Psyllid ID: psy17851
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 60 | ||||||
| 322789355 | 1714 | hypothetical protein SINV_10357 [Solenop | 0.9 | 0.031 | 0.981 | 1e-24 | |
| 307214547 | 1830 | Myosin heavy chain, non-muscle [Harpegna | 0.9 | 0.029 | 0.981 | 1e-24 | |
| 242014184 | 1968 | myosin-9, putative [Pediculus humanus co | 0.9 | 0.027 | 0.981 | 1e-24 | |
| 345486457 | 1882 | PREDICTED: LOW QUALITY PROTEIN: myosin h | 0.9 | 0.028 | 0.981 | 1e-24 | |
| 383850896 | 1968 | PREDICTED: myosin heavy chain, non-muscl | 0.9 | 0.027 | 0.981 | 2e-24 | |
| 340711723 | 1979 | PREDICTED: myosin heavy chain, non-muscl | 0.9 | 0.027 | 0.981 | 2e-24 | |
| 380023226 | 1967 | PREDICTED: LOW QUALITY PROTEIN: myosin h | 0.9 | 0.027 | 0.981 | 2e-24 | |
| 328790487 | 1967 | PREDICTED: myosin heavy chain, non-muscl | 0.9 | 0.027 | 0.981 | 2e-24 | |
| 340711721 | 1969 | PREDICTED: myosin heavy chain, non-muscl | 0.9 | 0.027 | 0.981 | 2e-24 | |
| 350412852 | 1967 | PREDICTED: myosin heavy chain, non-muscl | 0.9 | 0.027 | 0.981 | 2e-24 |
| >gi|322789355|gb|EFZ14667.1| hypothetical protein SINV_10357 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
Score = 117 bits (292), Expect = 1e-24, Method: Compositional matrix adjust.
Identities = 53/54 (98%), Positives = 54/54 (100%)
Query: 1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLD 54
MTKAFLKPRIKVGRDFVTK+QTKEQVEFAVEAISKACYERMFRWLVNRINRSLD
Sbjct: 169 MTKAFLKPRIKVGRDFVTKAQTKEQVEFAVEAISKACYERMFRWLVNRINRSLD 222
|
Source: Solenopsis invicta Species: Solenopsis invicta Genus: Solenopsis Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|307214547|gb|EFN89532.1| Myosin heavy chain, non-muscle [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|242014184|ref|XP_002427775.1| myosin-9, putative [Pediculus humanus corporis] gi|212512229|gb|EEB15037.1| myosin-9, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|345486457|ref|XP_003425478.1| PREDICTED: LOW QUALITY PROTEIN: myosin heavy chain, non-muscle [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|383850896|ref|XP_003701010.1| PREDICTED: myosin heavy chain, non-muscle-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|340711723|ref|XP_003394420.1| PREDICTED: myosin heavy chain, non-muscle-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|380023226|ref|XP_003695426.1| PREDICTED: LOW QUALITY PROTEIN: myosin heavy chain, non-muscle-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328790487|ref|XP_623323.3| PREDICTED: myosin heavy chain, non-muscle [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|340711721|ref|XP_003394419.1| PREDICTED: myosin heavy chain, non-muscle-like isoform 1 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350412852|ref|XP_003489788.1| PREDICTED: myosin heavy chain, non-muscle-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 60 | ||||||
| WB|WBGene00003776 | 1963 | nmy-1 [Caenorhabditis elegans | 0.9 | 0.027 | 0.722 | 2.1e-15 | |
| ZFIN|ZDB-GENE-030616-162 | 1992 | myh10 "myosin, heavy chain 10, | 0.883 | 0.026 | 0.716 | 3.4e-15 | |
| ZFIN|ZDB-GENE-091112-18 | 1686 | si:ch211-150d5.2 "si:ch211-150 | 0.883 | 0.031 | 0.735 | 3.6e-15 | |
| UNIPROTKB|F1P312 | 1861 | MYH10 "Uncharacterized protein | 0.883 | 0.028 | 0.716 | 4.1e-15 | |
| UNIPROTKB|F1SSA6 | 1864 | LOC396903 "Uncharacterized pro | 0.883 | 0.028 | 0.716 | 4.1e-15 | |
| UNIPROTKB|F1P313 | 1871 | MYH10 "Uncharacterized protein | 0.883 | 0.028 | 0.716 | 4.1e-15 | |
| UNIPROTKB|F1P314 | 1882 | MYH10 "Uncharacterized protein | 0.883 | 0.028 | 0.716 | 4.1e-15 | |
| UNIPROTKB|F1NGG0 | 1892 | MYH10 "Uncharacterized protein | 0.883 | 0.028 | 0.716 | 4.1e-15 | |
| ZFIN|ZDB-GENE-030131-5870 | 1964 | myh9a "myosin, heavy polypepti | 0.883 | 0.026 | 0.735 | 4.3e-15 | |
| UNIPROTKB|Q27991 | 1976 | MYH10 "Myosin-10" [Bos taurus | 0.883 | 0.026 | 0.716 | 4.4e-15 |
| WB|WBGene00003776 nmy-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Score = 210 (79.0 bits), Expect = 2.1e-15, P = 2.1e-15
Identities = 39/54 (72%), Positives = 48/54 (88%)
Query: 1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLD 54
+ KAFL+PRIKVGR+FV K+Q +EQ EFAVEAI+KA YER+F+WLV RIN+SLD
Sbjct: 399 LQKAFLRPRIKVGREFVNKAQNQEQAEFAVEAIAKASYERLFKWLVTRINKSLD 452
|
|
| ZFIN|ZDB-GENE-030616-162 myh10 "myosin, heavy chain 10, non-muscle" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-091112-18 si:ch211-150d5.2 "si:ch211-150d5.2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P312 MYH10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SSA6 LOC396903 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P313 MYH10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P314 MYH10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NGG0 MYH10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-5870 myh9a "myosin, heavy polypeptide 9a, non-muscle" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q27991 MYH10 "Myosin-10" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 60 | |||
| cd01377 | 693 | cd01377, MYSc_type_II, Myosin motor domain, type I | 3e-30 | |
| pfam00063 | 679 | pfam00063, Myosin_head, Myosin head (motor domain) | 4e-20 | |
| smart00242 | 677 | smart00242, MYSc, Myosin | 5e-19 | |
| COG5022 | 1463 | COG5022, COG5022, Myosin heavy chain [Cytoskeleton | 3e-12 | |
| cd00124 | 679 | cd00124, MYSc, Myosin motor domain | 3e-11 | |
| cd01378 | 674 | cd01378, MYSc_type_I, Myosin motor domain, type I | 3e-09 | |
| cd01380 | 691 | cd01380, MYSc_type_V, Myosin motor domain, type V | 3e-07 | |
| cd01384 | 674 | cd01384, MYSc_type_XI, Myosin motor domain, plant- | 3e-06 | |
| cd01383 | 677 | cd01383, MYSc_type_VIII, Myosin motor domain, plan | 1e-05 | |
| cd01379 | 653 | cd01379, MYSc_type_III, Myosin motor domain, type | 2e-05 | |
| cd01382 | 717 | cd01382, MYSc_type_VI, Myosin motor domain, type V | 4e-04 | |
| PTZ00014 | 821 | PTZ00014, PTZ00014, myosin-A; Provisional | 0.001 | |
| cd01381 | 671 | cd01381, MYSc_type_VII, Myosin motor domain, type | 0.003 |
| >gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins | Back alignment and domain information |
|---|
Score = 109 bits (276), Expect = 3e-30
Identities = 35/55 (63%), Positives = 44/55 (80%)
Query: 1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDT 55
+ KA L PRIKVGR++VTK Q EQV F+V A++KA YER+F WLV RIN++LDT
Sbjct: 314 LLKALLHPRIKVGREWVTKGQNVEQVSFSVGALAKALYERLFLWLVKRINKTLDT 368
|
Myosin II mediates cortical contraction in cell motility, and is the motor in smooth and skeletal muscle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 693 |
| >gnl|CDD|215687 pfam00063, Myosin_head, Myosin head (motor domain) | Back alignment and domain information |
|---|
| >gnl|CDD|214580 smart00242, MYSc, Myosin | Back alignment and domain information |
|---|
| >gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|238071 cd00124, MYSc, Myosin motor domain | Back alignment and domain information |
|---|
| >gnl|CDD|238674 cd01378, MYSc_type_I, Myosin motor domain, type I myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238676 cd01380, MYSc_type_V, Myosin motor domain, type V myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238680 cd01384, MYSc_type_XI, Myosin motor domain, plant-specific type XI myosin, involved in organelle transport | Back alignment and domain information |
|---|
| >gnl|CDD|238679 cd01383, MYSc_type_VIII, Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata | Back alignment and domain information |
|---|
| >gnl|CDD|238675 cd01379, MYSc_type_III, Myosin motor domain, type III myosins | Back alignment and domain information |
|---|
| >gnl|CDD|238678 cd01382, MYSc_type_VI, Myosin motor domain, type VI myosins | Back alignment and domain information |
|---|
| >gnl|CDD|240229 PTZ00014, PTZ00014, myosin-A; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238677 cd01381, MYSc_type_VII, Myosin motor domain, type VII myosins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 60 | |||
| PTZ00014 | 821 | myosin-A; Provisional | 99.73 | |
| cd01381 | 671 | MYSc_type_VII Myosin motor domain, type VII myosin | 99.72 | |
| cd01385 | 692 | MYSc_type_IX Myosin motor domain, type IX myosins. | 99.72 | |
| COG5022 | 1463 | Myosin heavy chain [Cytoskeleton] | 99.72 | |
| cd01379 | 653 | MYSc_type_III Myosin motor domain, type III myosin | 99.72 | |
| cd01383 | 677 | MYSc_type_VIII Myosin motor domain, plant-specific | 99.72 | |
| cd01380 | 691 | MYSc_type_V Myosin motor domain, type V myosins. M | 99.72 | |
| cd01377 | 693 | MYSc_type_II Myosin motor domain, type II myosins. | 99.71 | |
| cd01387 | 677 | MYSc_type_XV Myosin motor domain, type XV myosins. | 99.71 | |
| cd01384 | 674 | MYSc_type_XI Myosin motor domain, plant-specific t | 99.7 | |
| KOG0164|consensus | 1001 | 99.69 | ||
| cd00124 | 679 | MYSc Myosin motor domain. This catalytic (head) do | 99.69 | |
| cd01378 | 674 | MYSc_type_I Myosin motor domain, type I myosins. M | 99.68 | |
| PF00063 | 689 | Myosin_head: Myosin head (motor domain); InterPro: | 99.68 | |
| smart00242 | 677 | MYSc Myosin. Large ATPases. ATPase; molecular moto | 99.67 | |
| cd01382 | 717 | MYSc_type_VI Myosin motor domain, type VI myosins. | 99.65 | |
| KOG0162|consensus | 1106 | 99.58 | ||
| cd01386 | 767 | MYSc_type_XVIII Myosin motor domain, type XVIII my | 99.52 | |
| KOG0163|consensus | 1259 | 99.45 | ||
| KOG0160|consensus | 862 | 99.38 | ||
| KOG4229|consensus | 1062 | 99.22 | ||
| KOG0161|consensus | 1930 | 99.22 |
| >PTZ00014 myosin-A; Provisional | Back alignment and domain information |
|---|
Probab=99.73 E-value=5.8e-18 Score=122.91 Aligned_cols=58 Identities=21% Similarity=0.439 Sum_probs=54.3
Q ss_pred CccccccceEEeCceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccccc
Q psy17851 1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIMC 58 (60)
Q Consensus 1 l~~aL~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~~ 58 (60)
|.++|+++++.+|||.+.++++++||..+||||||+||+|||+|||.+||.+|.++++
T Consensus 402 L~~~L~~~~~~~~~e~i~~~~~~~qA~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~~ 459 (821)
T PTZ00014 402 LKKELTVKVTYAGNQKIEGPWSKDESEMLKDSLSKAVYEKLFLWIIRNLNATIEPPGG 459 (821)
T ss_pred HHHHhhceEEEeCCeeEecCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcc
Confidence 4578999999999999999999999999999999999999999999999999987543
|
|
| >cd01381 MYSc_type_VII Myosin motor domain, type VII myosins | Back alignment and domain information |
|---|
| >cd01385 MYSc_type_IX Myosin motor domain, type IX myosins | Back alignment and domain information |
|---|
| >COG5022 Myosin heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >cd01379 MYSc_type_III Myosin motor domain, type III myosins | Back alignment and domain information |
|---|
| >cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata | Back alignment and domain information |
|---|
| >cd01380 MYSc_type_V Myosin motor domain, type V myosins | Back alignment and domain information |
|---|
| >cd01377 MYSc_type_II Myosin motor domain, type II myosins | Back alignment and domain information |
|---|
| >cd01387 MYSc_type_XV Myosin motor domain, type XV myosins | Back alignment and domain information |
|---|
| >cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport | Back alignment and domain information |
|---|
| >KOG0164|consensus | Back alignment and domain information |
|---|
| >cd00124 MYSc Myosin motor domain | Back alignment and domain information |
|---|
| >cd01378 MYSc_type_I Myosin motor domain, type I myosins | Back alignment and domain information |
|---|
| >PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril | Back alignment and domain information |
|---|
| >smart00242 MYSc Myosin | Back alignment and domain information |
|---|
| >cd01382 MYSc_type_VI Myosin motor domain, type VI myosins | Back alignment and domain information |
|---|
| >KOG0162|consensus | Back alignment and domain information |
|---|
| >cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins | Back alignment and domain information |
|---|
| >KOG0163|consensus | Back alignment and domain information |
|---|
| >KOG0160|consensus | Back alignment and domain information |
|---|
| >KOG4229|consensus | Back alignment and domain information |
|---|
| >KOG0161|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 60 | ||||
| 2ycu_A | 995 | Crystal Structure Of Human Non Muscle Myosin 2c In | 2e-17 | ||
| 1i84_S | 1184 | Cryo-Em Structure Of The Heavy Meromyosin Subfragme | 7e-16 | ||
| 1br2_A | 791 | Smooth Muscle Myosin Motor Domain Complexed With Mg | 1e-15 | ||
| 1br1_A | 820 | Smooth Muscle Myosin Motor Domain-Essential Light C | 1e-15 | ||
| 3dtp_B | 973 | Tarantula Heavy Meromyosin Obtained By Flexible Doc | 1e-15 | ||
| 3dtp_A | 971 | Tarantula Heavy Meromyosin Obtained By Flexible Doc | 1e-15 | ||
| 3j04_A | 909 | Em Structure Of The Heavy Meromyosin Subfragment Of | 1e-15 | ||
| 2ec6_A | 838 | Placopecten Striated Muscle Myosin Ii Length = 838 | 3e-13 | ||
| 2os8_A | 840 | Rigor-Like Structures Of Muscle Myosins Reveal Key | 3e-13 | ||
| 2w4g_M | 840 | Isometrically Contracting Insect Asynchronous Fligh | 2e-12 | ||
| 3i5g_A | 839 | Crystal Structure Of Rigor-Like Squid Myosin S1 Len | 2e-12 | ||
| 1qvi_A | 840 | Crystal Structure Of Scallop Myosin S1 In The Pre-P | 2e-12 | ||
| 1kk7_A | 837 | Scallop Myosin In The Near Rigor Conformation Lengt | 2e-12 | ||
| 1b7t_A | 835 | Myosin Digested By Papain Length = 835 | 2e-12 | ||
| 1dfk_A | 830 | Nucleotide-Free Scallop Myosin S1-Near Rigor State | 2e-12 | ||
| 1dfl_A | 831 | Scallop Myosin S1 Complexed With Mgadp:vanadate-Tra | 2e-12 | ||
| 4db1_A | 783 | Cardiac Human Myosin S1dc, Beta Isoform Complexed W | 6e-12 | ||
| 2mys_A | 843 | Myosin Subfragment-1, Alpha Carbon Coordinates Only | 3e-08 | ||
| 1m8q_A | 840 | Molecular Models Of Averaged Rigor Crossbridges Fro | 3e-08 | ||
| 1mmd_A | 762 | Truncated Head Of Myosin From Dictyostelium Discoid | 7e-07 | ||
| 1lvk_A | 762 | X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N | 2e-06 | ||
| 1mmg_A | 762 | X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga | 2e-06 | ||
| 1mmn_A | 762 | X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga | 2e-06 | ||
| 3mkd_A | 692 | Crystal Structure Of Myosin-2 Dictyostelium Discoid | 2e-06 | ||
| 3mnq_A | 788 | Crystal Structure Of Myosin-2 Motor Domain In Compl | 2e-06 | ||
| 2jhr_A | 788 | Crystal Structure Of Myosin-2 Motor Domain In Compl | 2e-06 | ||
| 2xel_A | 776 | Molecular Mechanism Of Pentachloropseudilin Mediate | 2e-06 | ||
| 1yv3_A | 762 | The Structural Basis Of Blebbistatin Inhibition And | 2e-06 | ||
| 3myh_X | 762 | Insights Into The Importance Of Hydrogen Bonding In | 2e-06 | ||
| 1fmv_A | 761 | Crystal Structure Of The Apo Motor Domain Of Dictyo | 2e-06 | ||
| 1w9l_A | 770 | Myosin Ii Dictyostelium Discoideum Motor Domain S45 | 2e-06 | ||
| 1w9i_A | 770 | Myosin Ii Dictyostelium Discoideum Motor Domain S45 | 2e-06 | ||
| 1w9j_A | 770 | Myosin Ii Dictyostelium Discoideum Motor Domain S45 | 2e-06 | ||
| 1w9k_A | 770 | Dictyostelium Discoideum Myosin Ii Motor Domain S45 | 2e-06 | ||
| 1g8x_A | 1010 | Structure Of A Genetically Engineered Molecular Mot | 2e-06 | ||
| 1d0x_A | 761 | Dictyostelium Myosin S1dc (Motor Domain Fragment) C | 2e-06 | ||
| 1mma_A | 762 | X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga | 2e-06 | ||
| 2aka_A | 776 | Structure Of The Nucleotide-Free Myosin Ii Motor Do | 2e-06 | ||
| 1jwy_A | 776 | Crystal Structure Of The Dynamin A Gtpase Domain Co | 2e-06 | ||
| 2y9e_X | 758 | Structural Basis For The Allosteric Interference Of | 2e-06 | ||
| 2y0r_X | 758 | Structural Basis For The Allosteric Interference Of | 2e-06 | ||
| 2x9h_A | 695 | Crystal Structure Of Myosin-2 Motor Domain In Compl | 4e-06 | ||
| 2xo8_A | 776 | Crystal Structure Of Myosin-2 In Complex With Tribr | 4e-06 |
| >pdb|2YCU|A Chain A, Crystal Structure Of Human Non Muscle Myosin 2c In Pre-power Stroke State Length = 995 | Back alignment and structure |
|
| >pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184 | Back alignment and structure |
| >pdb|1BR2|A Chain A, Smooth Muscle Myosin Motor Domain Complexed With Mgadp.Alf4 Length = 791 | Back alignment and structure |
| >pdb|1BR1|A Chain A, Smooth Muscle Myosin Motor Domain-Essential Light Chain Complex With Mgadp.Alf4 Bound At The Active Site Length = 820 | Back alignment and structure |
| >pdb|3DTP|B Chain B, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 973 | Back alignment and structure |
| >pdb|3DTP|A Chain A, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 971 | Back alignment and structure |
| >pdb|3J04|A Chain A, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 909 | Back alignment and structure |
| >pdb|2EC6|A Chain A, Placopecten Striated Muscle Myosin Ii Length = 838 | Back alignment and structure |
| >pdb|2OS8|A Chain A, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 840 | Back alignment and structure |
| >pdb|3I5G|A Chain A, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 839 | Back alignment and structure |
| >pdb|1QVI|A Chain A, Crystal Structure Of Scallop Myosin S1 In The Pre-Power Stroke State To 2.6 Angstrom Resolution: Flexibility And Function In The Head Length = 840 | Back alignment and structure |
| >pdb|1KK7|A Chain A, Scallop Myosin In The Near Rigor Conformation Length = 837 | Back alignment and structure |
| >pdb|1B7T|A Chain A, Myosin Digested By Papain Length = 835 | Back alignment and structure |
| >pdb|1DFK|A Chain A, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 830 | Back alignment and structure |
| >pdb|1DFL|A Chain A, Scallop Myosin S1 Complexed With Mgadp:vanadate-Transition State Length = 831 | Back alignment and structure |
| >pdb|4DB1|A Chain A, Cardiac Human Myosin S1dc, Beta Isoform Complexed With Mn-Amppnp Length = 783 | Back alignment and structure |
| >pdb|2MYS|A Chain A, Myosin Subfragment-1, Alpha Carbon Coordinates Only For The Two Light Chains Length = 843 | Back alignment and structure |
| >pdb|1M8Q|A Chain A, Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle Length = 840 | Back alignment and structure |
| >pdb|1MMD|A Chain A, Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mgadp-Bef3 Length = 762 | Back alignment and structure |
| >pdb|1LVK|A Chain A, X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N- Methylanthraniloyl) Nucleotide Bound To Dictyostelium Discoideum Myosin Motor Domain Length = 762 | Back alignment and structure |
| >pdb|1MMG|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 | Back alignment and structure |
| >pdb|1MMN|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 | Back alignment and structure |
| >pdb|3MKD|A Chain A, Crystal Structure Of Myosin-2 Dictyostelium Discoideum Motor Domain S456y Mutant In Complex With Adp-Orthovanadate Length = 692 | Back alignment and structure |
| >pdb|3MNQ|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp- Metavanadate And Resveratrol Length = 788 | Back alignment and structure |
| >pdb|2JHR|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentabromopseudilin Length = 788 | Back alignment and structure |
| >pdb|2XEL|A Chain A, Molecular Mechanism Of Pentachloropseudilin Mediated Inhibition Of Myosin Motor Activity Length = 776 | Back alignment and structure |
| >pdb|1YV3|A Chain A, The Structural Basis Of Blebbistatin Inhibition And Specificity For Myosin Ii Length = 762 | Back alignment and structure |
| >pdb|3MYH|X Chain X, Insights Into The Importance Of Hydrogen Bonding In The Gamma- Phosphate Binding Pocket Of Myosin: Structural And Functional Studies Of Ser236 Length = 762 | Back alignment and structure |
| >pdb|1FMV|A Chain A, Crystal Structure Of The Apo Motor Domain Of Dictyostellium Myosin Ii Length = 761 | Back alignment and structure |
| >pdb|1W9L|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456e Bound With Mgadp-Alf4 Length = 770 | Back alignment and structure |
| >pdb|1W9I|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Befx Length = 770 | Back alignment and structure |
| >pdb|1W9J|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Alf4 Length = 770 | Back alignment and structure |
| >pdb|1W9K|A Chain A, Dictyostelium Discoideum Myosin Ii Motor Domain S456e With Bound Mgadp-Befx Length = 770 | Back alignment and structure |
| >pdb|1G8X|A Chain A, Structure Of A Genetically Engineered Molecular Motor Length = 1010 | Back alignment and structure |
| >pdb|1D0X|A Chain A, Dictyostelium Myosin S1dc (Motor Domain Fragment) Complexed With M-Nitrophenyl Aminoethyldiphosphate Beryllium Trifluoride. Length = 761 | Back alignment and structure |
| >pdb|1MMA|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 | Back alignment and structure |
| >pdb|2AKA|A Chain A, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 776 | Back alignment and structure |
| >pdb|1JWY|A Chain A, Crystal Structure Of The Dynamin A Gtpase Domain Complexed With Gdp, Determined As Myosin Fusion Length = 776 | Back alignment and structure |
| >pdb|2Y9E|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 | Back alignment and structure |
| >pdb|2Y0R|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 | Back alignment and structure |
| >pdb|2X9H|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentachlorocarbazole Length = 695 | Back alignment and structure |
| >pdb|2XO8|A Chain A, Crystal Structure Of Myosin-2 In Complex With Tribromodichloropseudilin Length = 776 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 60 | |||
| 4db1_A | 783 | Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb | 4e-25 | |
| 1w9i_A | 770 | Myosin II heavy chain; molecular motor, ATPase, mo | 4e-24 | |
| 1w7j_A | 795 | Myosin VA; motor protein, unconventional myosin, m | 9e-24 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 1e-23 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 1e-23 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 3e-23 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 9e-23 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 6e-22 | |
| 1lkx_A | 697 | Myosin IE heavy chain; myosin motor domain, lever | 5e-21 | |
| 2v26_A | 784 | Myosin VI; calmodulin-binding, nucleotide-binding, | 3e-19 |
| >4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Length = 783 | Back alignment and structure |
|---|
Score = 94.6 bits (236), Expect = 4e-25
Identities = 28/55 (50%), Positives = 39/55 (70%)
Query: 1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDT 55
+ K PR+KVG ++VTK Q +QV +A A++KA YERMF W+V RIN +L+T
Sbjct: 395 LLKGLCHPRVKVGNEYVTKGQNVQQVIYATGALAKAVYERMFNWMVTRINATLET 449
|
| >1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Length = 770 | Back alignment and structure |
|---|
| >1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Length = 795 | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 | Back alignment and structure |
|---|
| >1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Length = 697 | Back alignment and structure |
|---|
| >2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Length = 784 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 60 | |||
| 1w7j_A | 795 | Myosin VA; motor protein, unconventional myosin, m | 99.77 | |
| 1w9i_A | 770 | Myosin II heavy chain; molecular motor, ATPase, mo | 99.75 | |
| 1lkx_A | 697 | Myosin IE heavy chain; myosin motor domain, lever | 99.74 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 99.74 | |
| 4db1_A | 783 | Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb | 99.74 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 99.73 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 99.73 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 99.72 | |
| 2v26_A | 784 | Myosin VI; calmodulin-binding, nucleotide-binding, | 99.71 | |
| 1i84_S | 1184 | Smooth muscle myosin heavy chain; muscle protein, | 99.7 | |
| 4anj_A | 1052 | Unconventional myosin-VI, green fluorescent prote; | 99.65 |
| >1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A | Back alignment and structure |
|---|
Probab=99.77 E-value=4e-19 Score=127.44 Aligned_cols=57 Identities=21% Similarity=0.440 Sum_probs=54.1
Q ss_pred CccccccceEEeCceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccc
Q psy17851 1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIM 57 (60)
Q Consensus 1 l~~aL~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~ 57 (60)
|.++|++|++.++||.+.++++++||.++||||||+||+|||+|||.+||.+|..+.
T Consensus 371 L~~aL~~~~~~~~~e~v~~~~~~~qA~~~rdalaK~lY~rLF~wlV~~IN~~l~~~~ 427 (795)
T 1w7j_A 371 MAHWLCHRKLATATETYIKPISKLHAINARDALAKHIYANLFNWIVDHVNKALHSTV 427 (795)
T ss_dssp HHHHHSEEEEECSSCEEEEECCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCSS
T ss_pred HHHHhcccEEEeCCceecCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCc
Confidence 457899999999999999999999999999999999999999999999999998764
|
| >1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... | Back alignment and structure |
|---|
| >1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... | Back alignment and structure |
|---|
| >4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 | Back alignment and structure |
|---|
| >2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* | Back alignment and structure |
|---|
| >1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A | Back alignment and structure |
|---|
| >4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 60 | ||||
| d1d0xa2 | 712 | c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain | 2e-11 | |
| d1kk8a2 | 789 | c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain | 4e-11 | |
| d2mysa2 | 794 | c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain | 6e-11 | |
| d1w7ja2 | 730 | c.37.1.9 (A:63-792) Myosin S1, motor domain {Chick | 2e-10 | |
| d1br2a2 | 710 | c.37.1.9 (A:80-789) Myosin S1, motor domain {Chick | 3e-10 | |
| d1lkxa_ | 684 | c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli | 1e-07 |
| >d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Length = 712 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Myosin S1, motor domain species: Dictyostelium discoideum [TaxId: 44689]
Score = 54.3 bits (130), Expect = 2e-11
Identities = 22/55 (40%), Positives = 32/55 (58%)
Query: 1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDT 55
+ KA ++PRI GRD V + E+ + +A+ KA Y R+F WLV +IN L
Sbjct: 342 LEKALMEPRILAGRDLVAQHLNVEKSSSSRDALVKALYGRLFLWLVKKINNVLCQ 396
|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Length = 730 | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 710 | Back information, alignment and structure |
|---|
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 60 | |||
| d1d0xa2 | 712 | Myosin S1, motor domain {Dictyostelium discoideum | 99.69 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 99.65 | |
| d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 99.64 | |
| d1br2a2 | 710 | Myosin S1, motor domain {Chicken (Gallus gallus), | 99.64 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 99.63 | |
| d1lkxa_ | 684 | Myosin S1, motor domain {Dictyostelium discoideum, | 99.56 |
| >d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Motor proteins domain: Myosin S1, motor domain species: Dictyostelium discoideum [TaxId: 44689]
Probab=99.69 E-value=9e-18 Score=117.51 Aligned_cols=57 Identities=39% Similarity=0.635 Sum_probs=53.6
Q ss_pred CccccccceEEeCceEEEeeCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccc
Q psy17851 1 MTKAFLKPRIKVGRDFVTKSQTKEQVEFAVEAISKACYERMFRWLVNRINRSLDTIM 57 (60)
Q Consensus 1 l~~aL~~~~i~~~~e~~~~~~~~~~a~~~rdalaK~lY~rLF~wiV~~IN~~l~~~~ 57 (60)
|.++|+++.+.++||.+.++++++||.++||+|||+||+|||+|||.+||.+|.+..
T Consensus 342 L~~~L~~~~~~~~~e~i~~~l~~~~A~~~rdalaK~LY~~LF~wiV~~IN~~l~~~~ 398 (712)
T d1d0xa2 342 LEKALMEPRILAGRDLVAQHLNVEKSSSSRDALVKALYGRLFLWLVKKINNVLCQER 398 (712)
T ss_dssp HHHHHHSCEEEETTEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCSC
T ss_pred hhhhhcceeeccCCceEEecCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhcccCc
Confidence 357899999999999999999999999999999999999999999999999998754
|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} | Back information, alignment and structure |
|---|