Psyllid ID: psy17851


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60
MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIMCAY
ccccccccEEEEccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccc
ccHHcccccEEEccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
mtkaflkprikvgrdfvtkSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIMCAY
mtkaflkprikvgrdfvtksqtkeqVEFAVEAISKACYERMFRWLVNRINRSLDTIMCAY
MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIMCAY
*********IKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIMC**
MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRS*D******
MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIMCAY
MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIMCAY
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIMCAY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query60 2.2.26 [Sep-21-2011]
Q99323 2057 Myosin heavy chain, non-m yes N/A 0.9 0.026 0.907 3e-24
Q62812 1961 Myosin-9 OS=Rattus norveg yes N/A 0.883 0.027 0.698 3e-17
P35579 1960 Myosin-9 OS=Homo sapiens yes N/A 0.883 0.027 0.698 3e-17
Q8VDD5 1960 Myosin-9 OS=Mus musculus yes N/A 0.883 0.027 0.698 3e-17
Q258K2 1960 Myosin-9 OS=Canis familia yes N/A 0.883 0.027 0.698 3e-17
P14105 1959 Myosin-9 OS=Gallus gallus yes N/A 0.883 0.027 0.679 8e-17
O08638 1972 Myosin-11 OS=Mus musculus no N/A 0.883 0.026 0.641 2e-16
P35748 1972 Myosin-11 OS=Oryctolagus yes N/A 0.883 0.026 0.641 3e-16
Q63862 1327 Myosin-11 (Fragments) OS= no N/A 0.883 0.039 0.641 3e-16
P35749 1972 Myosin-11 OS=Homo sapiens no N/A 0.883 0.026 0.641 4e-16
>sp|Q99323|MYSN_DROME Myosin heavy chain, non-muscle OS=Drosophila melanogaster GN=zip PE=1 SV=2 Back     alignment and function desciption
 Score =  110 bits (274), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 49/54 (90%), Positives = 53/54 (98%)

Query: 1   MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLD 54
           MT+AFL PRIKVGRDFVTK+QTKEQVEFAVEAI+KACYERMF+WLVNRINRSLD
Sbjct: 484 MTRAFLTPRIKVGRDFVTKAQTKEQVEFAVEAIAKACYERMFKWLVNRINRSLD 537




Nonmuscle myosin appears to be responsible for cellularization. Required for morphogenesis and cytokinesis.
Drosophila melanogaster (taxid: 7227)
>sp|Q62812|MYH9_RAT Myosin-9 OS=Rattus norvegicus GN=Myh9 PE=1 SV=3 Back     alignment and function description
>sp|P35579|MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 Back     alignment and function description
>sp|Q8VDD5|MYH9_MOUSE Myosin-9 OS=Mus musculus GN=Myh9 PE=1 SV=4 Back     alignment and function description
>sp|Q258K2|MYH9_CANFA Myosin-9 OS=Canis familiaris GN=MYH9 PE=2 SV=1 Back     alignment and function description
>sp|P14105|MYH9_CHICK Myosin-9 OS=Gallus gallus GN=MYH9 PE=2 SV=1 Back     alignment and function description
>sp|O08638|MYH11_MOUSE Myosin-11 OS=Mus musculus GN=Myh11 PE=1 SV=1 Back     alignment and function description
>sp|P35748|MYH11_RABIT Myosin-11 OS=Oryctolagus cuniculus GN=MYH11 PE=2 SV=2 Back     alignment and function description
>sp|Q63862|MYH11_RAT Myosin-11 (Fragments) OS=Rattus norvegicus GN=Myh11 PE=2 SV=3 Back     alignment and function description
>sp|P35749|MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query60
322789355 1714 hypothetical protein SINV_10357 [Solenop 0.9 0.031 0.981 1e-24
307214547 1830 Myosin heavy chain, non-muscle [Harpegna 0.9 0.029 0.981 1e-24
242014184 1968 myosin-9, putative [Pediculus humanus co 0.9 0.027 0.981 1e-24
345486457 1882 PREDICTED: LOW QUALITY PROTEIN: myosin h 0.9 0.028 0.981 1e-24
383850896 1968 PREDICTED: myosin heavy chain, non-muscl 0.9 0.027 0.981 2e-24
340711723 1979 PREDICTED: myosin heavy chain, non-muscl 0.9 0.027 0.981 2e-24
380023226 1967 PREDICTED: LOW QUALITY PROTEIN: myosin h 0.9 0.027 0.981 2e-24
328790487 1967 PREDICTED: myosin heavy chain, non-muscl 0.9 0.027 0.981 2e-24
340711721 1969 PREDICTED: myosin heavy chain, non-muscl 0.9 0.027 0.981 2e-24
350412852 1967 PREDICTED: myosin heavy chain, non-muscl 0.9 0.027 0.981 2e-24
>gi|322789355|gb|EFZ14667.1| hypothetical protein SINV_10357 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  117 bits (292), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 53/54 (98%), Positives = 54/54 (100%)

Query: 1   MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLD 54
           MTKAFLKPRIKVGRDFVTK+QTKEQVEFAVEAISKACYERMFRWLVNRINRSLD
Sbjct: 169 MTKAFLKPRIKVGRDFVTKAQTKEQVEFAVEAISKACYERMFRWLVNRINRSLD 222




Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|307214547|gb|EFN89532.1| Myosin heavy chain, non-muscle [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|242014184|ref|XP_002427775.1| myosin-9, putative [Pediculus humanus corporis] gi|212512229|gb|EEB15037.1| myosin-9, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|345486457|ref|XP_003425478.1| PREDICTED: LOW QUALITY PROTEIN: myosin heavy chain, non-muscle [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383850896|ref|XP_003701010.1| PREDICTED: myosin heavy chain, non-muscle-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340711723|ref|XP_003394420.1| PREDICTED: myosin heavy chain, non-muscle-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|380023226|ref|XP_003695426.1| PREDICTED: LOW QUALITY PROTEIN: myosin heavy chain, non-muscle-like [Apis florea] Back     alignment and taxonomy information
>gi|328790487|ref|XP_623323.3| PREDICTED: myosin heavy chain, non-muscle [Apis mellifera] Back     alignment and taxonomy information
>gi|340711721|ref|XP_003394419.1| PREDICTED: myosin heavy chain, non-muscle-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350412852|ref|XP_003489788.1| PREDICTED: myosin heavy chain, non-muscle-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query60
WB|WBGene00003776 1963 nmy-1 [Caenorhabditis elegans 0.9 0.027 0.722 2.1e-15
ZFIN|ZDB-GENE-030616-162 1992 myh10 "myosin, heavy chain 10, 0.883 0.026 0.716 3.4e-15
ZFIN|ZDB-GENE-091112-18 1686 si:ch211-150d5.2 "si:ch211-150 0.883 0.031 0.735 3.6e-15
UNIPROTKB|F1P312 1861 MYH10 "Uncharacterized protein 0.883 0.028 0.716 4.1e-15
UNIPROTKB|F1SSA6 1864 LOC396903 "Uncharacterized pro 0.883 0.028 0.716 4.1e-15
UNIPROTKB|F1P313 1871 MYH10 "Uncharacterized protein 0.883 0.028 0.716 4.1e-15
UNIPROTKB|F1P314 1882 MYH10 "Uncharacterized protein 0.883 0.028 0.716 4.1e-15
UNIPROTKB|F1NGG0 1892 MYH10 "Uncharacterized protein 0.883 0.028 0.716 4.1e-15
ZFIN|ZDB-GENE-030131-5870 1964 myh9a "myosin, heavy polypepti 0.883 0.026 0.735 4.3e-15
UNIPROTKB|Q27991 1976 MYH10 "Myosin-10" [Bos taurus 0.883 0.026 0.716 4.4e-15
WB|WBGene00003776 nmy-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 210 (79.0 bits), Expect = 2.1e-15, P = 2.1e-15
 Identities = 39/54 (72%), Positives = 48/54 (88%)

Query:     1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLD 54
             + KAFL+PRIKVGR+FV K+Q +EQ EFAVEAI+KA YER+F+WLV RIN+SLD
Sbjct:   399 LQKAFLRPRIKVGREFVNKAQNQEQAEFAVEAIAKASYERLFKWLVTRINKSLD 452




GO:0003774 "motor activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0016459 "myosin complex" evidence=IEA
GO:0009792 "embryo development ending in birth or egg hatching" evidence=IMP
GO:0010171 "body morphogenesis" evidence=IMP
GO:0040011 "locomotion" evidence=IMP
GO:0000003 "reproduction" evidence=IMP
GO:0040002 "collagen and cuticulin-based cuticle development" evidence=IMP
GO:0040007 "growth" evidence=IMP
GO:0002119 "nematode larval development" evidence=IGI;IMP
GO:0016476 "regulation of embryonic cell shape" evidence=IGI;IMP
GO:0008104 "protein localization" evidence=IMP
GO:0043292 "contractile fiber" evidence=IDA
GO:0005913 "cell-cell adherens junction" evidence=IDA
ZFIN|ZDB-GENE-030616-162 myh10 "myosin, heavy chain 10, non-muscle" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091112-18 si:ch211-150d5.2 "si:ch211-150d5.2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1P312 MYH10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SSA6 LOC396903 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1P313 MYH10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1P314 MYH10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NGG0 MYH10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-5870 myh9a "myosin, heavy polypeptide 9a, non-muscle" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q27991 MYH10 "Myosin-10" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P35748MYH11_RABITNo assigned EC number0.64150.88330.0268yesN/A
Q62812MYH9_RATNo assigned EC number0.69810.88330.0270yesN/A
Q258K2MYH9_CANFANo assigned EC number0.69810.88330.0270yesN/A
Q8VDD5MYH9_MOUSENo assigned EC number0.69810.88330.0270yesN/A
Q99323MYSN_DROMENo assigned EC number0.90740.90.0262yesN/A
P14105MYH9_CHICKNo assigned EC number0.67920.88330.0270yesN/A
P35579MYH9_HUMANNo assigned EC number0.69810.88330.0270yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query60
cd01377 693 cd01377, MYSc_type_II, Myosin motor domain, type I 3e-30
pfam00063 679 pfam00063, Myosin_head, Myosin head (motor domain) 4e-20
smart00242 677 smart00242, MYSc, Myosin 5e-19
COG5022 1463 COG5022, COG5022, Myosin heavy chain [Cytoskeleton 3e-12
cd00124 679 cd00124, MYSc, Myosin motor domain 3e-11
cd01378 674 cd01378, MYSc_type_I, Myosin motor domain, type I 3e-09
cd01380 691 cd01380, MYSc_type_V, Myosin motor domain, type V 3e-07
cd01384 674 cd01384, MYSc_type_XI, Myosin motor domain, plant- 3e-06
cd01383 677 cd01383, MYSc_type_VIII, Myosin motor domain, plan 1e-05
cd01379 653 cd01379, MYSc_type_III, Myosin motor domain, type 2e-05
cd01382 717 cd01382, MYSc_type_VI, Myosin motor domain, type V 4e-04
PTZ00014 821 PTZ00014, PTZ00014, myosin-A; Provisional 0.001
cd01381 671 cd01381, MYSc_type_VII, Myosin motor domain, type 0.003
>gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins Back     alignment and domain information
 Score =  109 bits (276), Expect = 3e-30
 Identities = 35/55 (63%), Positives = 44/55 (80%)

Query: 1   MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDT 55
           + KA L PRIKVGR++VTK Q  EQV F+V A++KA YER+F WLV RIN++LDT
Sbjct: 314 LLKALLHPRIKVGREWVTKGQNVEQVSFSVGALAKALYERLFLWLVKRINKTLDT 368


Myosin II mediates cortical contraction in cell motility, and is the motor in smooth and skeletal muscle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 693

>gnl|CDD|215687 pfam00063, Myosin_head, Myosin head (motor domain) Back     alignment and domain information
>gnl|CDD|214580 smart00242, MYSc, Myosin Back     alignment and domain information
>gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238071 cd00124, MYSc, Myosin motor domain Back     alignment and domain information
>gnl|CDD|238674 cd01378, MYSc_type_I, Myosin motor domain, type I myosins Back     alignment and domain information
>gnl|CDD|238676 cd01380, MYSc_type_V, Myosin motor domain, type V myosins Back     alignment and domain information
>gnl|CDD|238680 cd01384, MYSc_type_XI, Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>gnl|CDD|238679 cd01383, MYSc_type_VIII, Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information
>gnl|CDD|238675 cd01379, MYSc_type_III, Myosin motor domain, type III myosins Back     alignment and domain information
>gnl|CDD|238678 cd01382, MYSc_type_VI, Myosin motor domain, type VI myosins Back     alignment and domain information
>gnl|CDD|240229 PTZ00014, PTZ00014, myosin-A; Provisional Back     alignment and domain information
>gnl|CDD|238677 cd01381, MYSc_type_VII, Myosin motor domain, type VII myosins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 60
PTZ00014 821 myosin-A; Provisional 99.73
cd01381 671 MYSc_type_VII Myosin motor domain, type VII myosin 99.72
cd01385 692 MYSc_type_IX Myosin motor domain, type IX myosins. 99.72
COG5022 1463 Myosin heavy chain [Cytoskeleton] 99.72
cd01379 653 MYSc_type_III Myosin motor domain, type III myosin 99.72
cd01383 677 MYSc_type_VIII Myosin motor domain, plant-specific 99.72
cd01380 691 MYSc_type_V Myosin motor domain, type V myosins. M 99.72
cd01377 693 MYSc_type_II Myosin motor domain, type II myosins. 99.71
cd01387 677 MYSc_type_XV Myosin motor domain, type XV myosins. 99.71
cd01384 674 MYSc_type_XI Myosin motor domain, plant-specific t 99.7
KOG0164|consensus 1001 99.69
cd00124 679 MYSc Myosin motor domain. This catalytic (head) do 99.69
cd01378 674 MYSc_type_I Myosin motor domain, type I myosins. M 99.68
PF00063 689 Myosin_head: Myosin head (motor domain); InterPro: 99.68
smart00242 677 MYSc Myosin. Large ATPases. ATPase; molecular moto 99.67
cd01382 717 MYSc_type_VI Myosin motor domain, type VI myosins. 99.65
KOG0162|consensus 1106 99.58
cd01386 767 MYSc_type_XVIII Myosin motor domain, type XVIII my 99.52
KOG0163|consensus 1259 99.45
KOG0160|consensus 862 99.38
KOG4229|consensus 1062 99.22
KOG0161|consensus 1930 99.22
>PTZ00014 myosin-A; Provisional Back     alignment and domain information
Probab=99.73  E-value=5.8e-18  Score=122.91  Aligned_cols=58  Identities=21%  Similarity=0.439  Sum_probs=54.3

Q ss_pred             CccccccceEEeCceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccccc
Q psy17851          1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIMC   58 (60)
Q Consensus         1 l~~aL~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~~   58 (60)
                      |.++|+++++.+|||.+.++++++||..+||||||+||+|||+|||.+||.+|.++++
T Consensus       402 L~~~L~~~~~~~~~e~i~~~~~~~qA~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~~  459 (821)
T PTZ00014        402 LKKELTVKVTYAGNQKIEGPWSKDESEMLKDSLSKAVYEKLFLWIIRNLNATIEPPGG  459 (821)
T ss_pred             HHHHhhceEEEeCCeeEecCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcc
Confidence            4578999999999999999999999999999999999999999999999999987543



>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins Back     alignment and domain information
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins Back     alignment and domain information
>COG5022 Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>cd01379 MYSc_type_III Myosin motor domain, type III myosins Back     alignment and domain information
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information
>cd01380 MYSc_type_V Myosin motor domain, type V myosins Back     alignment and domain information
>cd01377 MYSc_type_II Myosin motor domain, type II myosins Back     alignment and domain information
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins Back     alignment and domain information
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>KOG0164|consensus Back     alignment and domain information
>cd00124 MYSc Myosin motor domain Back     alignment and domain information
>cd01378 MYSc_type_I Myosin motor domain, type I myosins Back     alignment and domain information
>PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>smart00242 MYSc Myosin Back     alignment and domain information
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins Back     alignment and domain information
>KOG0163|consensus Back     alignment and domain information
>KOG0160|consensus Back     alignment and domain information
>KOG4229|consensus Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query60
2ycu_A 995 Crystal Structure Of Human Non Muscle Myosin 2c In 2e-17
1i84_S 1184 Cryo-Em Structure Of The Heavy Meromyosin Subfragme 7e-16
1br2_A 791 Smooth Muscle Myosin Motor Domain Complexed With Mg 1e-15
1br1_A 820 Smooth Muscle Myosin Motor Domain-Essential Light C 1e-15
3dtp_B 973 Tarantula Heavy Meromyosin Obtained By Flexible Doc 1e-15
3dtp_A 971 Tarantula Heavy Meromyosin Obtained By Flexible Doc 1e-15
3j04_A 909 Em Structure Of The Heavy Meromyosin Subfragment Of 1e-15
2ec6_A 838 Placopecten Striated Muscle Myosin Ii Length = 838 3e-13
2os8_A 840 Rigor-Like Structures Of Muscle Myosins Reveal Key 3e-13
2w4g_M 840 Isometrically Contracting Insect Asynchronous Fligh 2e-12
3i5g_A 839 Crystal Structure Of Rigor-Like Squid Myosin S1 Len 2e-12
1qvi_A 840 Crystal Structure Of Scallop Myosin S1 In The Pre-P 2e-12
1kk7_A 837 Scallop Myosin In The Near Rigor Conformation Lengt 2e-12
1b7t_A 835 Myosin Digested By Papain Length = 835 2e-12
1dfk_A 830 Nucleotide-Free Scallop Myosin S1-Near Rigor State 2e-12
1dfl_A 831 Scallop Myosin S1 Complexed With Mgadp:vanadate-Tra 2e-12
4db1_A 783 Cardiac Human Myosin S1dc, Beta Isoform Complexed W 6e-12
2mys_A 843 Myosin Subfragment-1, Alpha Carbon Coordinates Only 3e-08
1m8q_A 840 Molecular Models Of Averaged Rigor Crossbridges Fro 3e-08
1mmd_A 762 Truncated Head Of Myosin From Dictyostelium Discoid 7e-07
1lvk_A 762 X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N 2e-06
1mmg_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 2e-06
1mmn_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 2e-06
3mkd_A 692 Crystal Structure Of Myosin-2 Dictyostelium Discoid 2e-06
3mnq_A 788 Crystal Structure Of Myosin-2 Motor Domain In Compl 2e-06
2jhr_A 788 Crystal Structure Of Myosin-2 Motor Domain In Compl 2e-06
2xel_A 776 Molecular Mechanism Of Pentachloropseudilin Mediate 2e-06
1yv3_A 762 The Structural Basis Of Blebbistatin Inhibition And 2e-06
3myh_X 762 Insights Into The Importance Of Hydrogen Bonding In 2e-06
1fmv_A 761 Crystal Structure Of The Apo Motor Domain Of Dictyo 2e-06
1w9l_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 2e-06
1w9i_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 2e-06
1w9j_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 2e-06
1w9k_A 770 Dictyostelium Discoideum Myosin Ii Motor Domain S45 2e-06
1g8x_A 1010 Structure Of A Genetically Engineered Molecular Mot 2e-06
1d0x_A 761 Dictyostelium Myosin S1dc (Motor Domain Fragment) C 2e-06
1mma_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 2e-06
2aka_A 776 Structure Of The Nucleotide-Free Myosin Ii Motor Do 2e-06
1jwy_A 776 Crystal Structure Of The Dynamin A Gtpase Domain Co 2e-06
2y9e_X 758 Structural Basis For The Allosteric Interference Of 2e-06
2y0r_X 758 Structural Basis For The Allosteric Interference Of 2e-06
2x9h_A 695 Crystal Structure Of Myosin-2 Motor Domain In Compl 4e-06
2xo8_A 776 Crystal Structure Of Myosin-2 In Complex With Tribr 4e-06
>pdb|2YCU|A Chain A, Crystal Structure Of Human Non Muscle Myosin 2c In Pre-power Stroke State Length = 995 Back     alignment and structure

Iteration: 1

Score = 83.6 bits (205), Expect = 2e-17, Method: Composition-based stats. Identities = 36/53 (67%), Positives = 47/53 (88%) Query: 2 TKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLD 54 ++A L PRIKVGRD+V K+QTKEQ +FA+EA++KA YER+FRWLV R+NR+LD Sbjct: 367 SRALLTPRIKVGRDYVQKAQTKEQADFALEALAKATYERLFRWLVLRLNRALD 419
>pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184 Back     alignment and structure
>pdb|1BR2|A Chain A, Smooth Muscle Myosin Motor Domain Complexed With Mgadp.Alf4 Length = 791 Back     alignment and structure
>pdb|1BR1|A Chain A, Smooth Muscle Myosin Motor Domain-Essential Light Chain Complex With Mgadp.Alf4 Bound At The Active Site Length = 820 Back     alignment and structure
>pdb|3DTP|B Chain B, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 973 Back     alignment and structure
>pdb|3DTP|A Chain A, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 971 Back     alignment and structure
>pdb|3J04|A Chain A, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 909 Back     alignment and structure
>pdb|2EC6|A Chain A, Placopecten Striated Muscle Myosin Ii Length = 838 Back     alignment and structure
>pdb|2OS8|A Chain A, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 840 Back     alignment and structure
>pdb|3I5G|A Chain A, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 839 Back     alignment and structure
>pdb|1QVI|A Chain A, Crystal Structure Of Scallop Myosin S1 In The Pre-Power Stroke State To 2.6 Angstrom Resolution: Flexibility And Function In The Head Length = 840 Back     alignment and structure
>pdb|1KK7|A Chain A, Scallop Myosin In The Near Rigor Conformation Length = 837 Back     alignment and structure
>pdb|1B7T|A Chain A, Myosin Digested By Papain Length = 835 Back     alignment and structure
>pdb|1DFK|A Chain A, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 830 Back     alignment and structure
>pdb|1DFL|A Chain A, Scallop Myosin S1 Complexed With Mgadp:vanadate-Transition State Length = 831 Back     alignment and structure
>pdb|4DB1|A Chain A, Cardiac Human Myosin S1dc, Beta Isoform Complexed With Mn-Amppnp Length = 783 Back     alignment and structure
>pdb|2MYS|A Chain A, Myosin Subfragment-1, Alpha Carbon Coordinates Only For The Two Light Chains Length = 843 Back     alignment and structure
>pdb|1M8Q|A Chain A, Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle Length = 840 Back     alignment and structure
>pdb|1MMD|A Chain A, Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mgadp-Bef3 Length = 762 Back     alignment and structure
>pdb|1LVK|A Chain A, X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N- Methylanthraniloyl) Nucleotide Bound To Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1MMG|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1MMN|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|3MKD|A Chain A, Crystal Structure Of Myosin-2 Dictyostelium Discoideum Motor Domain S456y Mutant In Complex With Adp-Orthovanadate Length = 692 Back     alignment and structure
>pdb|3MNQ|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp- Metavanadate And Resveratrol Length = 788 Back     alignment and structure
>pdb|2JHR|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentabromopseudilin Length = 788 Back     alignment and structure
>pdb|2XEL|A Chain A, Molecular Mechanism Of Pentachloropseudilin Mediated Inhibition Of Myosin Motor Activity Length = 776 Back     alignment and structure
>pdb|1YV3|A Chain A, The Structural Basis Of Blebbistatin Inhibition And Specificity For Myosin Ii Length = 762 Back     alignment and structure
>pdb|3MYH|X Chain X, Insights Into The Importance Of Hydrogen Bonding In The Gamma- Phosphate Binding Pocket Of Myosin: Structural And Functional Studies Of Ser236 Length = 762 Back     alignment and structure
>pdb|1FMV|A Chain A, Crystal Structure Of The Apo Motor Domain Of Dictyostellium Myosin Ii Length = 761 Back     alignment and structure
>pdb|1W9L|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456e Bound With Mgadp-Alf4 Length = 770 Back     alignment and structure
>pdb|1W9I|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Befx Length = 770 Back     alignment and structure
>pdb|1W9J|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Alf4 Length = 770 Back     alignment and structure
>pdb|1W9K|A Chain A, Dictyostelium Discoideum Myosin Ii Motor Domain S456e With Bound Mgadp-Befx Length = 770 Back     alignment and structure
>pdb|1G8X|A Chain A, Structure Of A Genetically Engineered Molecular Motor Length = 1010 Back     alignment and structure
>pdb|1D0X|A Chain A, Dictyostelium Myosin S1dc (Motor Domain Fragment) Complexed With M-Nitrophenyl Aminoethyldiphosphate Beryllium Trifluoride. Length = 761 Back     alignment and structure
>pdb|1MMA|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|2AKA|A Chain A, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 776 Back     alignment and structure
>pdb|1JWY|A Chain A, Crystal Structure Of The Dynamin A Gtpase Domain Complexed With Gdp, Determined As Myosin Fusion Length = 776 Back     alignment and structure
>pdb|2Y9E|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 Back     alignment and structure
>pdb|2Y0R|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 Back     alignment and structure
>pdb|2X9H|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentachlorocarbazole Length = 695 Back     alignment and structure
>pdb|2XO8|A Chain A, Crystal Structure Of Myosin-2 In Complex With Tribromodichloropseudilin Length = 776 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query60
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 4e-25
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 4e-24
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 9e-24
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 1e-23
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 1e-23
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 3e-23
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 9e-23
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 6e-22
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 5e-21
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 3e-19
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Length = 783 Back     alignment and structure
 Score = 94.6 bits (236), Expect = 4e-25
 Identities = 28/55 (50%), Positives = 39/55 (70%)

Query: 1   MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDT 55
           + K    PR+KVG ++VTK Q  +QV +A  A++KA YERMF W+V RIN +L+T
Sbjct: 395 LLKGLCHPRVKVGNEYVTKGQNVQQVIYATGALAKAVYERMFNWMVTRINATLET 449


>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Length = 770 Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Length = 795 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Length = 697 Back     alignment and structure
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Length = 784 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query60
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 99.77
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 99.75
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 99.74
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 99.74
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 99.74
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 99.73
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 99.73
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 99.72
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 99.71
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 99.7
4anj_A 1052 Unconventional myosin-VI, green fluorescent prote; 99.65
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Back     alignment and structure
Probab=99.77  E-value=4e-19  Score=127.44  Aligned_cols=57  Identities=21%  Similarity=0.440  Sum_probs=54.1

Q ss_pred             CccccccceEEeCceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccc
Q psy17851          1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIM   57 (60)
Q Consensus         1 l~~aL~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~   57 (60)
                      |.++|++|++.++||.+.++++++||.++||||||+||+|||+|||.+||.+|..+.
T Consensus       371 L~~aL~~~~~~~~~e~v~~~~~~~qA~~~rdalaK~lY~rLF~wlV~~IN~~l~~~~  427 (795)
T 1w7j_A          371 MAHWLCHRKLATATETYIKPISKLHAINARDALAKHIYANLFNWIVDHVNKALHSTV  427 (795)
T ss_dssp             HHHHHSEEEEECSSCEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCSS
T ss_pred             HHHHhcccEEEeCCceecCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCc
Confidence            457899999999999999999999999999999999999999999999999998764



>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Back     alignment and structure
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Back     alignment and structure
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Back     alignment and structure
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 60
d1d0xa2 712 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain 2e-11
d1kk8a2 789 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain 4e-11
d2mysa2 794 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain 6e-11
d1w7ja2 730 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chick 2e-10
d1br2a2 710 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chick 3e-10
d1lkxa_ 684 c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli 1e-07
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Length = 712 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Dictyostelium discoideum [TaxId: 44689]
 Score = 54.3 bits (130), Expect = 2e-11
 Identities = 22/55 (40%), Positives = 32/55 (58%)

Query: 1   MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDT 55
           + KA ++PRI  GRD V +    E+   + +A+ KA Y R+F WLV +IN  L  
Sbjct: 342 LEKALMEPRILAGRDLVAQHLNVEKSSSSRDALVKALYGRLFLWLVKKINNVLCQ 396


>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Length = 730 Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 710 Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query60
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 99.69
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 99.65
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 99.64
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 99.64
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 99.63
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 99.56
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Dictyostelium discoideum [TaxId: 44689]
Probab=99.69  E-value=9e-18  Score=117.51  Aligned_cols=57  Identities=39%  Similarity=0.635  Sum_probs=53.6

Q ss_pred             CccccccceEEeCceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccc
Q psy17851          1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIM   57 (60)
Q Consensus         1 l~~aL~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~   57 (60)
                      |.++|+++.+.++||.+.++++++||.++||+|||+||+|||+|||.+||.+|.+..
T Consensus       342 L~~~L~~~~~~~~~e~i~~~l~~~~A~~~rdalaK~LY~~LF~wiV~~IN~~l~~~~  398 (712)
T d1d0xa2         342 LEKALMEPRILAGRDLVAQHLNVEKSSSSRDALVKALYGRLFLWLVKKINNVLCQER  398 (712)
T ss_dssp             HHHHHHSCEEEETTEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCSC
T ss_pred             hhhhhcceeeccCCceEEecCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcccCc
Confidence            357899999999999999999999999999999999999999999999999998754



>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure