
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-15
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-09
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 9e-09
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 2e-15
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-09
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 3e-07
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-15
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-07
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 2e-15
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-07
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-15
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-09
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 3e-08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-15
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-08
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-15
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 4e-09
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 3e-15
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-08
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-07
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-15
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 5e-09
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-07
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-15
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-09
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-08
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 4e-15
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-09
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-08
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-15
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-08
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-15
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 5e-09
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 1e-07
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 4e-15
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 1e-09
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 2e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 6e-15
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 7e-15
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-09
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-07
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-15
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-09
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-08
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 7e-15
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 1e-08
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 8e-08
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-14
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-09
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 7e-07
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 1e-14
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 2e-08
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 3e-07
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-14
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 1e-14
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 9e-08
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 4e-07
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-14
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 4e-10
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-14
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-09
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 5e-07
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-14
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-09
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 3e-07
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 2e-14
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 7e-09
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 4e-07
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 2e-14
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 3e-09
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 3e-14
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 4e-09
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-07
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 3e-14
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 5e-09
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 2e-06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 4e-14
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 2e-09
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 3e-07
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 5e-14
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 1e-08
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 2e-07
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-14
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-09
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-07
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 6e-14
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-08
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 5e-06
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 7e-14
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-07
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 2e-05
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 9e-14
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-09
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-06
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 9e-14
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 3e-09
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 5e-04
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 1e-13
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 7e-08
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 4e-07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 1e-13
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 7e-08
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 2e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 1e-13
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 3e-07
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 5e-06
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-13
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 3e-09
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 1e-05
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 2e-13
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 5e-08
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 7e-08
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-13
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-09
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 2e-06
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-13
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-08
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 8e-06
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 2e-13
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 6e-08
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 5e-07
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 4e-13
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 3e-08
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 7e-06
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-13
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 2e-09
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 6e-08
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 7e-13
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 1e-07
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 2e-07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-12
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-07
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 3e-04
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 8e-12
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 6e-06
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 6e-06
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 1e-11
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 2e-10
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-11
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 8e-07
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 2e-05
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 2e-11
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 5e-09
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 4e-11
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 1e-08
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 5e-11
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 3e-06
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 6e-11
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 6e-10
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 2e-10
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 8e-07
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 8e-05
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 9e-08
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 1e-07
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 5e-06
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 2e-04
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 2e-07
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 1e-06
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 3e-07
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} Len 4e-05
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 1e-06
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 9e-04
1ard_A29 Yeast transcription factor ADR1; transcription reg 4e-06
1ard_A29 Yeast transcription factor ADR1; transcription reg 6e-04
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 2e-05
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 2e-04
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 6e-05
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 7e-05
1ej6_B 1275 Lambda1; icosahedral, non-equivalence, dsRNA virus 7e-04
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 4e-04
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 4e-04
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 5e-04
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} Len 6e-04
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 7e-04
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 7e-04
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 9e-04
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Length = 89 Back     alignment and structure
 Score =  129 bits (327), Expect = 2e-40
 Identities = 38/89 (42%), Positives = 52/89 (58%)

Query: 32  KNQRPKKFNCPHCNVAFSNNGQLKGHIRIHTGERPYKCDAENCGKSFTRNEELTRHKRIH 91
           K       +   C   ++ +  LK H+R HTGE+PY CD + CG  F R++ELTRH R H
Sbjct: 1   KRTATHTCDYAGCGKTYTKSSHLKAHLRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKH 60

Query: 92  SGLRPYPCTHCGKKFGRKDHLKKHLRTHF 120
           +G RP+ C  C + F R DHL  H++ HF
Sbjct: 61  TGHRPFQCQKCDRAFSRSDHLALHMKRHF 89


>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Length = 119 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Length = 90 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Length = 124 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 96 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Length = 106 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Length = 73 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Length = 190 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Length = 190 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 155 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Length = 88 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 95 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Length = 85 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Length = 124 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 110 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 79 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Length = 66 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 77 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 72 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 86 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 70 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 48 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Length = 60 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 54 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 45 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Length = 42 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 47 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 44 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 42 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 46 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 41 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Length = 42 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Length = 37 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Length = 57 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Length = 31 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 115 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Length = 42 Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 32 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 48 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 44 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Length = 129 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Length = 107 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Length = 29 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Length = 37 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1ej6_B Lambda1; icosahedral, non-equivalence, dsRNA virus, methylase, methyltransferase, guanylyltransferase, zinc finger, icosahedral virus; 3.60A {Reovirus SP} SCOP: i.7.1.1 PDB: 2cse_V Length = 1275 Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Length = 47 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Length = 33 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Length = 45 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Length = 32 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Length = 102 Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Length = 29 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Length = 30 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.89
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.88
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.88
2i13_A190 AART; DNA binding, zinc finger, DNA binding protei 99.87
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.86
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.85
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.85
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.85
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.84
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.84
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.84
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.84
1ubd_C124 Protein (YY1 zinc finger domain); transcription in 99.84
2dlq_A124 GLI-kruppel family member HKR3; ZF-C2H2 domain, st 99.82
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.82
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.81
2rpc_A155 Zinc finger protein ZIC 3; ZF-C2H2, zinc finger pr 99.81
2jp9_A119 Wilms tumor 1; DNA binding, nucleic acid recogniti 99.8
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.8
2gli_A155 Protein (five-finger GLI); protein/DNA complex, tr 99.79
1tf6_A190 Protein (transcription factor IIIA); complex (tran 99.79
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.79
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.78
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.78
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.74
2lt7_A133 Transcriptional regulator kaiso; zinc finger, doub 99.74
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.73
4gzn_C60 ZFP-57, zinc finger protein 57; transcription-DNA 99.69
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.68
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.67
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.65
2dlk_A79 Novel protein; ZF-C2H2 domain, zinc finger protein 99.64
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.63
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.63
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.62
2cot_A77 Zinc finger protein 435; ADK_LID domain, zinc fing 99.59
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.59
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.59
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.57
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.56
1a1h_A90 QGSR zinc finger peptide; complex (zinc finger/DNA 99.56
2dmd_A96 Zinc finger protein 64, isoforms 1 and 2; ZNF338, 99.56
2lce_A74 B-cell lymphoma 6 protein; structural genomics, no 99.56
2ee8_A106 Protein ODD-skipped-related 2; zinc binding, ZF-C2 99.55
2ghf_A102 ZHX1, zinc fingers and homeoboxes protein 1; C2H2 99.55
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.53
2yt9_A95 Zinc finger-containing protein 1; C2H2, structural 99.52
1x6h_A86 Transcriptional repressor CTCF; zinc finger protei 99.52
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.51
2kmk_A82 Zinc finger protein GFI-1; tandem repeat zinc fing 99.51
2dmi_A115 Teashirt homolog 3; zinc finger protein 537, struc 99.5
2csh_A110 Zinc finger protein 297B; ZF-C2H2 domain, zinc fin 99.5
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.49
1wjp_A107 Zinc finger protein 295; ZF-C2H2 domain, zinc bind 99.49
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.49
1x5w_A70 Zinc finger protein 64, isoforms 1; ZNF338, nuclea 99.48
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.47
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.47
2ebt_A100 Krueppel-like factor 5; C2H2-type zinc-finger, met 99.45
2wbs_A89 Krueppel-like factor 4; transcription-DNA complex, 99.44
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.44
3uk3_C57 Zinc finger protein 217; transcription factor, DNA 99.43
1x6e_A72 Zinc finger protein 24; ZNF24, KOX17, ZNF191, zsca 99.42
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.41
1bbo_A57 Human enhancer-binding protein MBP-1; DNA-binding 99.41
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.4
2lv2_A85 Insulinoma-associated protein 1; structural genomi 99.4
1llm_C88 Chimera of ZIF23-GCN4; dimerization, DNA recogniti 99.4
2gqj_A98 Zinc finger protein KIAA1196; ZF-C2H2 like domain, 99.39
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.38
2j7j_A85 Transcription factor IIIA; zinc finger module, alt 99.38
2ctd_A96 Zinc finger protein 512; zinc binding, two ZF-C2H2 99.37
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.35
2ej4_A95 Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc bi 99.35
2drp_A66 Protein (tramtrack DNA-binding domain); protein-DN 99.32
2adr_A60 ADR1; transcription regulation, zinc finger,; NMR 99.31
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 99.3
2wbt_A129 B-129; zinc finger; 2.70A {Sulfolobus virus 1} 99.3
2d9h_A78 Zinc finger protein 692; ZF-C2H2 domain, structura 99.3
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 99.26
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.25
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.25
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 99.24
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.24
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.23
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.23
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.22
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.22
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.22
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.22
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.22
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.22
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.21
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 99.21
2ct1_A77 Transcriptional repressor CTCF; CCCTC-BINDING fact 99.21
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.21
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 99.21
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.21
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.21
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.21
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.21
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
1f2i_G73 Fusion of N-terminal 17-MER peptide extension to Z 99.21
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.21
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 99.21
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.21
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.21
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.21
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.21
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.21
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.21
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.2
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.2
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.2
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.2
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.2
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.2
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.2
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.2
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 99.19
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.19
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.19
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.19
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.19
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.19
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.19
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.19
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.19
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.19
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.19
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.19
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.19
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.19
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.19
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.18
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 99.18
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.18
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.18
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.18
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.18
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.18
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 99.17
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.17
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.17
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.17
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.15
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.15
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.15
2epa_A72 Krueppel-like factor 10; transforming growth facto 99.15
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.14
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.14
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.13
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 99.12
2eod_A66 TNF receptor-associated factor 4; zinc binding, NF 99.09
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.09
2ytn_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.08
2eq4_A46 Zinc finger protein 224; C2H2, zinc finger domain, 99.08
2eoq_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.08
2emk_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.08
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 99.08
2emx_A44 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2em0_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.07
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.07
2emm_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.07
2eov_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2ely_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.07
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.07
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 99.07
2eoe_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.07
2ep2_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.07
2ytq_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.07
2eml_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.06
2elz_A46 Zinc finger protein 224; DNA-binding, metal-bindin 99.06
2epz_A46 Zinc finger protein 28 homolog; C2H2, zinc finger 99.06
2ytj_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2emf_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.06
2el4_A46 Zinc finger protein 268; alternative splicing, DNA 99.06
2eop_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
2ene_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2ytr_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2eme_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.05
2ytk_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2ema_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2emp_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.05
2emy_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.05
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 99.05
2em7_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.05
2ytd_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.05
2ytm_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 99.05
2eq0_A46 Zinc finger protein 347; C2H2, zinc finger domain, 99.05
2em9_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2em5_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.04
2emh_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.04
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 99.04
2enc_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.04
2eoo_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2en1_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2eps_A54 POZ-, at HOOK-, and zinc finger-containing protein 99.03
2ctu_A73 Zinc finger protein 483; zinc finger domain, struc 99.03
2yso_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.03
2en8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.03
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 99.03
2epw_A46 Zinc finger protein 268; C2H2, zinc finger domain, 99.02
2el6_A46 Zinc finger protein 268; alternative splicing, DNA 99.02
2ysp_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.01
2en6_A46 Zinc finger protein 268; ZF-C2H2, structural genom 99.01
2yu8_A46 Zinc finger protein 347; ZF-C2H2, structural genom 99.01
2ep3_A46 Zinc finger protein 484; ZF-C2H2, structural genom 99.0
2ytg_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 99.0
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 99.0
2epx_A47 Zinc finger protein 28 homolog; C2H2, zinc finger 99.0
2em8_A46 Zinc finger protein 224; ZF-C2H2, structural genom 99.0
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.99
2em2_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.97
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.95
2yte_A42 Zinc finger protein 473; ZF-C2H2, structural genom 98.94
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.94
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.92
1yui_A54 GAGA-factor; complex (DNA-binding protein/DNA), ch 98.92
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.92
2el5_A42 Zinc finger protein 268; alternative splicing, DNA 98.92
2eq2_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.91
2enf_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.91
2ep1_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
2emj_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.91
2emg_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.91
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.91
2yti_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.9
2yth_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.9
2em4_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2em3_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.9
2epq_A45 POZ-, at HOOK-, and zinc finger-containing protein 98.9
2eow_A46 Zinc finger protein 347; ZF-C2H2, structural genom 98.89
2eoh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2em6_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.89
2ep0_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2en9_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.89
2ytt_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.89
2epr_A48 POZ-, at HOOK-, and zinc finger-containing protein 98.89
2yts_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.89
2ytf_A46 Zinc finger protein 268; ZF-C2H2, structural genom 98.89
2eor_A46 Zinc finger protein 224; ZF-C2H2, structural genom 98.89
2eq1_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.88
2emi_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.88
2en7_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.88
2ytp_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.88
2ent_A48 Krueppel-like factor 15; zinc binding, transcripti 98.88
2eon_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.87
2eof_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.87
2yrj_A46 Zinc finger protein 473; C2H2-type zinc finger, st 98.86
2ytb_A42 Zinc finger protein 32; zinc-finger domain, C2H2, 98.86
2yu5_A44 Zinc finger protein 473; ZF-C2H2 domain, structura 98.85
2eoz_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.85
2emz_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.85
2epc_A42 Zinc finger protein 32; zinc finger domain, C2H2, 98.85
2eoj_A44 Zinc finger protein 268; ZF-C2H2, structural genom 98.84
2eos_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.84
2yto_A46 Zinc finger protein 484; ZF-C2H2, structural genom 98.84
2eou_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.84
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.84
2en2_A42 B-cell lymphoma 6 protein; ZF-C2H2, structural gen 98.83
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.83
2emb_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.82
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.82
2enh_A46 Zinc finger protein 28 homolog; ZF-C2H2, structura 98.82
1vd4_A62 Transcription initiation factor IIE, alpha subunit 98.82
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.81
2eq3_A46 Zinc finger protein 347; C2H2, zinc finger domain, 98.81
2eoy_A46 Zinc finger protein 473; ZF-C2H2, structural genom 98.8
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.79
2epv_A44 Zinc finger protein 268; C2H2, zinc finger domain, 98.79
2eox_A44 Zinc finger protein 473; ZF-C2H2, structural genom 98.78
2yrm_A43 B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, 98.78
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.78
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.77
2eom_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.77
2ept_A41 Zinc finger protein 32; C2H2, zinc finger domain, 98.77
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.77
2en3_A46 ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, s 98.76
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.75
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.74
2epu_A45 Zinc finger protein 32; C2H2, zinc finger domain, 98.73
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.72
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.72
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.66
1x3c_A73 Zinc finger protein 292; DNA binding, nuclear prot 98.64
1njq_A39 Superman protein; zinc-finger, peptide-zinc comple 98.64
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.63
1rim_A33 E6APC2 peptide; E6-binding domain, zinc finger, hu 98.58
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.58
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.55
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.55
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.54
2elx_A35 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.52
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.5
2elo_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.5
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.5
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.49
1srk_A35 Zinc finger protein ZFPM1; classical zinc finger, 98.49
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.49
1x6f_A88 Zinc finger protein 462; zinc finger domain, KIAA1 98.48
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.48
2eln_A38 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.47
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.47
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.43
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.43
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.4
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.75
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.74
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.38
2elt_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.37
2elq_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.35
2elr_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.35
1bhi_A38 CRE-BP1, ATF-2; CRE binding protein, transcription 98.35
2els_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.34
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.34
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.33
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.33
1p7a_A37 BF3, BKLF, kruppel-like factor 3; classical zinc f 98.33
2elv_A36 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.33
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.31
1fv5_A36 First zinc finger of U-shaped; CCHC, protein inter 98.3
2d9k_A75 FLN29 gene product; zinc finger, ZF-TRAF, structur 98.29
2elp_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.28
2m0d_A30 Zinc finger and BTB domain-containing protein 17; 98.27
1ard_A29 Yeast transcription factor ADR1; transcription reg 98.27
1rik_A29 E6APC1 peptide; E6-binding domain, zinc finger, hu 98.24
1klr_A30 Zinc finger Y-chromosomal protein; transcription; 98.23
2m0e_A29 Zinc finger and BTB domain-containing protein 17; 98.2
2kvh_A27 Zinc finger and BTB domain-containing protein 32; 98.2
2m0f_A29 Zinc finger and BTB domain-containing protein 17; 98.19
2kvf_A28 Zinc finger and BTB domain-containing protein 32; 98.19
1zfd_A32 SWI5; DNA binding motif, zinc finger DNA binding d 98.18
2kvg_A27 Zinc finger and BTB domain-containing protein 32; 98.17
2elm_A37 Zinc finger protein 406; ZFAT zinc finger 1, struc 98.16
1sp2_A31 SP1F2; zinc finger, transcription activation; NMR 98.16
3iuf_A48 Zinc finger protein UBI-D4; structural genomics co 98.16
2epp_A66 POZ-, at HOOK-, and zinc finger-containing protein 98.16
2kfq_A32 FP1; protein, de novo protein; NMR {Synthetic} 98.16
1va1_A37 Transcription factor SP1; C2H2 type zinc finger, D 98.15
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 98.13
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.38
2lvt_A29 Zinc finger and BTB domain-containing protein 17; 97.38
1znf_A27 31ST zinc finger from XFIN; zinc finger DNA bindin 98.09
2lvr_A30 Zinc finger and BTB domain-containing protein 17; 97.37
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 98.06
1ncs_A47 Peptide M30F, transcriptional factor SWI5; DNA bin 98.04
1paa_A30 Yeast transcription factor ADR1; transcription reg 98.0
2lvu_A26 Zinc finger and BTB domain-containing protein 17; 97.24
1zw8_A64 Zinc-responsive transcriptional regulator ZAP1; in 97.99
2ab3_A29 ZNF29; zinc finger protein, beta BETA alpha, RREII 97.83
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 96.98
1zu1_A127 DSRBP-ZFA, RNA binding protein ZFA; zinc finger pr 95.9
1zr9_A124 Zinc finger protein 593; DNA binding, structural g 95.45
2e72_A49 POGO transposable element with ZNF domain; zinc fi 95.06
2e72_A49 POGO transposable element with ZNF domain; zinc fi 94.02
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 93.12
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 90.85
1fu9_A36 U-shaped transcriptional cofactor; zinc-finger, be 88.7
2jsp_A87 Transcriptional regulatory protein ROS; prokaryoti 88.06
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 86.89
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
Probab=99.89  E-value=1.5e-23  Score=129.92  Aligned_cols=94  Identities=28%  Similarity=0.501  Sum_probs=88.8

Q ss_pred             hhcCCCCccccCcchhccCChHHHHHHHHHhCCCCCccccCCccCcccCChHhHHHHHHHhCCCCCeeCccchhccCChH
Q psy17779         31 AKNQRPKKFNCPHCNVAFSNNGQLKGHIRIHTGERPYKCDAENCGKSFTRNEELTRHKRIHSGLRPYPCTHCGKKFGRKD  110 (141)
Q Consensus        31 ~~~~~~~~~~C~~C~~~f~~~~~l~~h~~~h~~~~~~~c~~~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~  110 (141)
                      ....|+++|.|.+|++.|.....|..|+++|.++++|.|.  .|++.|.....|..|++.|++++||.|..|++.|...+
T Consensus        15 ~~h~Gek~y~C~~C~k~F~~~~~L~~H~~~H~~~k~~~C~--~C~k~F~~~~~L~~H~~~H~~~k~~~C~~C~k~F~~~~   92 (133)
T 2lt7_A           15 LIVDGRVYYICIVCKRSYVCLTSLRRHFNIHSWEKKYPCR--YCEKVFPLAEYRTKHEIHHTGERRYQCLACGKSFINYQ   92 (133)
T ss_dssp             EEETTEEEEEETTTCCEESCHHHHHHHHHHHHCCSCEECS--SSSCEESSHHHHHHHHHHHHTCCCEEESSSCCEESSHH
T ss_pred             eecCCCcCeECCCCCCCcCCHHHHHHHHHHcCCCCCeeCC--ccCeecccccchhhhccccCCCccccCCCCCCCcCCHH
Confidence            3467899999999999999999999999999999999998  89999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhCCCCCcc
Q psy17779        111 HLKKHLRTHFPQPRYV  126 (141)
Q Consensus       111 ~l~~H~~~h~~~~~~~  126 (141)
                      .|..|+++|++++|+.
T Consensus        93 ~L~~H~~~hh~~~p~~  108 (133)
T 2lt7_A           93 FMSSHIKSVHSQDPSG  108 (133)
T ss_dssp             HHHHHHHHHTCCCTTS
T ss_pred             HHHHHhHHhcCCCCCC
Confidence            9999999999887654



>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2i13_A AART; DNA binding, zinc finger, DNA binding protein-DNA complex; 1.96A {Mus musculus} SCOP: k.12.1.1 PDB: 1mey_C* Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>1ubd_C Protein (YY1 zinc finger domain); transcription initiation, initiator element, zinc finger protein, DNA- protein recognition; HET: DNA; 2.50A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1znm_A* Back     alignment and structure
>2dlq_A GLI-kruppel family member HKR3; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2rpc_A Zinc finger protein ZIC 3; ZF-C2H2, zinc finger protein of the cerebellum 3, disease mutation, DNA-binding, metal-binding, nucleus, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2jp9_A Wilms tumor 1; DNA binding, nucleic acid recognition, X-RAY; HET: DNA; NMR {Homo sapiens} PDB: 2jpa_A* 2prt_A* Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2gli_A Protein (five-finger GLI); protein/DNA complex, transcription/DNA complex; HET: DNA; 2.60A {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1tf6_A Protein (transcription factor IIIA); complex (transcription regulation/DNA), RNA polymerase III, transcription initiation, zinc finger protein; HET: DNA; 3.10A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1tf3_A Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2lt7_A Transcriptional regulator kaiso; zinc finger, double helix, metal binding protein-DNA complex; HET: DNA; NMR {Homo sapiens} PDB: 4f6m_A* 4f6n_A* Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4gzn_C ZFP-57, zinc finger protein 57; transcription-DNA complex; HET: DNA 5CM; 0.99A {Mus musculus} Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2dlk_A Novel protein; ZF-C2H2 domain, zinc finger protein 692, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cot_A Zinc finger protein 435; ADK_LID domain, zinc finger and SCAN domain containing protein 16, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1a1h_A QGSR zinc finger peptide; complex (zinc finger/DNA), DNA-binding protein, transcription/DNA complex; HET: DNA; 1.60A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1jk2_A 1jk1_A 1a1g_A* 1a1f_A* 1a1i_A* 1a1j_A* 1a1k_A* 1aay_A* 1a1l_A* 1p47_A 1zaa_C* 1g2f_C 1g2d_C Back     alignment and structure
>2dmd_A Zinc finger protein 64, isoforms 1 and 2; ZNF338, nuclear protein, DNA- binding, transcription, C2H2-type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>2lce_A B-cell lymphoma 6 protein; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2ee8_A Protein ODD-skipped-related 2; zinc binding, ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: k.12.1.1 Back     alignment and structure
>2ghf_A ZHX1, zinc fingers and homeoboxes protein 1; C2H2 zinc fingers, 4-stranded parallel/anti-parallel beta- sheet, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2yt9_A Zinc finger-containing protein 1; C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>1x6h_A Transcriptional repressor CTCF; zinc finger protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>2kmk_A Zinc finger protein GFI-1; tandem repeat zinc finger domain, protein-DNA complex, DNA-B metal-binding, nucleus; HET: DNA; NMR {Rattus norvegicus} Back     alignment and structure
>2dmi_A Teashirt homolog 3; zinc finger protein 537, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2csh_A Zinc finger protein 297B; ZF-C2H2 domain, zinc finger and BTB domain containing protein 22B, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1wjp_A Zinc finger protein 295; ZF-C2H2 domain, zinc binding, nucleic acid binding, KIAA1227 protein, structural genomics; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x5w_A Zinc finger protein 64, isoforms 1; ZNF338, nuclear protein, DNA binding, transcription, C2H2 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ebt_A Krueppel-like factor 5; C2H2-type zinc-finger, metal BIND, transcription factor, kruppel-like factor, GC-box promoter elements, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2wbs_A Krueppel-like factor 4; transcription-DNA complex, DNA-binding, transcription, metal-binding, DNA, protein, nucleus, activator; 1.70A {Mus musculus} PDB: 2wbu_A Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>3uk3_C Zinc finger protein 217; transcription factor, DNA binding, DNA-metal BI protein complex; 2.10A {Homo sapiens} Back     alignment and structure
>1x6e_A Zinc finger protein 24; ZNF24, KOX17, ZNF191, zscan3, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bbo_A Human enhancer-binding protein MBP-1; DNA-binding protein; HET: ABA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 PDB: 3znf_A 4znf_A Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2lv2_A Insulinoma-associated protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1llm_C Chimera of ZIF23-GCN4; dimerization, DNA recognition, leucine zipper, X-RAY crystallography, structure-based design, zinc fingers; 1.50A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 PDB: 1xf7_A Back     alignment and structure
>2gqj_A Zinc finger protein KIAA1196; ZF-C2H2 like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2j7j_A Transcription factor IIIA; zinc finger module, alternative initiation, nuclear protein, phosphorylation, hydrophobic core, zinc, RNA-binding; 1.65A {Xenopus laevis} SCOP: g.37.1.1 g.37.1.1 g.37.1.1 PDB: 1un6_B 2hgh_A Back     alignment and structure
>2ctd_A Zinc finger protein 512; zinc binding, two ZF-C2H2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ej4_A Zinc finger protein ZIC 3; ZF-C2H2 domain, zinc binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2drp_A Protein (tramtrack DNA-binding domain); protein-DNA complex, double helix, transcription/DNA complex; HET: DNA; 2.80A {Drosophila melanogaster} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2adr_A ADR1; transcription regulation, zinc finger,; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2wbt_A B-129; zinc finger; 2.70A {Sulfolobus virus 1} Back     alignment and structure
>2d9h_A Zinc finger protein 692; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ct1_A Transcriptional repressor CTCF; CCCTC-BINDING factor, zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1f2i_G Fusion of N-terminal 17-MER peptide extension to ZIF12; zinc finger, dimer, protein-DNA complex, cooperativity, transcription/DNA complex; 2.35A {Mus musculus} SCOP: g.37.1.1 g.37.1.1 Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epa_A Krueppel-like factor 10; transforming growth factor-beta-inducible early growth response protein 1, TGFB-inducible early growth response protein 1; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eod_A TNF receptor-associated factor 4; zinc binding, NF-KB, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytn_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq4_A Zinc finger protein 224; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoq_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emk_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ysv_A Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emx_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em0_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2emm_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eov_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ely_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2ena_A 2en4_A Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eoe_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep2_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytq_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eml_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elz_A Zinc finger protein 224; DNA-binding, metal-binding, nuclear protein, phosphorylation, polymorphism, repeat, repressor, transcription; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epz_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytj_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emf_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el4_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eog_A 2em1_A 2emw_A 2eok_A Back     alignment and structure
>2eop_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ene_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytr_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eme_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytk_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ema_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2emc_A Back     alignment and structure
>2emp_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emy_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>2em7_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytd_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytm_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq0_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em9_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2yrh_A Back     alignment and structure
>2em5_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2emh_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2enc_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoo_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en1_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eps_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2ctu_A Zinc finger protein 483; zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yso_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epw_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2el6_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} Back     alignment and structure
>2ysp_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en6_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu8_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep3_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytg_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2epx_A Zinc finger protein 28 homolog; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em8_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em2_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yte_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1yui_A GAGA-factor; complex (DNA-binding protein/DNA), chromatin remodeling, DNA binding protein/DNA complex; HET: DNA; NMR {Drosophila melanogaster} SCOP: g.37.1.1 PDB: 1yuj_A* Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2el5_A Zinc finger protein 268; alternative splicing, DNA-binding, metal-binding, nuclear protein, repeat, transcription, transcription regulation; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eol_A 2emv_A 2eqw_A 2en0_A 2epy_A Back     alignment and structure
>2eq2_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2enf_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep1_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emj_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 PDB: 2eoi_A Back     alignment and structure
>2emg_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2yti_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yth_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em4_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2em3_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epq_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2eow_A Zinc finger protein 347; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2em6_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ep0_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en9_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytt_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epr_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2yts_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytf_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eor_A Zinc finger protein 224; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eq1_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emi_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2en7_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytp_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ent_A Krueppel-like factor 15; zinc binding, transcription factor, adipogenesis, CLCNKA, chloride channel Ka, rhodopsin, IRBP; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eon_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eof_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrj_A Zinc finger protein 473; C2H2-type zinc finger, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2ytb_A Zinc finger protein 32; zinc-finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yu5_A Zinc finger protein 473; ZF-C2H2 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eoz_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2emz_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2epc_A Zinc finger protein 32; zinc finger domain, C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yta_A Back     alignment and structure
>2eoj_A Zinc finger protein 268; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eos_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yto_A Zinc finger protein 484; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eou_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2en2_A B-cell lymphoma 6 protein; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2emb_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2enh_A Zinc finger protein 28 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>1vd4_A Transcription initiation factor IIE, alpha subunit; zinc finger; NMR {Homo sapiens} SCOP: g.41.3.1 Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eq3_A Zinc finger protein 347; C2H2, zinc finger domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eoy_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epv_A Zinc finger protein 268; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2eox_A Zinc finger protein 473; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2yrm_A B-cell lymphoma 6 protein; ZF-C2H2, zinc binding, DNA binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2eom_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ept_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2en3_A ZFP-95, zinc finger protein 95 homolog; ZF-C2H2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epu_A Zinc finger protein 32; C2H2, zinc finger domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: k.12.1.1 Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>1x3c_A Zinc finger protein 292; DNA binding, nuclear protein, C2H2-type zinc finger, KIAA0530, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1njq_A Superman protein; zinc-finger, peptide-zinc complex, beta-BETA-ALFA motif, metal binding protein; NMR {Synthetic} SCOP: g.37.1.3 PDB: 2l1o_A Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1rim_A E6APC2 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2elx_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>2elo_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>1srk_A Zinc finger protein ZFPM1; classical zinc finger, transcription; NMR {Mus musculus} SCOP: g.37.1.1 Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1x6f_A Zinc finger protein 462; zinc finger domain, KIAA1803, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2eln_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elt_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elq_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elr_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1bhi_A CRE-BP1, ATF-2; CRE binding protein, transcriptional activation domain, Zn finger, DNA-binding regulatory protein; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2els_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1p7a_A BF3, BKLF, kruppel-like factor 3; classical zinc finger, transcription factor, DNA binding protein; NMR {Mus musculus} SCOP: g.37.1.1 PDB: 1u85_A 1u86_A Back     alignment and structure
>2elv_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>1fv5_A First zinc finger of U-shaped; CCHC, protein interaction, transcription; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1y0j_B 2l6z_B Back     alignment and structure
>2d9k_A FLN29 gene product; zinc finger, ZF-TRAF, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2elp_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2m0d_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>1ard_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 PDB: 1arf_A 1are_A Back     alignment and structure
>1rik_A E6APC1 peptide; E6-binding domain, zinc finger, human papillomavirus, HPV E6 protein, de novo protein; NMR {Synthetic} SCOP: k.12.1.1 PDB: 1sp1_A 1va3_A Back     alignment and structure
>1klr_A Zinc finger Y-chromosomal protein; transcription; NMR {Synthetic} SCOP: g.37.1.1 PDB: 5znf_A 1kls_A 1xrz_A* 7znf_A Back     alignment and structure
>2m0e_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvh_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2m0f_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc fingers, transcription; NMR {Homo sapiens} Back     alignment and structure
>2kvf_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>1zfd_A SWI5; DNA binding motif, zinc finger DNA binding domain; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2kvg_A Zinc finger and BTB domain-containing protein 32; protein/DNA, metal-binding, transcription; NMR {Mus musculus} Back     alignment and structure
>2elm_A Zinc finger protein 406; ZFAT zinc finger 1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1sp2_A SP1F2; zinc finger, transcription activation; NMR {Homo sapiens} SCOP: g.37.1.1 PDB: 1va2_A Back     alignment and structure
>3iuf_A Zinc finger protein UBI-D4; structural genomics consortium (SGC), C2H2, APO metal-binding, nucleus, phosphoprotein, transcription, TRAN regulation; 1.80A {Homo sapiens} Back     alignment and structure
>2epp_A POZ-, at HOOK-, and zinc finger-containing protein 1; C2H2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.37.1.1 Back     alignment and structure
>2kfq_A FP1; protein, de novo protein; NMR {Synthetic} Back     alignment and structure
>1va1_A Transcription factor SP1; C2H2 type zinc finger, DNA-binding protein; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2lvt_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1znf_A 31ST zinc finger from XFIN; zinc finger DNA binding domain; NMR {Xenopus laevis} SCOP: g.37.1.1 Back     alignment and structure
>2lvr_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, classical zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1ncs_A Peptide M30F, transcriptional factor SWI5; DNA binding motif, transcription regulation, zinc-finger; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>1paa_A Yeast transcription factor ADR1; transcription regulation; NMR {Saccharomyces cerevisiae} SCOP: g.37.1.1 Back     alignment and structure
>2lvu_A Zinc finger and BTB domain-containing protein 17; C2H2 zinc finger, transcription; NMR {Homo sapiens} Back     alignment and structure
>1zw8_A Zinc-responsive transcriptional regulator ZAP1; interacting C2H2 zinc fingers, beta-BETA-alpha, solution structure; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2ab3_A ZNF29; zinc finger protein, beta BETA alpha, RREIIB-TR, RNA binding protein; NMR {Escherichia coli} SCOP: k.12.1.1 PDB: 2ab7_A Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>1zu1_A DSRBP-ZFA, RNA binding protein ZFA; zinc finger protein, helix-loop-helix, helix-turn-helix; NMR {Xenopus laevis} SCOP: g.37.1.4 g.37.1.4 Back     alignment and structure
>1zr9_A Zinc finger protein 593; DNA binding, structural genomics, PSI, protein structure initiative, center for eukaryotic structural genomics, CESG; NMR {Homo sapiens} SCOP: g.37.1.4 Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e72_A POGO transposable element with ZNF domain; zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>1fu9_A U-shaped transcriptional cofactor; zinc-finger, beta-hairpin + alpha-helix; NMR {Drosophila melanogaster} SCOP: g.37.1.2 PDB: 1jn7_A Back     alignment and structure
>2jsp_A Transcriptional regulatory protein ROS; prokaryotic Cys2His2 zinc finger, gene regulation; NMR {Agrobacterium tumefaciens} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 141
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 6e-13
d2csha153 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human 3e-06
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 4e-11
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 2e-09
d1x6ea133 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (H 9e-05
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 1e-10
d1p7aa_37 g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse ( 3e-09
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 5e-10
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 9e-06
d1zfda_32 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 0.004
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-10
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 5e-09
d1x6ha236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 0.004
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 3e-09
d1a1ia129 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) 3e-05
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 3e-09
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 6e-09
d2cota238 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-cont 0.002
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 3e-09
d2dlka236 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 2e-07
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 4e-09
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 2e-05
d2glia330 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo 4e-04
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 7e-09
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 3e-05
d1sp2a_31 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 6e-05
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 8e-09
d2ct1a236 g.37.1.1 (A:8-43) Transcriptional repressor CTCF { 2e-08
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 3e-08
d1ncsa_47 g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's ye 9e-04
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 4e-08
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 5e-08
d2epsa139 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [ 1e-04
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 4e-08
d1ubdc428 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger 8e-06
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 5e-08
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 2e-04
d1ubdc330 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger 0.004
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 1e-07
d1srka_35 g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {M 6e-07
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-07
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 2e-06
d1a1ia228 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) 5e-04
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 5e-07
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-06
d2adra129 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Sac 2e-05
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 1e-05
d1x6ea226 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human ( 3e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 1e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 5e-05
d1sp1a_29 g.37.1.1 (A:) Transcription factor sp1 {Human (Hom 8e-05
d1a1ia328 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) 5e-04
d1a1ia328 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) 9e-04
d1bhia_38 g.37.1.1 (A:) Transactivation domain of cre-bp1/at 7e-04
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure

class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 57.4 bits (138), Expect = 6e-13
 Identities = 27/56 (48%), Positives = 33/56 (58%), Gaps = 3/56 (5%)

Query: 64  ERPYKCDAENCGKSFTRNEELTRHKRIHSGLRPYPCTHCGKKFGRKDHLKKHLRTH 119
           ++ Y C    CGKSFT   +  RH  +H GLRPY C  CGKKF  K HL  H++ H
Sbjct: 1   DKLYPCQ---CGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH 53


>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 33 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Length = 37 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 32 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 29 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Length = 36 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 47 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Length = 39 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 28 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Length = 30 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 35 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Length = 29 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Length = 29 Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Length = 28 Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 38 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query141
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.6
d2csha153 Zinc finger protein 297b {Human (Homo sapiens) [Ta 99.56
d2cota238 Zinc finger and SCAN domain-containing protein 16, 99.4
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 99.38
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.32
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 99.27
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 99.24
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 99.21
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 99.2
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 99.16
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 99.16
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 99.14
d2epsa139 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 99.12
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 99.08
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.99
d1x6ea133 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.99
d1a1ia228 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.99
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.98
d2adra129 ADR1 {Synthetic, based on Saccharomyces cerevisiae 98.98
d1sp1a_29 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.96
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.93
d2cota238 Zinc finger and SCAN domain-containing protein 16, 98.93
d2dlka236 Zinc finger protein 692, ZNF692 {Human (Homo sapie 98.92
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.9
d1srka_35 Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musc 98.89
d1x6ha236 Transcriptional repressor CTCF {Human (Homo sapien 98.85
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.83
d1x6ea226 Zinc finger protein 24 {Human (Homo sapiens) [TaxI 98.83
d1sp2a_31 Transcription factor sp1 {Human (Homo sapiens) [Ta 98.8
d1ncsa_47 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.77
d2glia330 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.73
d1p7aa_37 Kruppel-like factor 3, Bklf {Mouse (Mus musculus) 98.71
d2ct1a236 Transcriptional repressor CTCF {Human (Homo sapien 98.7
d1ubdc330 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.68
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.64
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.63
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.48
d1a1ia129 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.47
d1zfda_32 SWI5 zinc-finger domains {Baker's yeast (Saccharom 98.44
d1ubdc428 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.41
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.38
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 98.28
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.26
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.22
d2dmda226 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 98.19
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 98.12
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 98.08
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 98.0
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.91
d2epqa132 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.89
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.83
d1a1ia328 ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} 97.78
d2epra135 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 97.77
d1ubdc228 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 97.75
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.74
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.73
d2dmda329 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.7
d1bboa128 Enhancer binding protein {Human (Homo sapiens) [Ta 97.63
d2glia529 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.6
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.53
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 97.45
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.44
d1njqa_37 SUPERMAN zinc finger domain {Thale cress (Arabidop 97.33
d1klra_30 ZFY {Human (Homo sapiens) [TaxId: 9606]} 97.31
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.23
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 97.23
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.22
d2dmda128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 97.21
d2j7ja229 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.2
d2dlqa427 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.16
d1znfa_26 XFIN, third domain {Xenopus laevis [TaxId: 8355]} 97.16
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 97.15
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.14
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 97.06
d1bboa229 Enhancer binding protein {Human (Homo sapiens) [Ta 97.05
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.98
d2dlqa330 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.98
d2glia431 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.97
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.87
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.64
d1tf3a230 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.58
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 96.56
d2dlqa228 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.53
d1bhia_38 Transactivation domain of cre-bp1/atf-2 {Human (Ho 96.39
d1x5wa229 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 96.38
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.27
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 96.26
d2csha244 Zinc finger protein 297b {Human (Homo sapiens) [Ta 96.22
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 96.21
d2adra231 ADR1 {Synthetic, based on Saccharomyces cerevisiae 96.17
d2dlqa126 GLI-Krueppel family member HKR3 {Mouse (Mus muscul 96.04
d2ctda230 Zinc finger protein 512, ZNF512 {Human (Homo sapie 95.69
d1tf3a131 Transcription factor IIIA, TFIIIA {Xenopus laevis 95.44
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.07
d2eppa153 PATZ1 {Human (Homo sapiens) [TaxId: 9606]} 95.06
d2glia233 Five-finger GLI1 {Human (Homo sapiens) [TaxId: 960 94.85
d1x6ha137 Transcriptional repressor CTCF {Human (Homo sapien 94.71
d1x5wa128 Zinc finger protein 64, ZFP68 {Human (Homo sapiens 94.67
d1ubdc128 Ying-yang 1 (yy1, zinc finger domain) {Human (Homo 94.22
d2ct1a128 Transcriptional repressor CTCF {Human (Homo sapien 94.18
d2drpa226 Tramtrack protein (two zinc-finger peptide) {Droso 93.92
d1y0jb136 U-shaped transcription factor, different fingers { 92.83
d2j7ja128 Transcription factor IIIA, TFIIIA {Xenopus laevis 92.19
d2dlka130 Zinc finger protein 692, ZNF692 {Human (Homo sapie 91.26
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 91.16
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 90.44
d2drpa137 Tramtrack protein (two zinc-finger peptide) {Droso 89.96
d1zr9a167 Zinc finger protein 593, ZNF593 {Human (Homo sapie 89.08
d1yuja_54 GAGA factor {Drosophila melanogaster [TaxId: 7227] 88.69
d1tf3a331 Transcription factor IIIA, TFIIIA {Xenopus laevis 83.14
d1fu9a_36 U-shaped transcription factor, different fingers { 80.67
>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: beta-beta-alpha zinc fingers
superfamily: beta-beta-alpha zinc fingers
family: Classic zinc finger, C2H2
domain: Zinc finger protein 297b
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.60  E-value=6.2e-16  Score=79.33  Aligned_cols=53  Identities=51%  Similarity=1.043  Sum_probs=37.0

Q ss_pred             CCCccccCCccCcccCChHhHHHHHHHhCCCCCeeCccchhccCChHHHHHHHHhh
Q psy17779         64 ERPYKCDAENCGKSFTRNEELTRHKRIHSGLRPYPCTHCGKKFGRKDHLKKHLRTH  119 (141)
Q Consensus        64 ~~~~~c~~~~C~~~~~~~~~l~~h~~~h~~~~~~~C~~C~~~f~~~~~l~~H~~~h  119 (141)
                      +++|.|   .||+.|.....|..|+++|++++||.|.+|+++|...+.|..|+++|
T Consensus         1 EK~y~C---~Cgk~F~~~~~l~~H~~~Ht~ekpy~C~~C~k~F~~~~~L~~H~r~H   53 (53)
T d2csha1           1 DKLYPC---QCGKSFTHKSQRDRHMSMHLGLRPYGCGVCGKKFKMKHHLVGHMKIH   53 (53)
T ss_dssp             CCCEEC---TTSCEESSHHHHHHHHHHHSCCCSEECTTTSCEESSSHHHHHHHTTT
T ss_pred             CcCCCC---CCCCeECCHHHhHHHhhccccccCCcCCCcCCEecCHHHHHHHHhcC
Confidence            356666   27777777777777777777777777777777777777777777665



>d2csha1 g.37.1.1 (A:8-60) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epsa1 g.37.1.1 (A:408-446) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea1 g.37.1.1 (A:8-40) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia2 g.37.1.1 (A:132-159) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra1 g.37.1.1 (A:102-130) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1sp1a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cota2 g.37.1.1 (A:7-44) Zinc finger and SCAN domain-containing protein 16, ZSCAN16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlka2 g.37.1.1 (A:38-73) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1srka_ g.37.1.1 (A:) Zinc finger protein ZFPM1 (FOG-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6ha2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ea2 g.37.1.1 (A:41-66) Zinc finger protein 24 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sp2a_ g.37.1.1 (A:) Transcription factor sp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncsa_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2glia3 g.37.1.1 (A:168-197) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p7aa_ g.37.1.1 (A:) Kruppel-like factor 3, Bklf {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ct1a2 g.37.1.1 (A:8-43) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc3 g.37.1.1 (C:351-380) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia1 g.37.1.1 (A:103-131) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zfda_ g.37.1.1 (A:) SWI5 zinc-finger domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ubdc4 g.37.1.1 (C:381-408) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda2 g.37.1.1 (A:8-33) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2epqa1 g.37.1.1 (A:380-411) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1a1ia3 g.37.1.1 (A:160-187) ZIF268 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2epra1 g.37.1.1 (A:350-384) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc2 g.37.1.1 (C:323-350) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2dmda3 g.37.1.1 (A:62-90) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bboa1 g.37.1.1 (A:1-28) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia5 g.37.1.1 (A:229-257) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1njqa_ g.37.1.3 (A:) SUPERMAN zinc finger domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1klra_ g.37.1.1 (A:) ZFY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dmda1 g.37.1.1 (A:34-61) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j7ja2 g.37.1.1 (A:29-57) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa4 g.37.1.1 (A:8-34) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znfa_ g.37.1.1 (A:) XFIN, third domain {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1bboa2 g.37.1.1 (A:29-57) Enhancer binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa3 g.37.1.1 (A:63-92) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2glia4 g.37.1.1 (A:198-228) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a2 g.37.1.1 (A:41-70) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa2 g.37.1.1 (A:35-62) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bhia_ g.37.1.1 (A:) Transactivation domain of cre-bp1/atf-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa2 g.37.1.1 (A:36-64) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2csha2 g.37.1.1 (A:61-104) Zinc finger protein 297b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adra2 g.37.1.1 (A:131-161) ADR1 {Synthetic, based on Saccharomyces cerevisiae sequence} Back     information, alignment and structure
>d2dlqa1 g.37.1.1 (A:93-118) GLI-Krueppel family member HKR3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ctda2 g.37.1.1 (A:61-90) Zinc finger protein 512, ZNF512 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tf3a1 g.37.1.1 (A:1-40) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2eppa1 g.37.1.1 (A:286-338) PATZ1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2glia2 g.37.1.1 (A:135-167) Five-finger GLI1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6ha1 g.37.1.1 (A:44-80) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5wa1 g.37.1.1 (A:8-35) Zinc finger protein 64, ZFP68 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ubdc1 g.37.1.1 (C:295-322) Ying-yang 1 (yy1, zinc finger domain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ct1a1 g.37.1.1 (A:44-71) Transcriptional repressor CTCF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa2 g.37.1.1 (A:140-165) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1y0jb1 g.37.1.2 (B:1-36) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2j7ja1 g.37.1.1 (A:1-28) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d2dlka1 g.37.1.1 (A:8-37) Zinc finger protein 692, ZNF692 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2drpa1 g.37.1.1 (A:103-139) Tramtrack protein (two zinc-finger peptide) {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1zr9a1 g.37.1.4 (A:28-94) Zinc finger protein 593, ZNF593 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yuja_ g.37.1.1 (A:) GAGA factor {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1tf3a3 g.37.1.1 (A:71-101) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]} Back     information, alignment and structure
>d1fu9a_ g.37.1.2 (A:) U-shaped transcription factor, different fingers {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure