Psyllid ID: psy17854

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-
MAQQAMSDTQFGARTRYDRMHNRAKPQERKNSRRDGPSLLFVTPGSPVPVLKGLKTAIEPVDYSAEKWLMKNMDPLNENVVSLLQVSQDPFVAHIWKDAEIGELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGYIAGANIETYLLEKSRAIRQAKDERTFHIFYQILAGR
cccccccccEEEEccccHHHHHHHccccccccccccccEEEEcccccccccccccccEEEEEEEEcccccccccccccHHHHHHHHcccccHHcccccccccHHHHHHHHHccHHHHHccccccccccccccccEEEEEEcccccEEccccccEEEEcccccccccccccHHEEEEccccc
ccccccHHHHHccHHHHHHHHHHHHHHccEEEEEEcEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEccccccEEEEcccccccHHHHHHHHHcHHHHHHccccEEEccccccccEEEEEEEcccccEccccHEHEHHHHcHEEEcccccccHHHHHHHHccc
maqqamsdtqfgartrydrmhnrakpqerknsrrdgpsllfvtpgspvpvlkglktaiepvDYSAEKWLMKNMDPLNENVVSLLQVsqdpfvahiwKDAEIGELEQQLLQANPILEafgnaktvkndnssrfgkfirinfdasgyiagaNIETYLLEKSRAIRQAKDERTFHIFYQILAGR
maqqamsdtqfgartrydrmhnrakpqerknsrrdgpsllfvtpgspvpvlkgLKTAIEPVDYSAEKWLMKNMDPLNENVVSLLQVSQDPFVAHIWKDAEIGELEQQLLQANPILEAFGNaktvkndnssrfGKFIRINFDASGYIAGANIETYLLEKSRAirqakdertFHIFYQILAGR
MAQQAMSDTQFGARTRYDRMHNRAKPQERKNSRRDGPSLLFVTPGSPVPVLKGLKTAIEPVDYSAEKWLMKNMDPLNENVVSLLQVSQDPFVAHIWKDAEIGELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGYIAGANIETYLLEKSRAIRQAKDERTFHIFYQILAGR
***************************************LFVTPGSPVPVLKGLKTAIEPVDYSAEKWLMKNMDPLNENVVSLLQVSQDPFVAHIWKDAEIGELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGYIAGANIETYLLEKSRAIRQAKDERTFHIFYQIL***
*****MS*TQFGARTRYDRMH******************LFVTPGSPVPVLKGLKTAIEPVDYSAEKWLMKNMDPLNENVVS************************QLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGYIAGANIETYLLEKSRAIRQAKDERTFHIFYQILAG*
MAQQAMSDTQFGARTRYDRMH************RDGPSLLFVTPGSPVPVLKGLKTAIEPVDYSAEKWLMKNMDPLNENVVSLLQVSQDPFVAHIWKDAEIGELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGYIAGANIETYLLEKSRAIRQAKDERTFHIFYQILAGR
****AMSDTQFGARTRYDRMHNRAKPQERKNSRRDGPSLLFVTPGSPVPVLKGLKTAIEPVDYSAEKWLMKNMDPLNENVVSLLQVSQDPFVAHIWKDAEIGELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGYIAGANIETYLLEKSRAIRQAKDERTFHIFYQILAGR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQQAMSDTQFGARTRYDRMHNRAKPQERKNSRRDGPSLLFVTPGSPVPVLKGLKTAIEPVDYSAEKWLMKNMDPLNENVVSLLQVSQDPFVAHIWKDAEIGELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGYIAGANIETYLLEKSRAIRQAKDERTFHIFYQILAGR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query181 2.2.26 [Sep-21-2011]
Q99323 2057 Myosin heavy chain, non-m yes N/A 0.491 0.043 0.853 2e-40
Q27991 1976 Myosin-10 OS=Bos taurus G yes N/A 0.541 0.049 0.718 5e-39
P35580 1976 Myosin-10 OS=Homo sapiens yes N/A 0.541 0.049 0.718 6e-39
Q9JLT0 1976 Myosin-10 OS=Rattus norve yes N/A 0.541 0.049 0.718 6e-39
Q61879 1976 Myosin-10 OS=Mus musculus yes N/A 0.541 0.049 0.718 6e-39
O08638 1972 Myosin-11 OS=Mus musculus no N/A 0.464 0.042 0.882 7e-39
P10587 1979 Myosin-11 OS=Gallus gallu no N/A 0.436 0.039 0.911 1e-38
P35749 1972 Myosin-11 OS=Homo sapiens no N/A 0.464 0.042 0.870 3e-38
P35748 1972 Myosin-11 OS=Oryctolagus no N/A 0.464 0.042 0.858 7e-38
Q62812 1961 Myosin-9 OS=Rattus norveg no N/A 0.541 0.049 0.710 1e-37
>sp|Q99323|MYSN_DROME Myosin heavy chain, non-muscle OS=Drosophila melanogaster GN=zip PE=1 SV=2 Back     alignment and function desciption
 Score =  165 bits (417), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 83/89 (93%)

Query: 92  VAHIWKDAEIGELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGYIAGANI 151
           +  +  + + GELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASG+I+GANI
Sbjct: 294 MVEVNSNCQEGELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGFISGANI 353

Query: 152 ETYLLEKSRAIRQAKDERTFHIFYQILAG 180
           ETYLLEKSRAIRQAKDERTFHIFYQ+LAG
Sbjct: 354 ETYLLEKSRAIRQAKDERTFHIFYQLLAG 382
Nonmuscle myosin appears to be responsible for cellularization. Required for morphogenesis and cytokinesis.
Drosophila melanogaster (taxid: 7227)
>sp|Q27991|MYH10_BOVIN Myosin-10 OS=Bos taurus GN=MYH10 PE=2 SV=2 Back     alignment and function description
>sp|P35580|MYH10_HUMAN Myosin-10 OS=Homo sapiens GN=MYH10 PE=1 SV=3 Back     alignment and function description
>sp|Q9JLT0|MYH10_RAT Myosin-10 OS=Rattus norvegicus GN=Myh10 PE=1 SV=1 Back     alignment and function description
>sp|Q61879|MYH10_MOUSE Myosin-10 OS=Mus musculus GN=Myh10 PE=1 SV=2 Back     alignment and function description
>sp|O08638|MYH11_MOUSE Myosin-11 OS=Mus musculus GN=Myh11 PE=1 SV=1 Back     alignment and function description
>sp|P10587|MYH11_CHICK Myosin-11 OS=Gallus gallus GN=MYH11 PE=1 SV=4 Back     alignment and function description
>sp|P35749|MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 Back     alignment and function description
>sp|P35748|MYH11_RABIT Myosin-11 OS=Oryctolagus cuniculus GN=MYH11 PE=2 SV=2 Back     alignment and function description
>sp|Q62812|MYH9_RAT Myosin-9 OS=Rattus norvegicus GN=Myh9 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query181
307214547 1830 Myosin heavy chain, non-muscle [Harpegna 0.441 0.043 0.987 1e-40
340711721 1969 PREDICTED: myosin heavy chain, non-muscl 0.441 0.040 0.987 2e-40
350412852 1967 PREDICTED: myosin heavy chain, non-muscl 0.441 0.040 0.987 2e-40
383850896 1968 PREDICTED: myosin heavy chain, non-muscl 0.441 0.040 0.987 2e-40
380023226 1967 PREDICTED: LOW QUALITY PROTEIN: myosin h 0.441 0.040 0.987 2e-40
328790487 1967 PREDICTED: myosin heavy chain, non-muscl 0.441 0.040 0.987 2e-40
340711723 1979 PREDICTED: myosin heavy chain, non-muscl 0.497 0.045 0.888 3e-40
345486457 1882 PREDICTED: LOW QUALITY PROTEIN: myosin h 0.441 0.042 0.975 4e-40
332019192 2033 Myosin heavy chain, non-muscle [Acromyrm 0.513 0.045 0.792 5e-40
357612190 1934 hypothetical protein KGM_00084 [Danaus p 0.441 0.041 0.975 7e-40
>gi|307214547|gb|EFN89532.1| Myosin heavy chain, non-muscle [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 79/80 (98%), Positives = 80/80 (100%)

Query: 101 IGELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGYIAGANIETYLLEKSR 160
           IGELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGYIAGANIETYLLEKSR
Sbjct: 77  IGELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGYIAGANIETYLLEKSR 136

Query: 161 AIRQAKDERTFHIFYQILAG 180
           AIRQAKDERTFHIFYQ+LAG
Sbjct: 137 AIRQAKDERTFHIFYQLLAG 156

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|340711721|ref|XP_003394419.1| PREDICTED: myosin heavy chain, non-muscle-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350412852|ref|XP_003489788.1| PREDICTED: myosin heavy chain, non-muscle-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383850896|ref|XP_003701010.1| PREDICTED: myosin heavy chain, non-muscle-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380023226|ref|XP_003695426.1| PREDICTED: LOW QUALITY PROTEIN: myosin heavy chain, non-muscle-like [Apis florea] Back     alignment and taxonomy information
>gi|328790487|ref|XP_623323.3| PREDICTED: myosin heavy chain, non-muscle [Apis mellifera] Back     alignment and taxonomy information
>gi|340711723|ref|XP_003394420.1| PREDICTED: myosin heavy chain, non-muscle-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|345486457|ref|XP_003425478.1| PREDICTED: LOW QUALITY PROTEIN: myosin heavy chain, non-muscle [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332019192|gb|EGI59702.1| Myosin heavy chain, non-muscle [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|357612190|gb|EHJ67857.1| hypothetical protein KGM_00084 [Danaus plexippus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query181
UNIPROTKB|F1P312 1861 MYH10 "Uncharacterized protein 0.569 0.055 0.752 9.8e-34
UNIPROTKB|F1P314 1882 MYH10 "Uncharacterized protein 0.569 0.054 0.752 1e-33
UNIPROTKB|F1SSA6 1864 LOC396903 "Uncharacterized pro 0.569 0.055 0.742 2.1e-33
MGI|MGI:102643 1972 Myh11 "myosin, heavy polypepti 0.464 0.042 0.882 2.2e-33
UNIPROTKB|G1K307 1972 MYH11 "Myosin-11" [Gallus gall 0.464 0.042 0.882 2.2e-33
UNIPROTKB|Q27991 1976 MYH10 "Myosin-10" [Bos taurus 0.569 0.052 0.742 2.2e-33
UNIPROTKB|P35580 1976 MYH10 "Myosin-10" [Homo sapien 0.569 0.052 0.742 2.2e-33
MGI|MGI:1930780 1976 Myh10 "myosin, heavy polypepti 0.569 0.052 0.742 2.2e-33
RGD|71000 1976 Myh10 "myosin, heavy chain 10, 0.569 0.052 0.742 2.2e-33
UNIPROTKB|G3V9Y1 1976 Myh10 "Myosin-10" [Rattus norv 0.569 0.052 0.742 2.2e-33
UNIPROTKB|F1P312 MYH10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 382 (139.5 bits), Expect = 9.8e-34, P = 9.8e-34
 Identities = 79/105 (75%), Positives = 87/105 (82%)

Query:    78 ENVVSLLQVSQDPFVAHIW-KDAEI-GELEQQLLQANPILEAFGNAKTVKNDNSSRFGKF 135
             EN   ++Q       +H   KD  I GELE+QLLQANPILE+FGNAKTVKNDNSSRFGKF
Sbjct:    71 ENTKKVIQYLAHVASSHKGRKDHNIPGELERQLLQANPILESFGNAKTVKNDNSSRFGKF 130

Query:   136 IRINFDASGYIAGANIETYLLEKSRAIRQAKDERTFHIFYQILAG 180
             IRINFD +GYI GANIETYLLEKSRA+RQAKDERTFHIFYQ+LAG
Sbjct:   131 IRINFDVTGYIVGANIETYLLEKSRAVRQAKDERTFHIFYQLLAG 175
GO:0003774 "motor activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0016459 "myosin complex" evidence=IEA
UNIPROTKB|F1P314 MYH10 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SSA6 LOC396903 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:102643 Myh11 "myosin, heavy polypeptide 11, smooth muscle" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G1K307 MYH11 "Myosin-11" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q27991 MYH10 "Myosin-10" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P35580 MYH10 "Myosin-10" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1930780 Myh10 "myosin, heavy polypeptide 10, non-muscle" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|71000 Myh10 "myosin, heavy chain 10, non-muscle" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V9Y1 Myh10 "Myosin-10" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P35580MYH10_HUMANNo assigned EC number0.71810.54140.0495yesN/A
P08799MYS2_DICDINo assigned EC number0.69620.43640.0373yesN/A
Q61879MYH10_MOUSENo assigned EC number0.71810.54140.0495yesN/A
Q27991MYH10_BOVINNo assigned EC number0.71810.54140.0495yesN/A
P10587MYH11_CHICKNo assigned EC number0.91130.43640.0399noN/A
Q99323MYSN_DROMENo assigned EC number0.85390.49170.0432yesN/A
Q9JLT0MYH10_RATNo assigned EC number0.71810.54140.0495yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
cd01377 693 cd01377, MYSc_type_II, Myosin motor domain, type I 3e-56
smart00242 677 smart00242, MYSc, Myosin 3e-49
pfam00063 679 pfam00063, Myosin_head, Myosin head (motor domain) 6e-46
cd00124 679 cd00124, MYSc, Myosin motor domain 4e-43
COG5022 1463 COG5022, COG5022, Myosin heavy chain [Cytoskeleton 5e-41
cd01380 691 cd01380, MYSc_type_V, Myosin motor domain, type V 3e-39
cd01381 671 cd01381, MYSc_type_VII, Myosin motor domain, type 1e-38
cd01384 674 cd01384, MYSc_type_XI, Myosin motor domain, plant- 3e-36
cd01378 674 cd01378, MYSc_type_I, Myosin motor domain, type I 3e-36
cd01383 677 cd01383, MYSc_type_VIII, Myosin motor domain, plan 6e-34
cd01382 717 cd01382, MYSc_type_VI, Myosin motor domain, type V 1e-31
cd01385 692 cd01385, MYSc_type_IX, Myosin motor domain, type I 7e-30
PTZ00014 821 PTZ00014, PTZ00014, myosin-A; Provisional 7e-30
cd01387 677 cd01387, MYSc_type_XV, Myosin motor domain, type X 1e-28
cd01379 653 cd01379, MYSc_type_III, Myosin motor domain, type 2e-28
cd01386 767 cd01386, MYSc_type_XVIII, Myosin motor domain, typ 2e-17
cd01377693 cd01377, MYSc_type_II, Myosin motor domain, type I 1e-14
pfam00063679 pfam00063, Myosin_head, Myosin head (motor domain) 7e-11
smart00242677 smart00242, MYSc, Myosin 6e-09
cd01363186 cd01363, Motor_domain, Myosin and Kinesin motor do 2e-06
COG5022 1463 COG5022, COG5022, Myosin heavy chain [Cytoskeleton 7e-06
PTZ00014 821 PTZ00014, PTZ00014, myosin-A; Provisional 3e-05
cd00124679 cd00124, MYSc, Myosin motor domain 7e-05
>gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins Back     alignment and domain information 
 Score =  187 bits (477), Expect = 3e-56
 Identities = 60/79 (75%), Positives = 69/79 (87%)

Query: 102 GELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGYIAGANIETYLLEKSRA 161
           G LE Q+LQANPILEAFGNAKTV+NDNSSRFGKFIRI+F  +G IAGA+IETYLLEKSR 
Sbjct: 133 GTLEDQILQANPILEAFGNAKTVRNDNSSRFGKFIRIHFGNTGKIAGADIETYLLEKSRV 192

Query: 162 IRQAKDERTFHIFYQILAG 180
           + QA  ER +HIFYQ+L+G
Sbjct: 193 VFQASGERNYHIFYQLLSG 211

Myosin II mediates cortical contraction in cell motility, and is the motor in smooth and skeletal muscle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 693
>gnl|CDD|214580 smart00242, MYSc, Myosin Back     alignment and domain information
>gnl|CDD|215687 pfam00063, Myosin_head, Myosin head (motor domain) Back     alignment and domain information
>gnl|CDD|238071 cd00124, MYSc, Myosin motor domain Back     alignment and domain information
>gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238676 cd01380, MYSc_type_V, Myosin motor domain, type V myosins Back     alignment and domain information
>gnl|CDD|238677 cd01381, MYSc_type_VII, Myosin motor domain, type VII myosins Back     alignment and domain information
>gnl|CDD|238680 cd01384, MYSc_type_XI, Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>gnl|CDD|238674 cd01378, MYSc_type_I, Myosin motor domain, type I myosins Back     alignment and domain information
>gnl|CDD|238679 cd01383, MYSc_type_VIII, Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information
>gnl|CDD|238678 cd01382, MYSc_type_VI, Myosin motor domain, type VI myosins Back     alignment and domain information
>gnl|CDD|238681 cd01385, MYSc_type_IX, Myosin motor domain, type IX myosins Back     alignment and domain information
>gnl|CDD|240229 PTZ00014, PTZ00014, myosin-A; Provisional Back     alignment and domain information
>gnl|CDD|238683 cd01387, MYSc_type_XV, Myosin motor domain, type XV myosins Back     alignment and domain information
>gnl|CDD|238675 cd01379, MYSc_type_III, Myosin motor domain, type III myosins Back     alignment and domain information
>gnl|CDD|238682 cd01386, MYSc_type_XVIII, Myosin motor domain, type XVIII myosins Back     alignment and domain information
>gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins Back     alignment and domain information
>gnl|CDD|215687 pfam00063, Myosin_head, Myosin head (motor domain) Back     alignment and domain information
>gnl|CDD|214580 smart00242, MYSc, Myosin Back     alignment and domain information
>gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain Back     alignment and domain information
>gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|240229 PTZ00014, PTZ00014, myosin-A; Provisional Back     alignment and domain information
>gnl|CDD|238071 cd00124, MYSc, Myosin motor domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 181
PTZ00014 821 myosin-A; Provisional 100.0
COG5022 1463 Myosin heavy chain [Cytoskeleton] 100.0
cd01377 693 MYSc_type_II Myosin motor domain, type II myosins. 100.0
cd01385 692 MYSc_type_IX Myosin motor domain, type IX myosins. 100.0
cd01386 767 MYSc_type_XVIII Myosin motor domain, type XVIII my 100.0
cd01381 671 MYSc_type_VII Myosin motor domain, type VII myosin 100.0
cd01380 691 MYSc_type_V Myosin motor domain, type V myosins. M 100.0
cd01383 677 MYSc_type_VIII Myosin motor domain, plant-specific 100.0
cd01382 717 MYSc_type_VI Myosin motor domain, type VI myosins. 100.0
cd01379 653 MYSc_type_III Myosin motor domain, type III myosin 100.0
cd01384 674 MYSc_type_XI Myosin motor domain, plant-specific t 100.0
cd01378 674 MYSc_type_I Myosin motor domain, type I myosins. M 100.0
cd01387 677 MYSc_type_XV Myosin motor domain, type XV myosins. 100.0
cd00124 679 MYSc Myosin motor domain. This catalytic (head) do 100.0
smart00242 677 MYSc Myosin. Large ATPases. ATPase; molecular moto 100.0
PF00063 689 Myosin_head: Myosin head (motor domain); InterPro: 100.0
KOG0164|consensus 1001 100.0
KOG0161|consensus 1930 100.0
KOG0162|consensus 1106 100.0
KOG0163|consensus 1259 100.0
KOG0160|consensus 862 100.0
KOG4229|consensus 1062 99.97
PTZ00014 821 myosin-A; Provisional 99.17
cd01381671 MYSc_type_VII Myosin motor domain, type VII myosin 99.15
cd01380691 MYSc_type_V Myosin motor domain, type V myosins. M 99.1
cd01384674 MYSc_type_XI Myosin motor domain, plant-specific t 99.05
KOG0161|consensus 1930 99.03
cd01385692 MYSc_type_IX Myosin motor domain, type IX myosins. 99.0
cd01378674 MYSc_type_I Myosin motor domain, type I myosins. M 98.98
COG5022 1463 Myosin heavy chain [Cytoskeleton] 98.98
smart00242677 MYSc Myosin. Large ATPases. ATPase; molecular moto 98.95
cd01387677 MYSc_type_XV Myosin motor domain, type XV myosins. 98.94
cd00124679 MYSc Myosin motor domain. This catalytic (head) do 98.92
cd01377693 MYSc_type_II Myosin motor domain, type II myosins. 98.87
cd01382717 MYSc_type_VI Myosin motor domain, type VI myosins. 98.85
cd01383677 MYSc_type_VIII Myosin motor domain, plant-specific 98.84
cd01386767 MYSc_type_XVIII Myosin motor domain, type XVIII my 98.71
cd01379653 MYSc_type_III Myosin motor domain, type III myosin 98.67
PF00063689 Myosin_head: Myosin head (motor domain); InterPro: 98.48
KOG0164|consensus 1001 98.27
KOG0162|consensus 1106 97.94
KOG0160|consensus 862 97.87
KOG0163|consensus 1259 97.16
KOG4229|consensus 1062 96.17
cd01363186 Motor_domain Myosin and Kinesin motor domain. Thes 87.18
>PTZ00014 myosin-A; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.2e-49  Score=362.93  Aligned_cols=172  Identities=27%  Similarity=0.448  Sum_probs=151.2

Q ss_pred             CCcCccccccCCCcchhhhhh-------hhhccCCCCeeEeCCCCCCCCccc----------ccccCCCccchhhhhHHH
Q psy17854          9 TQFGARTRYDRMHNRAKPQER-------KNSRRDGPSLLFVTPGSPVPVLKG----------LKTAIEPVDYSAEKWLMK   71 (181)
Q Consensus         9 ~~~~~~~~l~~l~e~~~l~~~-------~~~t~~G~~li~vNP~~~~p~~f~----------i~h~agph~Y~va~~~~k   71 (181)
                      +.++||+.|+.|||++||.++       +.||++|++||+||||+.+|+|..          ....++||+|++|+.+|+
T Consensus        96 ~~~~Dl~~L~~lnE~~vL~nL~~Ry~~~~IYTy~G~iLIavNPyk~l~~y~~~~~~~Y~~~~~~~~lpPHifavA~~Ay~  175 (821)
T PTZ00014         96 MTYGDIGLLPHTNIPCVLDFLKHRYLKNQIYTTADPLLVAINPFKDLGNTTNDWIRRYRDAKDSDKLPPHVFTTARRALE  175 (821)
T ss_pred             CCcchhhhCCCCCHHHHHHHHHHHHcCCCCeeeECCEEEEECCCCCCCCCcHHHHHHHhCCCCcCCCCCCHHHHHHHHHH
Confidence            468999999999999999988       788899999999999999997653          123579999999999999


Q ss_pred             hcCCCccchhhhhhc-cC-------Ccccccccc---ccchhhHHHHhhhhhhHHHhhccccccccCCCCcceeEEEEEe
Q psy17854         72 NMDPLNENVVSLLQV-SQ-------DPFVAHIWK---DAEIGELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINF  140 (181)
Q Consensus        72 n~d~~~~~~~~ll~~-S~-------~~~l~~l~~---~~~~~~v~~~i~~~~~iLeafgna~T~~N~nssrfg~~~~l~f  140 (181)
                      +|....++|++++++ |+       +.+++.+..   ......+++++.++||||||||||||.+|+||||||||++++|
T Consensus       176 ~m~~~~~~QsIiiSGESGAGKTe~tK~im~yla~~~~~~~~~~ie~~Il~sNpiLEAFGNAKT~rNdNSSRFGKfi~i~F  255 (821)
T PTZ00014        176 NLHGVKKSQTIIVSGESGAGKTEATKQIMRYFASSKSGNMDLKIQNAIMAANPVLEAFGNAKTIRNNNSSRFGRFMQLQL  255 (821)
T ss_pred             HHHhcCCCceEEEEcCCCCCchHHHHHHHHHHHHhccCCCcccHHHHHHHHHHHHHHhhccCcCCCCCcCcceeEEEEEE
Confidence            999999999988854 22       234443322   2223578999999999999999999999999999999999999


Q ss_pred             cCCCcccceeeeeEeeccccccccCCCCCchhhHHhhhcC
Q psy17854        141 DASGYIAGANIETYLLEKSRAIRQAKDERTFHIFYQILAG  180 (181)
Q Consensus       141 ~~~~~~~g~~~~~~lleksRv~~~~~~ernfhiFy~ll~g  180 (181)
                      +..|.|.||+|.+||||||||+.|++||||||||||||+|
T Consensus       256 ~~~g~i~Ga~I~~YLLEKSRVv~q~~gERNfHIFYqLl~G  295 (821)
T PTZ00014        256 GEEGGIRYGSIVAFLLEKSRVVTQEDDERSYHIFYQLLKG  295 (821)
T ss_pred             cCCCcEeeEEEEEEeccCceeeecCCCCCCEeHHHHHHhC
Confidence            9999999999999999999999999999999999999998

>COG5022 Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>cd01377 MYSc_type_II Myosin motor domain, type II myosins Back     alignment and domain information
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins Back     alignment and domain information
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins Back     alignment and domain information
>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins Back     alignment and domain information
>cd01380 MYSc_type_V Myosin motor domain, type V myosins Back     alignment and domain information
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins Back     alignment and domain information
>cd01379 MYSc_type_III Myosin motor domain, type III myosins Back     alignment and domain information
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>cd01378 MYSc_type_I Myosin motor domain, type I myosins Back     alignment and domain information
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins Back     alignment and domain information
>cd00124 MYSc Myosin motor domain Back     alignment and domain information
>smart00242 MYSc Myosin Back     alignment and domain information
>PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>KOG0164|consensus Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>KOG0163|consensus Back     alignment and domain information
>KOG0160|consensus Back     alignment and domain information
>KOG4229|consensus Back     alignment and domain information
>PTZ00014 myosin-A; Provisional Back     alignment and domain information
>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins Back     alignment and domain information
>cd01380 MYSc_type_V Myosin motor domain, type V myosins Back     alignment and domain information
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins Back     alignment and domain information
>cd01378 MYSc_type_I Myosin motor domain, type I myosins Back     alignment and domain information
>COG5022 Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>smart00242 MYSc Myosin Back     alignment and domain information
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins Back     alignment and domain information
>cd00124 MYSc Myosin motor domain Back     alignment and domain information
>cd01377 MYSc_type_II Myosin motor domain, type II myosins Back     alignment and domain information
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins Back     alignment and domain information
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins Back     alignment and domain information
>cd01379 MYSc_type_III Myosin motor domain, type III myosins Back     alignment and domain information
>PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>KOG0164|consensus Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>KOG0160|consensus Back     alignment and domain information
>KOG0163|consensus Back     alignment and domain information
>KOG4229|consensus Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
1i84_S 1184 Cryo-Em Structure Of The Heavy Meromyosin Subfragme 7e-39
3dtp_B 973 Tarantula Heavy Meromyosin Obtained By Flexible Doc 1e-38
3dtp_A 971 Tarantula Heavy Meromyosin Obtained By Flexible Doc 1e-38
3j04_A 909 Em Structure Of The Heavy Meromyosin Subfragment Of 2e-38
1br1_A 820 Smooth Muscle Myosin Motor Domain-Essential Light C 2e-38
1br2_A 791 Smooth Muscle Myosin Motor Domain Complexed With Mg 3e-38
2ycu_A 995 Crystal Structure Of Human Non Muscle Myosin 2c In 2e-37
3mkd_A 692 Crystal Structure Of Myosin-2 Dictyostelium Discoid 4e-29
1jwy_A 776 Crystal Structure Of The Dynamin A Gtpase Domain Co 4e-29
2y9e_X 758 Structural Basis For The Allosteric Interference Of 4e-29
2y0r_X 758 Structural Basis For The Allosteric Interference Of 4e-29
2x9h_A 695 Crystal Structure Of Myosin-2 Motor Domain In Compl 4e-29
2aka_A 776 Structure Of The Nucleotide-Free Myosin Ii Motor Do 4e-29
1yv3_A 762 The Structural Basis Of Blebbistatin Inhibition And 4e-29
2xel_A 776 Molecular Mechanism Of Pentachloropseudilin Mediate 4e-29
2xo8_A 776 Crystal Structure Of Myosin-2 In Complex With Tribr 4e-29
1w9j_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 4e-29
1w9l_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 4e-29
1w9i_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 4e-29
3mnq_A 788 Crystal Structure Of Myosin-2 Motor Domain In Compl 4e-29
2jhr_A 788 Crystal Structure Of Myosin-2 Motor Domain In Compl 4e-29
1w9k_A 770 Dictyostelium Discoideum Myosin Ii Motor Domain S45 4e-29
1mma_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 9e-29
3myh_X 762 Insights Into The Importance Of Hydrogen Bonding In 9e-29
1d0x_A 761 Dictyostelium Myosin S1dc (Motor Domain Fragment) C 9e-29
1mmd_A 762 Truncated Head Of Myosin From Dictyostelium Discoid 9e-29
1fmv_A 761 Crystal Structure Of The Apo Motor Domain Of Dictyo 9e-29
4db1_A 783 Cardiac Human Myosin S1dc, Beta Isoform Complexed W 9e-29
1lvk_A 762 X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N 1e-28
1mmg_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 1e-28
1mmn_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 1e-28
1g8x_A 1010 Structure Of A Genetically Engineered Molecular Mot 3e-28
2w4g_M 840 Isometrically Contracting Insect Asynchronous Fligh 2e-27
1kk7_A 837 Scallop Myosin In The Near Rigor Conformation Lengt 4e-27
1qvi_A 840 Crystal Structure Of Scallop Myosin S1 In The Pre-P 4e-27
1b7t_A 835 Myosin Digested By Papain Length = 835 4e-27
1dfl_A 831 Scallop Myosin S1 Complexed With Mgadp:vanadate-Tra 4e-27
1dfk_A 830 Nucleotide-Free Scallop Myosin S1-Near Rigor State 4e-27
2ec6_A 838 Placopecten Striated Muscle Myosin Ii Length = 838 4e-27
2os8_A 840 Rigor-Like Structures Of Muscle Myosins Reveal Key 1e-26
3i5g_A 839 Crystal Structure Of Rigor-Like Squid Myosin S1 Len 3e-26
2mys_A 843 Myosin Subfragment-1, Alpha Carbon Coordinates Only 3e-25
1m8q_A 840 Molecular Models Of Averaged Rigor Crossbridges Fro 3e-25
2dfs_A 1080 3-D Structure Of Myosin-V Inhibited State Length = 1e-23
1oe9_A 795 Crystal Structure Of Myosin V Motor With Essential 2e-23
1w8j_A 766 Crystal Structure Of Myosin V Motor Domain - Nucleo 2e-23
2bki_A 858 Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal St 5e-22
4e7s_A 798 Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke Stat 5e-22
4anj_A 1052 Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke St 5e-22
2bkh_A 814 Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc 5e-22
3l9i_A 814 Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant 5e-22
2v26_A 784 Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) L 6e-22
2x51_A 789 M6 Delta Insert1 Length = 789 6e-22
4e7z_A 798 Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal F 6e-22
2vas_A 788 Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigo 6e-22
4a7f_C 697 Structure Of The Actin-Tropomyosin-Myosin Complex ( 7e-22
1lkx_A 697 Motor Domain Of Myoe, A Class-I Myosin Length = 697 7e-22
4dbr_A 786 Myosin Vi D179y (md) Pre-powerstroke State Length = 1e-21
4dbp_A 814 Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal 1e-21
4dbq_A 788 Myosin Vi D179y (md-insert2-cam, Delta-insert1) Pos 1e-21
>pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184 Back     alignment and structure 
Iteration: 1

 Score =  156 bits (394), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 72/79 (91%), Positives = 76/79 (96%)
Query: 102 GELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGYIAGANIETYLLEKSRA 161
           GELE+QLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFD +GYI GANIETYLLEKSRA
Sbjct: 217 GELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLLEKSRA 276
Query: 162 IRQAKDERTFHIFYQILAG 180
           IRQAKDERTFHIFY ++AG
Sbjct: 277 IRQAKDERTFHIFYYLIAG 295
>pdb|3DTP|B Chain B, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 973 Back     alignment and structure
>pdb|3DTP|A Chain A, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 971 Back     alignment and structure
>pdb|3J04|A Chain A, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 909 Back     alignment and structure
>pdb|1BR1|A Chain A, Smooth Muscle Myosin Motor Domain-Essential Light Chain Complex With Mgadp.Alf4 Bound At The Active Site Length = 820 Back     alignment and structure
>pdb|1BR2|A Chain A, Smooth Muscle Myosin Motor Domain Complexed With Mgadp.Alf4 Length = 791 Back     alignment and structure
>pdb|2YCU|A Chain A, Crystal Structure Of Human Non Muscle Myosin 2c In Pre-power Stroke State Length = 995 Back     alignment and structure
>pdb|3MKD|A Chain A, Crystal Structure Of Myosin-2 Dictyostelium Discoideum Motor Domain S456y Mutant In Complex With Adp-Orthovanadate Length = 692 Back     alignment and structure
>pdb|1JWY|A Chain A, Crystal Structure Of The Dynamin A Gtpase Domain Complexed With Gdp, Determined As Myosin Fusion Length = 776 Back     alignment and structure
>pdb|2Y9E|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 Back     alignment and structure
>pdb|2Y0R|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 Back     alignment and structure
>pdb|2X9H|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentachlorocarbazole Length = 695 Back     alignment and structure
>pdb|2AKA|A Chain A, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 776 Back     alignment and structure
>pdb|1YV3|A Chain A, The Structural Basis Of Blebbistatin Inhibition And Specificity For Myosin Ii Length = 762 Back     alignment and structure
>pdb|2XEL|A Chain A, Molecular Mechanism Of Pentachloropseudilin Mediated Inhibition Of Myosin Motor Activity Length = 776 Back     alignment and structure
>pdb|2XO8|A Chain A, Crystal Structure Of Myosin-2 In Complex With Tribromodichloropseudilin Length = 776 Back     alignment and structure
>pdb|1W9J|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Alf4 Length = 770 Back     alignment and structure
>pdb|1W9L|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456e Bound With Mgadp-Alf4 Length = 770 Back     alignment and structure
>pdb|1W9I|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Befx Length = 770 Back     alignment and structure
>pdb|3MNQ|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp- Metavanadate And Resveratrol Length = 788 Back     alignment and structure
>pdb|2JHR|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentabromopseudilin Length = 788 Back     alignment and structure
>pdb|1W9K|A Chain A, Dictyostelium Discoideum Myosin Ii Motor Domain S456e With Bound Mgadp-Befx Length = 770 Back     alignment and structure
>pdb|1MMA|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|3MYH|X Chain X, Insights Into The Importance Of Hydrogen Bonding In The Gamma- Phosphate Binding Pocket Of Myosin: Structural And Functional Studies Of Ser236 Length = 762 Back     alignment and structure
>pdb|1D0X|A Chain A, Dictyostelium Myosin S1dc (Motor Domain Fragment) Complexed With M-Nitrophenyl Aminoethyldiphosphate Beryllium Trifluoride. Length = 761 Back     alignment and structure
>pdb|1MMD|A Chain A, Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mgadp-Bef3 Length = 762 Back     alignment and structure
>pdb|1FMV|A Chain A, Crystal Structure Of The Apo Motor Domain Of Dictyostellium Myosin Ii Length = 761 Back     alignment and structure
>pdb|4DB1|A Chain A, Cardiac Human Myosin S1dc, Beta Isoform Complexed With Mn-Amppnp Length = 783 Back     alignment and structure
>pdb|1LVK|A Chain A, X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N- Methylanthraniloyl) Nucleotide Bound To Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1MMG|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1MMN|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1G8X|A Chain A, Structure Of A Genetically Engineered Molecular Motor Length = 1010 Back     alignment and structure
>pdb|1KK7|A Chain A, Scallop Myosin In The Near Rigor Conformation Length = 837 Back     alignment and structure
>pdb|1QVI|A Chain A, Crystal Structure Of Scallop Myosin S1 In The Pre-Power Stroke State To 2.6 Angstrom Resolution: Flexibility And Function In The Head Length = 840 Back     alignment and structure
>pdb|1B7T|A Chain A, Myosin Digested By Papain Length = 835 Back     alignment and structure
>pdb|1DFL|A Chain A, Scallop Myosin S1 Complexed With Mgadp:vanadate-Transition State Length = 831 Back     alignment and structure
>pdb|1DFK|A Chain A, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 830 Back     alignment and structure
>pdb|2EC6|A Chain A, Placopecten Striated Muscle Myosin Ii Length = 838 Back     alignment and structure
>pdb|2OS8|A Chain A, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 840 Back     alignment and structure
>pdb|3I5G|A Chain A, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 839 Back     alignment and structure
>pdb|2MYS|A Chain A, Myosin Subfragment-1, Alpha Carbon Coordinates Only For The Two Light Chains Length = 843 Back     alignment and structure
>pdb|1M8Q|A Chain A, Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle Length = 840 Back     alignment and structure
>pdb|2DFS|A Chain A, 3-D Structure Of Myosin-V Inhibited State Length = 1080 Back     alignment and structure
>pdb|1OE9|A Chain A, Crystal Structure Of Myosin V Motor With Essential Light Chain - Nucleotide-Free Length = 795 Back     alignment and structure
>pdb|1W8J|A Chain A, Crystal Structure Of Myosin V Motor Domain - Nucleotide-Free Length = 766 Back     alignment and structure
>pdb|2BKI|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal Structure Length = 858 Back     alignment and structure
>pdb|4E7S|A Chain A, Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke State Length = 798 Back     alignment and structure
>pdb|4ANJ|A Chain A, Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke State (Mg.Adp.Alf4) Length = 1052 Back     alignment and structure
>pdb|2BKH|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 814 Back     alignment and structure
>pdb|3L9I|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant Crystal Structure Length = 814 Back     alignment and structure
>pdb|2V26|A Chain A, Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) Length = 784 Back     alignment and structure
>pdb|2X51|A Chain A, M6 Delta Insert1 Length = 789 Back     alignment and structure
>pdb|4E7Z|A Chain A, Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal Form Length = 798 Back     alignment and structure
>pdb|2VAS|A Chain A, Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigor State Length = 788 Back     alignment and structure
>pdb|4A7F|C Chain C, Structure Of The Actin-Tropomyosin-Myosin Complex (Rigor Atm 3) Length = 697 Back     alignment and structure
>pdb|1LKX|A Chain A, Motor Domain Of Myoe, A Class-I Myosin Length = 697 Back     alignment and structure
>pdb|4DBR|A Chain A, Myosin Vi D179y (md) Pre-powerstroke State Length = 786 Back     alignment and structure
>pdb|4DBP|A Chain A, Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal Structure Length = 814 Back     alignment and structure
>pdb|4DBQ|A Chain A, Myosin Vi D179y (md-insert2-cam, Delta-insert1) Post-rigor State Length = 788 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 2e-56
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 3e-10
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 2e-55
1lkx_A697 Myosin IE heavy chain; myosin motor domain, lever 5e-11
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 2e-55
1w9i_A770 Myosin II heavy chain; molecular motor, ATPase, mo 3e-12
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-55
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 8e-10
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 4e-55
2v26_A784 Myosin VI; calmodulin-binding, nucleotide-binding, 9e-11
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 4e-55
4db1_A783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 7e-12
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 7e-55
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 3e-12
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 9e-55
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 8e-12
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 3e-54
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 8e-12
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 7e-45
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 3e-11
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Length = 795 Back     alignment and structure
 Score =  188 bits (480), Expect = 2e-56
 Identities = 48/90 (53%), Positives = 65/90 (72%)

Query: 91  FVAHIWKDAEIGELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGYIAGAN 150
           + A +   A    +E+++L +NPI+E+ GNAKT +NDNSSRFGK+I I FD    I GAN
Sbjct: 179 YFATVSGSASEANVEEKVLASNPIMESIGNAKTTRNDNSSRFGKYIEIGFDKRYRIIGAN 238

Query: 151 IETYLLEKSRAIRQAKDERTFHIFYQILAG 180
           + TYLLEKSR + QA++ER +HIFYQ+ A 
Sbjct: 239 MRTYLLEKSRVVFQAEEERNYHIFYQLCAS 268
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Length = 795 Back     alignment and structure
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Length = 697 Back     alignment and structure
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Length = 697 Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Length = 770 Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Length = 770 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Length = 784 Back     alignment and structure
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Length = 784 Back     alignment and structure
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Length = 783 Back     alignment and structure
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Length = 783 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query181
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 100.0
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 100.0
4anj_A 1052 Unconventional myosin-VI, green fluorescent prote; 100.0
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 100.0
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 100.0
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 100.0
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 100.0
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 100.0
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 100.0
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 100.0
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 100.0
1w7j_A795 Myosin VA; motor protein, unconventional myosin, m 99.13
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 99.1
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 99.1
1w9i_A770 Myosin II heavy chain; molecular motor, ATPase, mo 99.08
4db1_A783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 99.07
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 99.04
1lkx_A697 Myosin IE heavy chain; myosin motor domain, lever 99.01
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 99.0
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 98.98
2v26_A784 Myosin VI; calmodulin-binding, nucleotide-binding, 98.98
4anj_A 1052 Unconventional myosin-VI, green fluorescent prote; 98.91
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Back     alignment and structure
Probab=100.00  E-value=4.4e-50  Score=360.76  Aligned_cols=172  Identities=33%  Similarity=0.512  Sum_probs=151.0

Q ss_pred             CCcCccccccCCCcchhhhhh-------hhhccCCCCeeEeCCCCCCCCccc---------ccccCCCccchhhhhHHHh
Q psy17854          9 TQFGARTRYDRMHNRAKPQER-------KNSRRDGPSLLFVTPGSPVPVLKG---------LKTAIEPVDYSAEKWLMKN   72 (181)
Q Consensus         9 ~~~~~~~~l~~l~e~~~l~~~-------~~~t~~G~~li~vNP~~~~p~~f~---------i~h~agph~Y~va~~~~kn   72 (181)
                      +..+||+.|+.|||++||.++       +.|||+|++||+||||+++|+|..         ....++||+|++|+.+|++
T Consensus         8 ~~~~Dl~~L~~l~E~~vl~nL~~Ry~~~~IYTy~G~iLiavNPyk~l~iY~~~~~~~Y~g~~~~~~pPHifaiA~~Ay~~   87 (697)
T 1lkx_A            8 EGVPDFVLLNQITENAFIENLTMRHKSDNIYTYIGDVVISTNPFKNLNIYKESDIKAYNGRYKYEMPPHMYALANDAYRS   87 (697)
T ss_dssp             -CCSSGGGCSSCSHHHHHHHHHHHHHTTCCEEESSSCEEEECCSSCCSCCSHHHHHHHSSCCGGGSCCCHHHHHHHHHHH
T ss_pred             cCCcccccCCCCCHHHHHHHHHHHHhcCCcEEeeCCeEEEEcCCcCCCCCCHHHHHHHhCCCCCCCCchHHHHHHHHHHH
Confidence            689999999999999999988       688999999999999999997653         1345899999999999999


Q ss_pred             cCCCccchhhhhhc-cC-------Cc---ccccccc-c-cchhhHHHHhhhhhhHHHhhccccccccCCCCcceeEEEEE
Q psy17854         73 MDPLNENVVSLLQV-SQ-------DP---FVAHIWK-D-AEIGELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRIN  139 (181)
Q Consensus        73 ~d~~~~~~~~ll~~-S~-------~~---~l~~l~~-~-~~~~~v~~~i~~~~~iLeafgna~T~~N~nssrfg~~~~l~  139 (181)
                      |....++|++++++ |+       +.   +++.+.. . .....+++++++++|||||||||||++|+||||||||++++
T Consensus        88 m~~~~~nQsIiisGESGAGKTe~tK~i~~yla~~~~~~~~~~~~i~~~il~snpiLEAFGNAkT~rNdNSSRFGKfi~i~  167 (697)
T 1lkx_A           88 MRQSQENQCVIISGESGAGKTEASKKIMQFLTFVSSNQSPNGERISKMLLDSNPLLEAFGNAKTLRNDNSSRFGKYMEMQ  167 (697)
T ss_dssp             HHHHCCCEEEEEECSTTSSHHHHHHHHHHHHHHHSCSSCHHHHHHHHHHHHHHHHHHHHHBBCCSSCSSCBCSEEEEEEE
T ss_pred             HHhcCCCcEEEecCCCCCCchhhHHHHHHHHHhhcCCCCCccccHHHHHHhcchHHHHhcCcccCCCCCcchhheeEEEE
Confidence            99999999988854 22       22   3343333 1 12357889999999999999999999999999999999999


Q ss_pred             ecCCCcccceeeeeEeeccccccccCCCCCchhhHHhhhcC
Q psy17854        140 FDASGYIAGANIETYLLEKSRAIRQAKDERTFHIFYQILAG  180 (181)
Q Consensus       140 f~~~~~~~g~~~~~~lleksRv~~~~~~ernfhiFy~ll~g  180 (181)
                      |+.+|.+.||+|.+||||||||+.|++||||||||||||+|
T Consensus       168 F~~~g~i~Ga~I~~yLLEKSRVv~q~~gERnfHIFYqllaG  208 (697)
T 1lkx_A          168 FNAVGSPIGGKITNYLLEKSRVVGRTQGERSFHIFYQMLKG  208 (697)
T ss_dssp             ECTTCCEEEEEEEEECCCGGGGTCCCTTCCCBHHHHHHHTT
T ss_pred             ECCCCCEeeeeeeeeeccCceeeeecCCCCceeehhHHhcC
Confidence            99999999999999999999999999999999999999998
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Back     alignment and structure
>4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Back     alignment and structure
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Back     alignment and structure
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Back     alignment and structure
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Back     alignment and structure
>4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 181
d1br2a2 710 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chick 2e-30
d1br2a2710 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chick 2e-08
d1w7ja2 730 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chick 6e-28
d1w7ja2 730 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chick 4e-04
d1kk8a2 789 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain 7e-28
d1kk8a2 789 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain 7e-07
d2mysa2 794 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain 7e-27
d2mysa2 794 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain 2e-04
d1lkxa_ 684 c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli 1e-26
d1lkxa_684 c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli 8e-06
d1d0xa2 712 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain 1e-26
d1d0xa2712 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain 1e-07
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 710 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]

 Score =  114 bits (285), Expect = 2e-30
 Identities = 72/84 (85%), Positives = 76/84 (90%)

Query: 97  KDAEIGELEQQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDASGYIAGANIETYLL 156
                GELE+QLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFD +GYI GANIETYLL
Sbjct: 134 PSFSYGELEKQLLQANPILEAFGNAKTVKNDNSSRFGKFIRINFDVTGYIVGANIETYLL 193

Query: 157 EKSRAIRQAKDERTFHIFYQILAG 180
           EKSRAIRQAKDERTFHIFY ++AG
Sbjct: 194 EKSRAIRQAKDERTFHIFYYLIAG 217
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 710 Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Length = 730 Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Length = 730 Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684 Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684 Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Length = 712 Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Length = 712 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query181
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 100.0
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 100.0
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 100.0
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 100.0
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 100.0
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 100.0
d1d0xa2712 Myosin S1, motor domain {Dictyostelium discoideum 98.93
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 98.87
d1w7ja2730 Myosin S1, motor domain {Chicken (Gallus gallus), 98.79
d1br2a2710 Myosin S1, motor domain {Chicken (Gallus gallus), 98.77
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 98.72
d1lkxa_684 Myosin S1, motor domain {Dictyostelium discoideum, 98.61
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Bay scallop (Aequipecten irradians) [TaxId: 31199]

Probab=100.00  E-value=5.4e-48  Score=350.48  Aligned_cols=172  Identities=40%  Similarity=0.556  Sum_probs=150.5

Q ss_pred             CCcCccccccCCCcchhhhhh-------hhhccCCCCeeEeCCCCCCCCccc---------ccccCCCccchhhhhHHHh
Q psy17854          9 TQFGARTRYDRMHNRAKPQER-------KNSRRDGPSLLFVTPGSPVPVLKG---------LKTAIEPVDYSAEKWLMKN   72 (181)
Q Consensus         9 ~~~~~~~~l~~l~e~~~l~~~-------~~~t~~G~~li~vNP~~~~p~~f~---------i~h~agph~Y~va~~~~kn   72 (181)
                      ++.+||+.|++|||++||.++       ..||++|++||+||||+++|+|..         .....+||+|++|+.||++
T Consensus        35 ~~v~Dl~~L~~l~E~~vl~~L~~Ry~~~~iYT~~G~iLiavNP~k~l~iy~~~~~~~y~~~~~~~~~PHiyavA~~Ay~~  114 (789)
T d1kk8a2          35 EKLEDMANMTYLNEASVLYNLRSRYTSGLIYTYSGLFCIAVNPYRRLPIYTDSVIAKYRGKRKTEIPPHLFSVADNAYQN  114 (789)
T ss_dssp             TTCSBGGGSSCCSHHHHHHHHHHHHHTTCCEEEETTEEEEECCSSCCSTTSHHHHHHHTTCCGGGSCCCHHHHHHHHHHH
T ss_pred             cCcchhccCCCCCHHHHHHHHHHHHcCCCceEeECCEEEEECCCCCCCCCCHHHHHHHcCCCCCCCCCcHHHHHHHHHHH
Confidence            689999999999999999988       788899999999999999996553         2344799999999999999


Q ss_pred             cCCCccchhhhhhc-c--C-----Ccccccccc---cc----------chhhHHHHhhhhhhHHHhhccccccccCCCCc
Q psy17854         73 MDPLNENVVSLLQV-S--Q-----DPFVAHIWK---DA----------EIGELEQQLLQANPILEAFGNAKTVKNDNSSR  131 (181)
Q Consensus        73 ~d~~~~~~~~ll~~-S--~-----~~~l~~l~~---~~----------~~~~v~~~i~~~~~iLeafgna~T~~N~nssr  131 (181)
                      |....++|++++++ |  +     +.++.++..   ..          ....+++++.+++|||||||||+|.+|+||||
T Consensus       115 m~~~~~nQ~IiisGESGaGKTe~~K~il~yL~~~~~~~~~~~~~~~~~~~~~i~~~il~~npiLEAFGNAkT~~N~NSSR  194 (789)
T d1kk8a2         115 MVTDRENQSCLITGESGAGKTENTKKVIMYLAKVACAVKKKDEEASDKKEGSLEDQIIQANPVLEAYGNAKTTRNNNSSR  194 (789)
T ss_dssp             HHHHTSEEEEEEECSTTSSHHHHHHHHHHHHHHHSCCCCCC--------CCCHHHHHHHHHHHHHHHHEECCSSCTTEES
T ss_pred             HHHhCCCcEEEEEeCCCCCHHHHHHHHHHHHHHHhcccccccccccccccccHHHHHHHHhHHHHhccccCCCCCCccCC
Confidence            99999999988754 2  2     234444432   11          12358899999999999999999999999999


Q ss_pred             ceeEEEEEecCCCcccceeeeeEeeccccccccCCCCCchhhHHhhhcC
Q psy17854        132 FGKFIRINFDASGYIAGANIETYLLEKSRAIRQAKDERTFHIFYQILAG  180 (181)
Q Consensus       132 fg~~~~l~f~~~~~~~g~~~~~~lleksRv~~~~~~ernfhiFy~ll~g  180 (181)
                      |||+++++|++.|.|.||+|.+||||||||+.+++||||||||||||+|
T Consensus       195 FGk~~~l~f~~~g~i~ga~i~~yLLEksRvv~~~~gErnfHIFY~ll~G  243 (789)
T d1kk8a2         195 FGKFIRIHFGPTGKIAGADIETYLLEKSRVTYQQSAERNYHIFYQICSN  243 (789)
T ss_dssp             SEEEEEEEECTTSSEEEEEEEEECCCGGGGTCCCTTCCSBHHHHHHTSC
T ss_pred             cceeEEEEECCCCCCccceeEEecCCCceeeecccccchhHHHHHHHcC
Confidence            9999999999999999999999999999999999999999999999998
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure