Psyllid ID: psy17870

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400------
MSFYYRLEGYLYLLYARLVLAPRIFSAQDALAKKYFGSSCPSTKDMVRNRSLLLSSSMWIFEYTRPVFPNTIHVGPLHIGDTKPLPQDLAKWVEGGKKGAIYFSLGSNVKSAALEDSKRTAILAALARFPDYRIIWKWENEELEGLPSNVICRKWLPQHDLLGTVDLAKWVEGGKKGAIYFSLGSNVKSAALEDSKRTAILAALARFPDYRIIWKWENEELEGLPSNVICRKWLPQHDLLAHPNIKLFITQGGLQSLQEAVHFEVPVIGIPFFGDQNYNVKIIRRLGIGSYMEFEDIHTETLFENIQEILNNYDRYKKAVKRASDISKTQMMSPRDTAVWWVEYLLKADGNVSHLQPEYWHLTWYEYFGLDVYLVIFSPVILALYGLYRLVLTINRRWSKGKLKSE
ccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccccccHHHHHccccEEEEEEcccccccccccccEEEEccccccccccccHHHHHHHHcccccEEEEEcccccccccccHHHHHHHHHHHHcccccEEEEEEEccccccccccEEEccccccccccccHHHHHHHHccccEEEEEEcccccccccccHHHHHHHHHHHHccccccEEEEEcccccccccccEEEEccccccccccccccEEEEEcccccHHHHHHHccccEEcccccccHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHHccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
ccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHccccEEEEEcccccccccccccccEEEEEccccccccHHHHHHHHHHcccccEEEEEccccccccccHHHcHHHHHHHHHccccEEEEEEEcccccccccccEEEEcccccccccccccEEEEEEcccccEEEEEcccccccccccHHHHHHHHHHHHcccccEEEEEEccccccccccccEEEEEccccccccccccEEEEEccccccEHHHHHccccEEEcccccccccHHHHHHHcccEEEEEEccccHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccHHHHEHHHHHHHHcccccccccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
MSFYYRLEGYLYLLYARLVLAPRIFSAQDALAKkyfgsscpstkdmVRNRSLLLsssmwifeytrpvfpntihvgplhigdtkplpqDLAKWVEGGKKGAIYFSLGsnvksaaleDSKRTAILAALARFPDYRIIWKWEneeleglpsnvicrkwlpqhdllgtVDLAKWVEGGKKGAIYFSLGsnvksaaleDSKRTAILAALARFPDYRIIWKWEneeleglpsnvicrkwlpqhdllahpnikLFITQGGLQSLQeavhfevpvigipffgdqnynvKIIRRlgigsymefedIHTETLFENIQEILNNYDRYKKAVKRASDisktqmmsprdTAVWWVEYLLKAdgnvshlqpeywHLTWYEYFGLDVYLVIFSPVILALYGLYRLVLTINRrwskgklkse
MSFYYRLEGYLYLLYARLVLAPRIFSAQDALAKKyfgsscpstkdMVRNRSLLLSSSMWIFEYTRPVFPNTIHVGPLHIGDTKPLPQDLAKWVEGGKKGAIYFSLGSNVKSAALEDSKRTAILAALARFPDYRIIWKWENEELEGLPSNVICRKWLPQHDLLGTVDLAKWVEGGKKGAIYFSLGSNVKSAALEDSKRTAILAALARFPDYRIIWKWENEELEGLPSNVICRKWLPQHDLLAHPNIKLFITQGGLQSLQEAVHFEVPVIgipffgdqnynVKIIRRLGIGSYMEFEDIHTETLFENIQEILNNYDRYKKAVKRasdisktqmmsprDTAVWWVEYLLKADGNVSHLQPEYWHLTWYEYFGLDVYLVIFSPVILALYGLYRLVLTinrrwskgklkse
MSFyyrlegylyllyARLVLAPRIFSAQDALAKKYFGSSCPSTKDMVRNRSLLLSSSMWIFEYTRPVFPNTIHVGPLHIGDTKPLPQDLAKWVEGGKKGAIYFSLGSNVKSAALEDSKRTAILAALARFPDYRIIWKWENEELEGLPSNVICRKWLPQHDLLGTVDLAKWVEGGKKGAIYFSLGSNVKSAALEDSKRTAILAALARFPDYRIIWKWENEELEGLPSNVICRKWLPQHDLLAHPNIKLFITQGGLQSLQEAVHFEVPVIGIPFFGDQNYNVKIIRRLGIGSYMEFEDIHTETLFENIQEILNNYDRYKKAVKRASDISKTQMMSPRDTAVWWVEYLLKADGNVSHLQPEYWHLTWYEYFGLDVYLVIFSPVILALYGLYRLVLTINRRWSKGKLKSE
**FYYRLEGYLYLLYARLVLAPRIFSAQDALAKKYFGSSCPSTKDMVRNRSLLLSSSMWIFEYTRPVFPNTIHVGPLHIGDTKPLPQDLAKWVEGGKKGAIYFSLGSNVKSAALEDSKRTAILAALARFPDYRIIWKWENEELEGLPSNVICRKWLPQHDLLGTVDLAKWVEGGKKGAIYFSLGSNVKSAALEDSKRTAILAALARFPDYRIIWKWENEELEGLPSNVICRKWLPQHDLLAHPNIKLFITQGGLQSLQEAVHFEVPVIGIPFFGDQNYNVKIIRRLGIGSYMEFEDIHTETLFENIQEILNNYDRYKKAVKR************RDTAVWWVEYLLKADGNVSHLQPEYWHLTWYEYFGLDVYLVIFSPVILALYGLYRLVLTINRRW********
MSFYYRLEGYLYLLYARLVLAPRIFSAQDALAKKYFGSSCPSTKDMVRNRSLLLSSSMWIFEYTRPVFPNTIHVGPLHIGDTKPLPQDLAKWVEGGKKGAIYFSLGSNVKSAALEDSKRTAILAALARFPDYRIIWKWENEELEGLPSNVICRKWLPQHDLLGTVDLAKWVEGGKKGAIYFSLGSNVKSAALEDSKRTAILAALARFPDYRIIWKWENEELEGLPSNVICRKWLPQHDLLAHPNIKLFITQGGLQSLQEAVHFEVPVIGIPFFGDQNYNVKIIRRLGIGSYMEFEDIHTETLFENIQEILNNYDRYKKAVKRASDISKTQMMSPRDTAVWWVEYLLKADGNVSHLQPEYWHLTWYEYFGLDVYLVIFSPVILALYGLYRLVLTINRRW*KG*****
MSFYYRLEGYLYLLYARLVLAPRIFSAQDALAKKYFGSSCPSTKDMVRNRSLLLSSSMWIFEYTRPVFPNTIHVGPLHIGDTKPLPQDLAKWVEGGKKGAIYFSLGSNVKSAALEDSKRTAILAALARFPDYRIIWKWENEELEGLPSNVICRKWLPQHDLLGTVDLAKWVEGGKKGAIYFSLGSNVKSAALEDSKRTAILAALARFPDYRIIWKWENEELEGLPSNVICRKWLPQHDLLAHPNIKLFITQGGLQSLQEAVHFEVPVIGIPFFGDQNYNVKIIRRLGIGSYMEFEDIHTETLFENIQEILNNYDRYKKAVKRASDISKTQMMSPRDTAVWWVEYLLKADGNVSHLQPEYWHLTWYEYFGLDVYLVIFSPVILALYGLYRLVLTINRRWSKGKLKSE
*SFYYRLEGYLYLLYARLVLAPRIFSAQDALAKKYFGSSCPSTKDMVRNRSLLLSSSMWIFEYTRPVFPNTIHVGPLHIGDTKPLPQDLAKWVEGGKKGAIYFSLGSNVKSAALEDSKRTAILAALARFPDYRIIWKWENEELEGLPSNVICRKWLPQHDLLGTVDLAKWVEGGKKGAIYFSLGSNVKSAALEDSKRTAILAALARFPDYRIIWKWENEELEGLPSNVICRKWLPQHDLLAHPNIKLFITQGGLQSLQEAVHFEVPVIGIPFFGDQNYNVKIIRRLGIGSYMEFEDIHTETLFENIQEILNNYDRYKKAVKRASDISKTQMMSPRDTAVWWVEYLLKADGNVSHLQPEYWHLTWYEYFGLDVYLVIFSPVILALYGLYRLVLTINRRWSKG*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSFYYRLEGYLYLLYARLVLAPRIFSAQDALAKKYFGSSCPSTKDMVRNRSLLLSSSMWIFEYTRPVFPNTIHVGPLHIGDTKPLPQDLAKWVEGGKKGAIYFSLGSNVKSAALEDSKRTAILAALARFPDYRIIWKWENEELEGLPSNVICRKWLPQHDLLGTVDLAKWVEGGKKGAIYFSLGSNVKSAALEDSKRTAILAALARFPDYRIIWKWENEELEGLPSNVICRKWLPQHDLLAHPNIKLFITQGGLQSLQEAVHFEVPVIGIPFFGDQNYNVKIIRRLGIGSYMEFEDIHTETLFENxxxxxxxxxxxxxxxxxxxxxSKTQMMSPRDTAVWWVEYLLKADGNVSHLQPEYWHLTWYEYFGLDVYLVIFSPVILALYGLYRLVLTINRRWSKGKLKSE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query406 2.2.26 [Sep-21-2011]
Q6K1J1530 UDP-glucuronosyltransfera yes N/A 0.605 0.464 0.310 2e-33
P36512531 UDP-glucuronosyltransfera no N/A 0.588 0.450 0.313 4e-33
P36514502 UDP-glucuronosyltransfera no N/A 0.598 0.484 0.301 5e-33
O02663529 UDP-glucuronosyltransfera N/A N/A 0.554 0.425 0.320 5e-33
Q64435531 UDP-glucuronosyltransfera no N/A 0.758 0.580 0.291 6e-33
Q9GLD9529 UDP-glucuronosyltransfera yes N/A 0.596 0.457 0.297 8e-33
Q88168515 Ecdysteroid UDP-glucosylt N/A N/A 0.534 0.421 0.32 1e-32
P08430529 UDP-glucuronosyltransfera no N/A 0.758 0.582 0.294 2e-32
P09875529 UDP-glucuronosyltransfera no N/A 0.608 0.466 0.306 2e-32
Q9TSL6529 UDP-glucuronosyltransfera N/A N/A 0.596 0.457 0.293 3e-32
>sp|Q6K1J1|UDB31_CANFA UDP-glucuronosyltransferase 2B31 OS=Canis familiaris GN=UGT2B31 PE=1 SV=1 Back     alignment and function desciption
 Score =  143 bits (361), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 82/264 (31%), Positives = 144/264 (54%), Gaps = 18/264 (6%)

Query: 156 LPQHDLLGTV----------DLAKWVEG-GKKGAIYFSLGSNVKSAALEDSKRTAILAAL 204
           LP  D +G +          ++ ++V+  G+ G + FSLGS V +  + + +   I +AL
Sbjct: 272 LPHFDFVGGLHCKPAKSLPTEMEEFVQSSGENGIVVFSLGSMVNN--MTEERANVIASAL 329

Query: 205 ARFPDYRIIWKWENEELEGLPSNVICRKWLPQHDLLAHPNIKLFITQGGLQSLQEAVHFE 264
           A+ P  +++W+++ ++ + L  N    KWLPQ+DLL HP  K FIT GG   + EA++  
Sbjct: 330 AQIPQ-KVLWRFDGKKPDTLGPNTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHG 388

Query: 265 VPVIGIPFFGDQNYNVKIIRRLGIGSYMEFEDIHTETLFENIQEILNNYDRYKKAVKRAS 324
           +P++GIP F DQ  N+  ++  G    ++F  + +  L   ++ ++N+   YK+   + S
Sbjct: 389 IPMVGIPLFADQADNIVHMKAKGAAIRLDFSTMSSADLLNALRMVIND-PSYKENAMKLS 447

Query: 325 DISKTQMMSPRDTAVWWVEYLLKADGNVSHLQPEYWHLTWYEYFGLDVYLVIFSPVILAL 384
            I   Q + P D AV+W+EY+++  G   HL+P    LTW++Y  LDV   + + V  A+
Sbjct: 448 GIHHDQPIKPLDRAVFWIEYVMRHQG-AKHLRPASHDLTWFQYHSLDVIGFLLACVATAI 506

Query: 385 YGLYRLVLTINRRWSKG--KLKSE 406
           +   +  L   R+ +K   K+K E
Sbjct: 507 FVTTQCCLFCCRKVAKTGKKIKKE 530
UDPGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isozyme has glucuronidating capacity on phenols, opioids, and carboxylic acid-containing drugs.
Canis familiaris (taxid: 9615)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 7
>sp|P36512|UDB13_RABIT UDP-glucuronosyltransferase 2B13 OS=Oryctolagus cuniculus GN=UGT2B13 PE=2 SV=1 Back     alignment and function description
>sp|P36514|UD2C1_RABIT UDP-glucuronosyltransferase 2C1 (Fragment) OS=Oryctolagus cuniculus GN=UGT2C1 PE=2 SV=1 Back     alignment and function description
>sp|O02663|UD2B9_MACFA UDP-glucuronosyltransferase 2B9 OS=Macaca fascicularis GN=UGT2B9 PE=2 SV=1 Back     alignment and function description
>sp|Q64435|UD16_MOUSE UDP-glucuronosyltransferase 1-6 OS=Mus musculus GN=Ugt1a6 PE=1 SV=1 Back     alignment and function description
>sp|Q9GLD9|UDB33_MACMU UDP-glucuronosyltransferase 2B33 OS=Macaca mulatta GN=UGT2B33 PE=1 SV=1 Back     alignment and function description
>sp|Q88168|UDPE_NPVSL Ecdysteroid UDP-glucosyltransferase OS=Spodoptera littoralis nuclear polyhedrosis virus GN=EGT PE=3 SV=1 Back     alignment and function description
>sp|P08430|UD16_RAT UDP-glucuronosyltransferase 1-6 OS=Rattus norvegicus GN=Ugt1a6 PE=2 SV=1 Back     alignment and function description
>sp|P09875|UD2B1_RAT UDP-glucuronosyltransferase 2B1 OS=Rattus norvegicus GN=Ugt2b1 PE=2 SV=1 Back     alignment and function description
>sp|Q9TSL6|UDB23_MACFA UDP-glucuronosyltransferase 2B23 OS=Macaca fascicularis GN=UGT2B23 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query406
189240910 518 PREDICTED: similar to glucosyl/glucurono 0.512 0.401 0.472 2e-48
242013333 522 UDP-glucuronosyltransferase 1-8 precurso 0.576 0.448 0.426 3e-48
270013462 983 hypothetical protein TcasGA2_TC012061 [T 0.524 0.216 0.452 2e-47
189240914 524 PREDICTED: similar to glucosyl/glucurono 0.524 0.406 0.452 2e-47
91090210 528 PREDICTED: similar to glucosyl/glucurono 0.524 0.403 0.457 3e-47
91090214 519 PREDICTED: similar to glucosyl/glucurono 0.524 0.410 0.448 3e-47
189240912 526 PREDICTED: similar to glucosyl/glucurono 0.524 0.404 0.448 7e-46
270013464 530 hypothetical protein TcasGA2_TC012063 [T 0.524 0.401 0.448 7e-46
91095083 771 PREDICTED: similar to glucosyl/glucurono 0.504 0.265 0.461 2e-45
270015480 787 hypothetical protein TcasGA2_TC004274 [T 0.504 0.260 0.461 2e-45
>gi|189240910|ref|XP_967606.2| PREDICTED: similar to glucosyl/glucuronosyl transferases [Tribolium castaneum] gi|270013465|gb|EFA09913.1| hypothetical protein TcasGA2_TC012064 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  199 bits (506), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 103/218 (47%), Positives = 140/218 (64%), Gaps = 10/218 (4%)

Query: 154 KWLPQHDLLGTVDLAKWVEGGKKGAIYFSLGSNVKSAALEDSKRTAILAALARFPDYRII 213
           K LPQ       DL ++++  K G IYFSLGSN+KSA L   KR A+L   A+    +I+
Sbjct: 273 KKLPQ-------DLQEFLDSAKHGVIYFSLGSNLKSAQLPLEKRNALLQTFAKL-KQKIL 324

Query: 214 WKWENEELEGLPSNVICRKWLPQHDLLAHPNIKLFITQGGLQSLQEAVHFEVPVIGIPFF 273
           WKWE+E+L G P NV   KWLPQ D+LAHPN+KLFIT GG  S  E ++  VP++GIP F
Sbjct: 325 WKWEDEDLPGKPPNVKVAKWLPQQDILAHPNVKLFITHGGQSSTTETIYHGVPILGIPIF 384

Query: 274 GDQNYNVKIIRRLGIGSYMEFEDIHTETLFENIQEILNNYDRYKKAVKRASDISKTQMMS 333
           GDQ  N K + R G G Y+ + +I  E L E+I EIL+N  +YK+ V+R S +   +++S
Sbjct: 385 GDQKINAKSVARDGCGLYVAYSEITEEKLTESINEILHN-QKYKENVQRRSKLFHDRIVS 443

Query: 334 PRDTAVWWVEYLLKADGNVSHLQPEYWHLTWYEYFGLD 371
           P DTA++WVEY+++  G   HL+     L WY+Y  LD
Sbjct: 444 PLDTAIYWVEYVIRHRG-APHLRVAALDLPWYKYLLLD 480

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242013333|ref|XP_002427365.1| UDP-glucuronosyltransferase 1-8 precursor, putative [Pediculus humanus corporis] gi|212511724|gb|EEB14627.1| UDP-glucuronosyltransferase 1-8 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|270013462|gb|EFA09910.1| hypothetical protein TcasGA2_TC012061 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189240914|ref|XP_967845.2| PREDICTED: similar to glucosyl/glucuronosyl transferases [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91090210|ref|XP_967762.1| PREDICTED: similar to glucosyl/glucuronosyl transferases [Tribolium castaneum] gi|270013463|gb|EFA09911.1| hypothetical protein TcasGA2_TC012062 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91090214|ref|XP_967924.1| PREDICTED: similar to glucosyl/glucuronosyl transferases [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189240912|ref|XP_967685.2| PREDICTED: similar to glucosyl/glucuronosyl transferases [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270013464|gb|EFA09912.1| hypothetical protein TcasGA2_TC012063 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91095083|ref|XP_973134.1| PREDICTED: similar to glucosyl/glucuronosyl transferases [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270015480|gb|EFA11928.1| hypothetical protein TcasGA2_TC004274 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query406
FB|FBgn0040255527 Ugt86De "Ugt86De" [Drosophila 0.576 0.444 0.392 8.4e-42
FB|FBgn0040253487 Ugt86Dg "Ugt86Dg" [Drosophila 0.551 0.459 0.368 3.6e-41
FB|FBgn0040256517 Ugt86Dd "Ugt86Dd" [Drosophila 0.564 0.442 0.386 7.5e-41
FB|FBgn0034605530 CG15661 [Drosophila melanogast 0.576 0.441 0.370 1.2e-40
FB|FBgn0027070517 CG17322 [Drosophila melanogast 0.578 0.454 0.356 2.6e-40
FB|FBgn0026314516 Ugt35b "UDP-glycosyltransferas 0.527 0.414 0.417 2.6e-40
FB|FBgn0032684530 CG10178 [Drosophila melanogast 0.573 0.439 0.352 6.8e-40
FB|FBgn0040259528 Ugt86Da "Ugt86Da" [Drosophila 0.561 0.431 0.359 2.9e-39
FB|FBgn0051002521 CG31002 [Drosophila melanogast 0.564 0.439 0.372 2.9e-39
FB|FBgn0038886537 CG6475 [Drosophila melanogaste 0.566 0.428 0.362 4.8e-39
FB|FBgn0040255 Ugt86De "Ugt86De" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 443 (161.0 bits), Expect = 8.4e-42, P = 8.4e-42
 Identities = 95/242 (39%), Positives = 146/242 (60%)

Query:   166 DLAKWVEG-GKKGAIYFSLGSNVKSAALEDSKRTAILAALARFPDYRIIWKWENEELEGL 224
             DL  +++G G+ G IYFSLG+NV+S  L   +R  ++   A  P  RI+WK++ +EL  +
Sbjct:   282 DLEDFIQGAGEHGVIYFSLGTNVRSRNLSKDRRKILIDTFASLPQ-RILWKFDADELSDV 340

Query:   225 PSNVICRKWLPQHDLLAHPNIKLFITQGGLQSLQEAVHFEVPVIGIPFFGDQNYNVKIIR 284
             PSNV+   W PQ D+LAHPN+KLFIT GGLQS  E +H  VP++G+PFF DQ  N++ I+
Sbjct:   341 PSNVLISPWFPQQDILAHPNVKLFITHGGLQSTVECIHRGVPMLGLPFFYDQFRNMEHIK 400

Query:   285 RLGIGSYMEFEDIHTETLFENIQEILNNYDRYKKAVKRASDISKTQMMSPRDTAVWWVEY 344
               GIG  + + D+ ++   + I ++L       KA KR +D  + Q M+P DTA+WW  Y
Sbjct:   401 AQGIGLVLNYRDMTSDEFKDTIHQLLTEKSFGVKA-KRTADRYRDQPMNPLDTAIWWTHY 459

Query:   345 LLKADGNVSHLQPEYWHLTWYEYFGLDVYLVIFSPVILALYGLYRLVLTINRRWSKGKLK 404
             +L+  G   H++    +L +  Y  LDV L  F   +LA++ +  +V+    +  +  LK
Sbjct:   460 VLRHKG-APHMRVAGRNLDFITYHSLDV-LGTF---LLAVWAILSIVVLCAIKLLRAILK 514

Query:   405 SE 406
             S+
Sbjct:   515 SK 516
GO:0015020 "glucuronosyltransferase activity" evidence=ISS
GO:0008152 "metabolic process" evidence=IEA
FB|FBgn0040253 Ugt86Dg "Ugt86Dg" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0040256 Ugt86Dd "Ugt86Dd" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0034605 CG15661 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0027070 CG17322 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0026314 Ugt35b "UDP-glycosyltransferase 35b" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0032684 CG10178 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0040259 Ugt86Da "Ugt86Da" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0051002 CG31002 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038886 CG6475 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.4.10.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query406
PHA03392507 PHA03392, egt, ecdysteroid UDP-glucosyltransferase 3e-43
pfam00201500 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosy 4e-38
COG1819406 COG1819, COG1819, Glycosyl transferases, related t 5e-21
PHA03392507 PHA03392, egt, ecdysteroid UDP-glucosyltransferase 2e-19
pfam00201500 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosy 9e-19
cd03784401 cd03784, GT1_Gtf_like, This family includes the Gt 2e-16
TIGR01426392 TIGR01426, MGT, glycosyltransferase, MGT family 5e-16
PLN02207468 PLN02207, PLN02207, UDP-glycosyltransferase 8e-07
PLN02173449 PLN02173, PLN02173, UDP-glucosyl transferase famil 2e-06
PLN00164480 PLN00164, PLN00164, glucosyltransferase; Provision 3e-06
PLN02555480 PLN02555, PLN02555, limonoid glucosyltransferase 8e-06
PLN02167475 PLN02167, PLN02167, UDP-glycosyltransferase family 1e-05
PLN02534491 PLN02534, PLN02534, UDP-glycosyltransferase 2e-05
pfam13528317 pfam13528, Glyco_trans_1_3, Glycosyl transferase f 2e-05
PLN03004451 PLN03004, PLN03004, UDP-glycosyltransferase 4e-05
PLN02992481 PLN02992, PLN02992, coniferyl-alcohol glucosyltran 4e-05
PLN02210456 PLN02210, PLN02210, UDP-glucosyl transferase 1e-04
PLN02410451 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl 2e-04
PLN02554481 PLN02554, PLN02554, UDP-glycosyltransferase family 2e-04
PLN03007482 PLN03007, PLN03007, UDP-glucosyltransferase family 2e-04
TIGR00661321 TIGR00661, MJ1255, conserved hypothetical protein 3e-04
cd03784401 cd03784, GT1_Gtf_like, This family includes the Gt 4e-04
PLN02448459 PLN02448, PLN02448, UDP-glycosyltransferase family 5e-04
PLN02562448 PLN02562, PLN02562, UDP-glycosyltransferase 0.001
PLN02764453 PLN02764, PLN02764, glycosyltransferase family pro 0.001
PLN02152455 PLN02152, PLN02152, indole-3-acetate beta-glucosyl 0.002
COG1819406 COG1819, COG1819, Glycosyl transferases, related t 0.004
COG0707357 COG0707, MurG, UDP-N-acetylglucosamine:LPS N-acety 0.004
>gnl|CDD|223071 PHA03392, egt, ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information 
 Score =  157 bits (400), Expect = 3e-43
 Identities = 62/216 (28%), Positives = 119/216 (55%), Gaps = 3/216 (1%)

Query: 164 TVDLAKWVEGGKKGAIYFSLGSNVKSAALEDSKRTAILAALARFPDYRIIWKWENE-ELE 222
              L +++     G +Y S GS++ +  +++     +L    + P Y ++WK++ E E  
Sbjct: 284 DDYLEEFLNNSTNGVVYVSFGSSIDTNDMDNEFLQMLLRTFKKLP-YNVLWKYDGEVEAI 342

Query: 223 GLPSNVICRKWLPQHDLLAHPNIKLFITQGGLQSLQEAVHFEVPVIGIPFFGDQNYNVKI 282
            LP+NV+ +KW PQ  +L H N+K F+TQGG+QS  EA+   VP++G+P  GDQ YN   
Sbjct: 343 NLPANVLTQKWFPQRAVLKHKNVKAFVTQGGVQSTDEAIDALVPMVGLPMMGDQFYNTNK 402

Query: 283 IRRLGIGSYMEFEDIHTETLFENIQEILNNYDRYKKAVKRASDISKTQMMSPRDTAVWWV 342
              LGIG  ++   +    L   I +++ N  +Y+K +K    + + Q M+P   A+W+ 
Sbjct: 403 YVELGIGRALDTVTVSAAQLVLAIVDVIEN-PKYRKNLKELRHLIRHQPMTPLHKAIWYT 461

Query: 343 EYLLKADGNVSHLQPEYWHLTWYEYFGLDVYLVIFS 378
           E++++     + L+ +  ++++ +YF   + + + +
Sbjct: 462 EHVIRNKHGNTSLKTKAANVSYSDYFMSYILVPLVT 497

Length = 507
>gnl|CDD|201077 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|224732 COG1819, COG1819, Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|223071 PHA03392, egt, ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|201077 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|99960 cd03784, GT1_Gtf_like, This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>gnl|CDD|233407 TIGR01426, MGT, glycosyltransferase, MGT family Back     alignment and domain information
>gnl|CDD|177857 PLN02207, PLN02207, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|177830 PLN02173, PLN02173, UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|215084 PLN00164, PLN00164, glucosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|178170 PLN02555, PLN02555, limonoid glucosyltransferase Back     alignment and domain information
>gnl|CDD|215112 PLN02167, PLN02167, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|215293 PLN02534, PLN02534, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|222200 pfam13528, Glyco_trans_1_3, Glycosyl transferase family 1 Back     alignment and domain information
>gnl|CDD|178581 PLN03004, PLN03004, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|178572 PLN02992, PLN02992, coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>gnl|CDD|215127 PLN02210, PLN02210, UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|178032 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|215304 PLN02554, PLN02554, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|178584 PLN03007, PLN03007, UDP-glucosyltransferase family protein Back     alignment and domain information
>gnl|CDD|233077 TIGR00661, MJ1255, conserved hypothetical protein Back     alignment and domain information
>gnl|CDD|99960 cd03784, GT1_Gtf_like, This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>gnl|CDD|215247 PLN02448, PLN02448, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|215305 PLN02562, PLN02562, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|178364 PLN02764, PLN02764, glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|177813 PLN02152, PLN02152, indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>gnl|CDD|224732 COG1819, COG1819, Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|223779 COG0707, MurG, UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 406
PF00201500 UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera 100.0
PHA03392507 egt ecdysteroid UDP-glucosyltransferase; Provision 100.0
KOG1192|consensus496 100.0
PLN02207468 UDP-glycosyltransferase 100.0
PLN02670472 transferase, transferring glycosyl groups 100.0
PLN02208442 glycosyltransferase family protein 100.0
PLN02562448 UDP-glycosyltransferase 100.0
PLN02554481 UDP-glycosyltransferase family protein 100.0
PLN03004451 UDP-glycosyltransferase 100.0
PLN02410451 UDP-glucoronosyl/UDP-glucosyl transferase family p 100.0
PLN02167475 UDP-glycosyltransferase family protein 99.98
PLN02992481 coniferyl-alcohol glucosyltransferase 99.97
PLN02555480 limonoid glucosyltransferase 99.97
PLN03007482 UDP-glucosyltransferase family protein 99.97
PLN02152455 indole-3-acetate beta-glucosyltransferase 99.97
PLN03015470 UDP-glucosyl transferase 99.97
PLN02764453 glycosyltransferase family protein 99.97
PLN02863477 UDP-glucoronosyl/UDP-glucosyl transferase family p 99.97
PLN02173449 UDP-glucosyl transferase family protein 99.97
PLN02210456 UDP-glucosyl transferase 99.97
PLN00164480 glucosyltransferase; Provisional 99.97
PLN00414446 glycosyltransferase family protein 99.97
PLN02448459 UDP-glycosyltransferase family protein 99.96
PLN02534491 UDP-glycosyltransferase 99.96
COG1819406 Glycosyl transferases, related to UDP-glucuronosyl 99.95
TIGR01426392 MGT glycosyltransferase, MGT family. This model de 99.95
cd03784401 GT1_Gtf_like This family includes the Gtfs, a grou 99.94
COG0707357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami 99.73
PRK12446352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 99.72
PF04101167 Glyco_tran_28_C: Glycosyltransferase family 28 C-t 99.67
TIGR00661321 MJ1255 conserved hypothetical protein. This model 99.55
PF13528318 Glyco_trans_1_3: Glycosyl transferase family 1 99.55
PRK00726357 murG undecaprenyldiphospho-muramoylpentapeptide be 99.45
PRK13608391 diacylglycerol glucosyltransferase; Provisional 99.32
PRK13609380 diacylglycerol glucosyltransferase; Provisional 99.27
cd03785350 GT1_MurG MurG is an N-acetylglucosaminyltransferas 99.23
PLN02605382 monogalactosyldiacylglycerol synthase 99.13
TIGR01133348 murG undecaprenyldiphospho-muramoylpentapeptide be 99.1
TIGR03492396 conserved hypothetical protein. This protein famil 99.08
COG4671400 Predicted glycosyl transferase [General function p 98.87
TIGR03590279 PseG pseudaminic acid biosynthesis-associated prot 98.83
TIGR00215385 lpxB lipid-A-disaccharide synthase. Lipid-A precur 98.79
PRK00025380 lpxB lipid-A-disaccharide synthase; Reviewed 98.72
KOG3349|consensus170 98.6
cd03814364 GT1_like_2 This family is most closely related to 98.29
PRK05749425 3-deoxy-D-manno-octulosonic-acid transferase; Revi 98.29
COG5017161 Uncharacterized conserved protein [Function unknow 98.24
TIGR00236365 wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras 98.07
COG3980318 spsG Spore coat polysaccharide biosynthesis protei 98.06
cd03801374 GT1_YqgM_like This family is most closely related 98.01
cd03823359 GT1_ExpE7_like This family is most closely related 97.99
cd03786363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th 97.97
PRK14089347 ipid-A-disaccharide synthase; Provisional 97.97
cd03800398 GT1_Sucrose_synthase This family is most closely r 97.95
cd03795357 GT1_like_4 This family is most closely related to 97.92
cd05844367 GT1_like_7 Glycosyltransferases catalyze the trans 97.88
cd03794394 GT1_wbuB_like This family is most closely related 97.88
PF00534172 Glycos_transf_1: Glycosyl transferases group 1; In 97.86
cd03821375 GT1_Bme6_like This family is most closely related 97.85
PRK15484380 lipopolysaccharide 1,2-N-acetylglucosaminetransfer 97.84
cd03820348 GT1_amsD_like This family is most closely related 97.83
cd03808359 GT1_cap1E_like This family is most closely related 97.77
cd03817374 GT1_UGDG_like This family is most closely related 97.77
cd03807365 GT1_WbnK_like This family is most closely related 97.76
cd03822366 GT1_ecORF704_like This family is most closely rela 97.74
COG1519419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase 97.72
cd04946407 GT1_AmsK_like This family is most closely related 97.72
cd03798377 GT1_wlbH_like This family is most closely related 97.71
cd04962371 GT1_like_5 This family is most closely related to 97.68
PRK15427406 colanic acid biosynthesis glycosyltransferase WcaL 97.65
cd04951360 GT1_WbdM_like This family is most closely related 97.65
PLN02871465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 97.61
PF02350346 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; 97.6
cd03818396 GT1_ExpC_like This family is most closely related 97.58
TIGR03449405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino 97.58
cd03825365 GT1_wcfI_like This family is most closely related 97.58
cd03804351 GT1_wbaZ_like This family is most closely related 97.55
PF13844468 Glyco_transf_41: Glycosyl transferase family 41; P 97.55
cd03799355 GT1_amsK_like This is a family of GT1 glycosyltran 97.53
cd04949372 GT1_gtfA_like This family is most closely related 97.5
TIGR03088374 stp2 sugar transferase, PEP-CTERM/EpsH1 system ass 97.46
TIGR03087397 stp1 sugar transferase, PEP-CTERM/EpsH1 system ass 97.41
cd03812358 GT1_CapH_like This family is most closely related 97.31
TIGR02149388 glgA_Coryne glycogen synthase, Corynebacterium fam 97.26
cd03792372 GT1_Trehalose_phosphorylase Trehalose phosphorylas 97.23
cd03809365 GT1_mtfB_like This family is most closely related 97.22
cd03805392 GT1_ALG2_like This family is most closely related 97.2
cd03811353 GT1_WabH_like This family is most closely related 97.18
PRK10307412 putative glycosyl transferase; Provisional 97.16
PRK09922359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D 97.14
PRK09814333 beta-1,6-galactofuranosyltransferase; Provisional 97.12
cd03813475 GT1_like_3 This family is most closely related to 97.11
cd03819355 GT1_WavL_like This family is most closely related 97.05
cd03796398 GT1_PIG-A_like This family is most closely related 96.95
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 96.86
PF0672297 DUF1205: Protein of unknown function (DUF1205); In 96.81
TIGR02918500 accessory Sec system glycosylation protein GtfA. M 96.77
PF13692135 Glyco_trans_1_4: Glycosyl transferases group 1; PD 96.75
cd03816415 GT1_ALG1_like This family is most closely related 96.73
cd04955363 GT1_like_6 This family is most closely related to 96.71
TIGR02472439 sucr_P_syn_N sucrose-phosphate synthase, putative, 96.58
PF04007335 DUF354: Protein of unknown function (DUF354); Inte 96.47
cd03802335 GT1_AviGT4_like This family is most closely relate 96.32
cd04950373 GT1_like_1 Glycosyltransferases catalyze the trans 96.27
PHA01630331 putative group 1 glycosyl transferase 96.01
TIGR03568365 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, 95.99
PHA01633335 putative glycosyl transferase group 1 95.96
PLN02275371 transferase, transferring glycosyl groups 95.82
TIGR03713519 acc_sec_asp1 accessory Sec system protein Asp1. Th 95.62
PF00201500 UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera 95.62
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 95.59
PF1352492 Glyco_trans_1_2: Glycosyl transferases group 1 95.51
PRK15490578 Vi polysaccharide biosynthesis protein TviE; Provi 95.45
PF06258311 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterP 95.43
COG0381383 WecB UDP-N-acetylglucosamine 2-epimerase [Cell env 95.41
cd03806419 GT1_ALG11_like This family is most closely related 94.87
cd03791476 GT1_Glycogen_synthase_DULL1_like This family is mo 94.76
PLN02949463 transferase, transferring glycosyl groups 94.67
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 94.38
TIGR02095473 glgA glycogen/starch synthases, ADP-glucose type. 94.02
KOG4626|consensus966 93.96
PRK10017426 colanic acid biosynthesis protein; Provisional 93.85
PRK14098489 glycogen synthase; Provisional 93.54
PF02684373 LpxB: Lipid-A-disaccharide synthetase; InterPro: I 93.19
PHA03392507 egt ecdysteroid UDP-glucosyltransferase; Provision 93.09
cd01635229 Glycosyltransferase_GTB_type Glycosyltransferases 92.76
PLN00142815 sucrose synthase 92.73
PRK10125405 putative glycosyl transferase; Provisional 92.29
TIGR02470784 sucr_synth sucrose synthase. This model represents 91.94
PLN02846462 digalactosyldiacylglycerol synthase 91.92
COG0763381 LpxB Lipid A disaccharide synthetase [Cell envelop 91.57
PRK00654466 glgA glycogen synthase; Provisional 91.37
PRK01021608 lpxB lipid-A-disaccharide synthase; Reviewed 90.62
TIGR02919438 accessory Sec system glycosyltransferase GtfB. Mem 90.52
PLN02173449 UDP-glucosyl transferase family protein 90.25
KOG1192|consensus496 89.85
PRK14099485 glycogen synthase; Provisional 89.74
PLN02501794 digalactosyldiacylglycerol synthase 89.13
COG3660329 Predicted nucleoside-diphosphate-sugar epimerase [ 88.92
PLN023161036 synthase/transferase 86.11
PLN02939977 transferase, transferring glycosyl groups 85.8
PF04464369 Glyphos_transf: CDP-Glycerol:Poly(glycerophosphate 85.52
PLN03004451 UDP-glycosyltransferase 84.01
cd03788460 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a 83.86
PF05159269 Capsule_synth: Capsule polysaccharide biosynthesis 83.77
TIGR02193319 heptsyl_trn_I lipopolysaccharide heptosyltransfera 81.79
TIGR02400456 trehalose_OtsA alpha,alpha-trehalose-phosphate syn 81.74
>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule Back     alignment and domain information 
Probab=100.00  E-value=6e-68  Score=549.36  Aligned_cols=320  Identities=41%  Similarity=0.750  Sum_probs=196.1

Q ss_pred             CCHHHHHHHHHHHHHHHHHHhhhcchHHHHHHHHHcCCCCCCHHHHhcCccEEEEccccccccCcCCCCCEEEeCCcccC
Q psy17870          1 MSFYYRLEGYLYLLYARLVLAPRIFSAQDALAKKYFGSSCPSTKDMVRNRSLLLSSSMWIFEYTRPVFPNTIHVGPLHIG   80 (406)
Q Consensus         1 ms~~~R~~n~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~l~n~~~~~~~~~p~~p~v~~vG~~~~~   80 (406)
                      |||+||+.|.+.+............+ ++++.+++++.+ .+..++.++.+++++|+++.+|+|||++|++++|||+++.
T Consensus       180 msf~~Ri~N~l~~~~~~~~~~~~~~~-~~~~~~~~~~~~-~~~~~~~~~~~l~l~ns~~~ld~prp~~p~v~~vGgl~~~  257 (500)
T PF00201_consen  180 MSFWQRIKNFLFYLYFRFIFRYFFSP-QDKLYKKYFGFP-FSFRELLSNASLVLINSHPSLDFPRPLLPNVVEVGGLHIK  257 (500)
T ss_dssp             SSSST--TTSHHHHHHHHHHHHGGGS--TTS-EEESS-G-GGCHHHHHHHHHCCSSTEEE----HHHHCTSTTGCGC-S-
T ss_pred             cchhhhhhhhhhhhhhccccccchhh-HHHHHhhhcccc-cccHHHHHHHHHHhhhccccCcCCcchhhcccccCccccc
Confidence            89999999999888777766655444 777777777654 3456666779999999999999999999999999999999


Q ss_pred             CCCCChHHHHHHHhc-CCcceEEEecCccccCCCCCHHHHHHHHHHHhcCCCceEeeeeccccccCCCCccccCCCCCCC
Q psy17870         81 DTKPLPQDLAKWVEG-GKKGAIYFSLGSNVKSAALEDSKRTAILAALARFPDYRIIWKWENEELEGLPSNVICRKWLPQH  159 (406)
Q Consensus        81 ~~~~l~~~~~~~l~~-~~~~vi~~s~Gs~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~~~~w~~~~  159 (406)
                      +++++|+++++|++. +++|+|||||||+++  .++++.++++                                     
T Consensus       258 ~~~~l~~~~~~~~~~~~~~~vv~vsfGs~~~--~~~~~~~~~~-------------------------------------  298 (500)
T PF00201_consen  258 PAKPLPEELWNFLDSSGKKGVVYVSFGSIVS--SMPEEKLKEI-------------------------------------  298 (500)
T ss_dssp             ---TCHHHHHHHTSTTTTTEEEEEE-TSSST--T-HHHHHHHH-------------------------------------
T ss_pred             cccccccccchhhhccCCCCEEEEecCcccc--hhHHHHHHHH-------------------------------------
Confidence            999999999999998 578999999999985  4777777777                                     


Q ss_pred             CCccchhhhhhhhcCCCceEEEecCCcccchhhhhHHHHHHHHHHhcCCCceEEEEecCcccCCCCCcEEEeeccCchhh
Q psy17870        160 DLLGTVDLAKWVEGGKKGAIYFSLGSNVKSAALEDSKRTAILAALARFPDYRIIWKWENEELEGLPSNVICRKWLPQHDL  239 (406)
Q Consensus       160 ~~~~~~~l~~fl~~~~~~~V~vs~GS~~~~~~~~~~~~~~i~~al~~~~~~~vI~~~~~~~~~~~~~nv~~~~~~pq~~l  239 (406)
                                                               +++|++++ ++|||++++.....+|+|+++.+|+||.++
T Consensus       299 -----------------------------------------~~~~~~~~-~~~iW~~~~~~~~~l~~n~~~~~W~PQ~~l  336 (500)
T PF00201_consen  299 -----------------------------------------AEAFENLP-QRFIWKYEGEPPENLPKNVLIVKWLPQNDL  336 (500)
T ss_dssp             -----------------------------------------HHHHHCST-TEEEEEETCSHGCHHHTTEEEESS--HHHH
T ss_pred             -----------------------------------------HHHHhhCC-CcccccccccccccccceEEEeccccchhh
Confidence                                                     66666777 688888776555567899999999999999


Q ss_pred             ccCCCceEEEEeCCcchHHHHHHcCCCeEeeccccchHHHHHHHHHhCceeeecCCCCCHHHHHHHHHHHHhChHHHHHH
Q psy17870        240 LAHPNIKLFITQGGLQSLQEAVHFEVPVIGIPFFGDQNYNVKIIRRLGIGSYMEFEDIHTETLFENIQEILNNYDRYKKA  319 (406)
Q Consensus       240 L~h~~~~l~IthgG~~sv~Eal~~GvP~i~iP~~~DQ~~NA~~l~~~G~G~~l~~~~~t~~~l~~ai~~lL~~~~~y~~~  319 (406)
                      |+||++++||||||.||+.||+++|||+|++|+++||+.||+++++.|+|+.++..++|++++.++|+++|+| ++|++|
T Consensus       337 L~hp~v~~fitHgG~~s~~Ea~~~gvP~l~~P~~~DQ~~na~~~~~~G~g~~l~~~~~~~~~l~~ai~~vl~~-~~y~~~  415 (500)
T PF00201_consen  337 LAHPRVKLFITHGGLNSTQEALYHGVPMLGIPLFGDQPRNAARVEEKGVGVVLDKNDLTEEELRAAIREVLEN-PSYKEN  415 (500)
T ss_dssp             HTSTTEEEEEES--HHHHHHHHHCT--EEE-GCSTTHHHHHHHHHHTTSEEEEGGGC-SHHHHHHHHHHHHHS-HHHHHH
T ss_pred             hhcccceeeeeccccchhhhhhhccCCccCCCCcccCCccceEEEEEeeEEEEEecCCcHHHHHHHHHHHHhh-hHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999 999999


Q ss_pred             HHHHHHHHhhCCCCHHHHHHHHHHHHHHhCCCCCCCCccCCCCCHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHHHhhhc
Q psy17870        320 VKRASDISKTQMMSPRDTAVWWVEYLLKADGNVSHLQPEYWHLTWYEYFGLDVYLVIFSPVILALYGLYRLVLTINRRWS  399 (406)
Q Consensus       320 a~~ls~~~~~~p~~~~~~av~~ie~v~~~~~~~~~l~~~~~~l~~~~~~~lDv~~~~~~~~~~~~~~~~~~~~~~~~~~~  399 (406)
                      |+++++++++||.+|.|+|++|||+++|++++ +|||+++.+|+|||||+|||+++++++++++++++++++++++|+++
T Consensus       416 a~~ls~~~~~~p~~p~~~~~~~ie~v~~~~~~-~~l~~~~~~l~~~~~~~lDv~~~~~~~~~~~~~~~~~~~~~~~~~~~  494 (500)
T PF00201_consen  416 AKRLSSLFRDRPISPLERAVWWIEYVARHGGA-PHLRSPARDLSFYQYYLLDVIAFLLLIILLIIYIIFKICRFVCRKCV  494 (500)
T ss_dssp             HHHHHHTTT-----------------------------------------------------------------------
T ss_pred             HHHHHHHHhcCCCCHHHHHHHHHHHHHhcCCC-cccCChhhcCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Confidence            99999999999999999999999999999999 89999999999999999999999988888999999999999999988


Q ss_pred             ccccCC
Q psy17870        400 KGKLKS  405 (406)
Q Consensus       400 ~~~~k~  405 (406)
                      ++|+|+
T Consensus       495 ~~~~k~  500 (500)
T PF00201_consen  495 KKKKKK  500 (500)
T ss_dssp             ------
T ss_pred             cccCCC
Confidence            877764

This family currently consist of: Mammalian UDP-glucuronosyl transferases (2.4.1.17 from EC) (UDPGT) []. A large family of membrane-bound microsomal enzymes which catalyze the transfer of glucuronic acid to a wide variety of exogenous and endogenous lipophilic substrates. These enzymes are of major importance in the detoxification and subsequent elimination of xenobiotics such as drugs and carcinogens. A large number of putative UDPGT from Caenorhabditis elegans. Mammalian 2-hydroxyacylsphingosine 1-beta-galactosyltransferase [] (2.4.1.45 from EC) (also known as UDP-galactose-ceramide galactosyltransferase). This enzyme catalyzes the transfer of galactose to ceramide, a key enzymatic step in the biosynthesis of galactocerebrosides, which are abundant sphingolipids of the myelin membrane of the central nervous system and peripheral nervous system. Plants flavonol O(3)-glucosyltransferase (2.4.1.91 from EC). An enzyme [] that catalyzes the transfer of glucose from UDP-glucose to a flavanol. This reaction is essential and one of the last steps in anthocyanin pigment biosynthesis. Baculoviruses ecdysteroid UDP-glucosyltransferase (2.4.1 from EC) [] (egt). This enzyme catalyzes the transfer of glucose from UDP-glucose to ectysteroids which are insect molting hormones. The expression of egt in the insect host interferes with the normal insect development by blocking the molting process. Prokaryotic zeaxanthin glucosyltransferase (2.4.1 from EC) (gene crtX), an enzyme involved in carotenoid biosynthesis and that catalyses the glycosylation reaction which converts zeaxanthin to zeaxanthin-beta-diglucoside. Streptomyces macrolide glycosyltransferases (2.4.1 from EC) []. These enzymes specifically inactivates macrolide anitibiotics via 2'-O-glycosylation using UDP-glucose. These enzymes share a conserved domain of about 50 amino acid residues located in their C-terminal section.; GO: 0016758 transferase activity, transferring hexosyl groups, 0008152 metabolic process; PDB: 3HBJ_A 3HBF_A 2PQ6_A 3IA7_B 3RSC_A 3IAA_B 2IYA_A 2IYF_B 2O6L_A 2VCH_A ....
>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>KOG1192|consensus Back     alignment and domain information
>PLN02207 UDP-glycosyltransferase Back     alignment and domain information
>PLN02670 transferase, transferring glycosyl groups Back     alignment and domain information
>PLN02208 glycosyltransferase family protein Back     alignment and domain information
>PLN02562 UDP-glycosyltransferase Back     alignment and domain information
>PLN02554 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN03004 UDP-glycosyltransferase Back     alignment and domain information
>PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02167 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02992 coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>PLN02555 limonoid glucosyltransferase Back     alignment and domain information
>PLN03007 UDP-glucosyltransferase family protein Back     alignment and domain information
>PLN02152 indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>PLN03015 UDP-glucosyl transferase Back     alignment and domain information
>PLN02764 glycosyltransferase family protein Back     alignment and domain information
>PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02173 UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02210 UDP-glucosyl transferase Back     alignment and domain information
>PLN00164 glucosyltransferase; Provisional Back     alignment and domain information
>PLN00414 glycosyltransferase family protein Back     alignment and domain information
>PLN02448 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02534 UDP-glycosyltransferase Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>PF04101 Glyco_tran_28_C: Glycosyltransferase family 28 C-terminal domain; InterPro: IPR007235 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>TIGR00661 MJ1255 conserved hypothetical protein Back     alignment and domain information
>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 Back     alignment and domain information
>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>PLN02605 monogalactosyldiacylglycerol synthase Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>TIGR03492 conserved hypothetical protein Back     alignment and domain information
>COG4671 Predicted glycosyl transferase [General function prediction only] Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>TIGR00215 lpxB lipid-A-disaccharide synthase Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>KOG3349|consensus Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>COG5017 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase Back     alignment and domain information
>COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>PRK14089 ipid-A-disaccharide synthase; Provisional Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>PF02350 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5 Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK10307 putative glycosyl transferase; Provisional Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>PRK09814 beta-1,6-galactofuranosyltransferase; Provisional Back     alignment and domain information
>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF06722 DUF1205: Protein of unknown function (DUF1205); InterPro: IPR010610 This entry represents a conserved region of unknown function within bacterial glycosyl transferases Back     alignment and domain information
>TIGR02918 accessory Sec system glycosylation protein GtfA Back     alignment and domain information
>PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain Back     alignment and domain information
>PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PHA01630 putative group 1 glycosyl transferase Back     alignment and domain information
>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing Back     alignment and domain information
>PHA01633 putative glycosyl transferase group 1 Back     alignment and domain information
>PLN02275 transferase, transferring glycosyl groups Back     alignment and domain information
>TIGR03713 acc_sec_asp1 accessory Sec system protein Asp1 Back     alignment and domain information
>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>PF13524 Glyco_trans_1_2: Glycosyl transferases group 1 Back     alignment and domain information
>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF06258 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterPro: IPR009367 This family consists of several hypothetical eukaryotic and prokaryotic proteins Back     alignment and domain information
>COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02949 transferase, transferring glycosyl groups Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>PRK10017 colanic acid biosynthesis protein; Provisional Back     alignment and domain information
>PRK14098 glycogen synthase; Provisional Back     alignment and domain information
>PF02684 LpxB: Lipid-A-disaccharide synthetase; InterPro: IPR003835 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PLN00142 sucrose synthase Back     alignment and domain information
>PRK10125 putative glycosyl transferase; Provisional Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase Back     alignment and domain information
>PLN02846 digalactosyldiacylglycerol synthase Back     alignment and domain information
>COG0763 LpxB Lipid A disaccharide synthetase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>TIGR02919 accessory Sec system glycosyltransferase GtfB Back     alignment and domain information
>PLN02173 UDP-glucosyl transferase family protein Back     alignment and domain information
>KOG1192|consensus Back     alignment and domain information
>PRK14099 glycogen synthase; Provisional Back     alignment and domain information
>PLN02501 digalactosyldiacylglycerol synthase Back     alignment and domain information
>COG3660 Predicted nucleoside-diphosphate-sugar epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02316 synthase/transferase Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>PF04464 Glyphos_transf: CDP-Glycerol:Poly(glycerophosphate) glycerophosphotransferase ; InterPro: IPR007554 Wall-associated teichoic acids are a heterogeneous class of phosphate-rich polymers that are covalently linked to the cell wall peptidoglycan of Gram-positive bacteria Back     alignment and domain information
>PLN03004 UDP-glycosyltransferase Back     alignment and domain information
>cd03788 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor Back     alignment and domain information
>PF05159 Capsule_synth: Capsule polysaccharide biosynthesis protein; InterPro: IPR007833 This family includes export proteins involved in capsule polysaccharide biosynthesis, such as KpsS P42218 from SWISSPROT and LipB P57038 from SWISSPROT Back     alignment and domain information
>TIGR02193 heptsyl_trn_I lipopolysaccharide heptosyltransferase I Back     alignment and domain information
>TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query406
2o6l_A170 Crystal Structure Of The Udp-Glucuronic Acid Bindin 3e-20
3hbf_A454 Structure Of Ugt78g1 Complexed With Myricetin And U 5e-09
2iya_A424 The Crystal Structure Of Macrolide Glycosyltransfer 3e-08
2c1x_A456 Structure And Activity Of A Flavonoid 3-O Glucosylt 3e-07
2pq6_A482 Crystal Structure Of Medicago Truncatula Ugt85h2- I 4e-06
2iyf_A430 The Crystal Structure Of Macrolide Glycosyltransfer 5e-06
2acv_A463 Crystal Structure Of Medicago Truncatula Ugt71g1 Le 1e-05
2acw_A465 Crystal Structure Of Medicago Truncatula Ugt71g1 Co 1e-05
2yjn_A441 Structure Of The Glycosyltransferase Eryciii From T 9e-05
3ia7_A402 Crystal Structure Of Calg4, The Calicheamicin Glyco 4e-04
>pdb|2O6L|A Chain A, Crystal Structure Of The Udp-Glucuronic Acid Binding Domain Of The Human Drug Metabolizing Udp-Glucuronosyltransferase 2b7 Length = 170 Back     alignment and structure 
Iteration: 1

 Score = 96.3 bits (238), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 50/153 (32%), Positives = 84/153 (54%), Gaps = 4/153 (2%)
Query: 174 GKKGAIYFSLGSNVKSAALEDSKRTAILAALARFPDYRIIWKWENEELEGLPSNVICRKW 233
           G+ G + FSLGS V +   E  +   I +ALA+ P  +++W+++  + + L  N    KW
Sbjct: 19  GENGVVVFSLGSXVSNXTEE--RANVIASALAQIPQ-KVLWRFDGNKPDTLGLNTRLYKW 75
Query: 234 LPQHDLLAHPNIKLFITQGGLQSLQEAVHFEVPVIGIPFFGDQNYNVKIIRRLGIGSYME 293
           +PQ+DLL HP  + FIT GG   + EA++  +P +GIP F DQ  N+   +  G    ++
Sbjct: 76  IPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPXVGIPLFADQPDNIAHXKARGAAVRVD 135
Query: 294 FEDIHTETLFENIQEILNNYDRYKKAVKRASDI 326
           F    +  L   ++ ++N+   YK+ V + S I
Sbjct: 136 FNTXSSTDLLNALKRVIND-PSYKENVXKLSRI 167
>pdb|3HBF|A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp Length = 454 Back     alignment and structure
>pdb|2IYA|A Chain A, The Crystal Structure Of Macrolide Glycosyltransferases: A Blueprint For Antibiotic Engineering Length = 424 Back     alignment and structure
>pdb|2C1X|A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification Length = 456 Back     alignment and structure
>pdb|2PQ6|A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase Length = 482 Back     alignment and structure
>pdb|2IYF|A Chain A, The Crystal Structure Of Macrolide Glycosyltransferases: A Blueprint For Antibiotic Engineering Length = 430 Back     alignment and structure
>pdb|2ACV|A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Length = 463 Back     alignment and structure
>pdb|2ACW|A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose Length = 465 Back     alignment and structure
>pdb|2YJN|A Chain A, Structure Of The Glycosyltransferase Eryciii From The Erythromycin Biosynthetic Pathway, In Complex With Its Activating Partner, Erycii Length = 441 Back     alignment and structure
>pdb|3IA7|A Chain A, Crystal Structure Of Calg4, The Calicheamicin Glycosyltransferase Length = 402 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query406
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 2e-69
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 5e-30
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 9e-39
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 7e-19
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 9e-34
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 7e-15
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 6e-27
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 2e-12
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 4e-26
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 2e-11
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 6e-22
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 7e-11
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 2e-21
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 6e-08
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 2e-20
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 2e-10
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; van 8e-20
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; van 6e-11
1rrv_A416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 7e-19
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 3e-18
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 2e-05
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 5e-18
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 2e-07
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 9e-17
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 7e-04
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 2e-14
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 4e-05
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 7e-08
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 1e-07
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 1e-07
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransfer 2e-07
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 5e-06
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Length = 170 Back     alignment and structure
 Score =  215 bits (550), Expect = 2e-69
 Identities = 50/162 (30%), Positives = 93/162 (57%), Gaps = 5/162 (3%)

Query: 166 DLAKWVEG-GKKGAIYFSLGSNVKSAALEDSKRTAILAALARFPDYRIIWKWENEELEGL 224
           ++  +V+  G+ G + FSLGS V +  + + +   I +ALA+ P  +++W+++  + + L
Sbjct: 10  EMEDFVQSSGENGVVVFSLGSMVSN--MTEERANVIASALAQIP-QKVLWRFDGNKPDTL 66

Query: 225 PSNVICRKWLPQHDLLAHPNIKLFITQGGLQSLQEAVHFEVPVIGIPFFGDQNYNVKIIR 284
             N    KW+PQ+DLL HP  + FIT GG   + EA++  +P++GIP F DQ  N+  ++
Sbjct: 67  GLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMK 126

Query: 285 RLGIGSYMEFEDIHTETLFENIQEILNNYDRYKKAVKRASDI 326
             G    ++F  + +  L   ++ ++N+   YK+ V + S I
Sbjct: 127 ARGAAVRVDFNTMSSTDLLNALKRVIND-PSYKENVMKLSRI 167
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Length = 170 Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Length = 430 Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Length = 430 Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Length = 424 Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Length = 424 Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Length = 402 Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Length = 402 Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Length = 415 Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Length = 415 Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Length = 412 Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Length = 412 Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 441 Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 441 Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Length = 415 Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Length = 415 Back     alignment and structure
>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} PDB: 3h4i_A* 1pn3_A* 1pnv_A* Length = 404 Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Length = 416 Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Length = 398 Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Length = 398 Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Length = 391 Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Length = 391 Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Length = 384 Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Length = 384 Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Length = 398 Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Length = 398 Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Length = 456 Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Length = 482 Back     alignment and structure
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} PDB: 3hbj_A* Length = 454 Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Length = 480 Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Length = 463 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query406
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 100.0
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransfer 100.0
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 100.0
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 100.0
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 100.0
1rrv_A416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 100.0
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 99.97
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; van 99.96
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 99.96
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 99.96
4amg_A400 Snogd; transferase, polyketide biosynthesis, GT1 f 99.94
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 99.93
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 99.92
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 99.92
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 99.91
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 99.91
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 99.88
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 99.88
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 99.87
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 99.82
3s2u_A365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 99.8
2jzc_A224 UDP-N-acetylglucosamine transferase subunit ALG13; 99.65
1f0k_A364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 99.34
3hbm_A282 UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter je 99.2
1v4v_A376 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t 98.71
1vgv_A384 UDP-N-acetylglucosamine 2-epimerase; structural ge 98.65
3ot5_A403 UDP-N-acetylglucosamine 2-epimerase; structural ge 98.62
2f9f_A177 First mannosyl transferase (WBAZ-1); alpha-beta pr 98.51
3dzc_A396 UDP-N-acetylglucosamine 2-epimerase; structural ge 98.5
3beo_A375 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a 98.35
2iw1_A374 Lipopolysaccharide core biosynthesis protein RFAG; 98.18
4hwg_A385 UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc 98.08
2gek_A406 Phosphatidylinositol mannosyltransferase (PIMA); G 97.99
3okp_A394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino 97.99
3c48_A438 Predicted glycosyltransferases; retaining glycosyl 97.97
2x6q_A416 Trehalose-synthase TRET; biosynthetic protein; 2.2 97.94
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 97.86
2bfw_A200 GLGA glycogen synthase; glycosyltransferase family 97.69
2jjm_A394 Glycosyl transferase, group 1 family protein; anth 97.67
3oy2_A413 Glycosyltransferase B736L; rossmann fold, GDP-mann 97.67
3qhp_A166 Type 1 capsular polysaccharide biosynthesis prote 97.51
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 97.35
2xci_A374 KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci 97.34
3fro_A439 GLGA glycogen synthase; glycosyltransferase family 97.33
2r60_A499 Glycosyl transferase, group 1; rossmann-fold; 1.80 97.33
2iuy_A342 Avigt4, glycosyltransferase; antibiotics, family G 97.23
3q3e_A631 HMW1C-like glycosyltransferase; N-glycosylation; 2 97.07
3rhz_A339 GTF3, nucleotide sugar synthetase-like protein; gl 96.93
2qzs_A485 Glycogen synthase; glycosyl-transferase, GT-B fold 96.5
1rzu_A485 Glycogen synthase 1; glycosyl-transferase, GT-B fo 96.45
3s28_A816 Sucrose synthase 1; glycosyltransferase, sucrose m 96.33
2x0d_A413 WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge 96.26
2hy7_A406 Glucuronosyltransferase GUMK; glycosyltransferases 96.15
4amg_A400 Snogd; transferase, polyketide biosynthesis, GT1 f 91.18
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 90.6
3vue_A536 GBSS-I, granule-bound starch synthase 1, chloropla 89.83
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 84.38
2gt1_A326 Lipopolysaccharide heptosyltransferase-1; GT-B fol 82.41
1psw_A348 ADP-heptose LPS heptosyltransferase II; structural 81.16
3nb0_A725 Glycogen [starch] synthase isoform 2; glycogen syn 80.88
2iz6_A176 Molybdenum cofactor carrier protein; metal transpo 80.39
3tov_A349 Glycosyl transferase family 9; structural genomics 80.14
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A* Back     alignment and structure
Probab=100.00  E-value=5.7e-35  Score=297.10  Aligned_cols=201  Identities=20%  Similarity=0.386  Sum_probs=172.6

Q ss_pred             hcCccEEEEccccccccC-----cCCCCCEEEeCCcccCCCC---CChHHHHHHHhcC-CcceEEEecCccccCCCCCHH
Q psy17870         47 VRNRSLLLSSSMWIFEYT-----RPVFPNTIHVGPLHIGDTK---PLPQDLAKWVEGG-KKGAIYFSLGSNVKSAALEDS  117 (406)
Q Consensus        47 ~~~~~l~l~n~~~~~~~~-----~p~~p~v~~vG~~~~~~~~---~l~~~~~~~l~~~-~~~vi~~s~Gs~~~~~~~~~~  117 (406)
                      .+.++.+|+||++++|++     ++..|++++|||++....+   +-++++.+||++. ++++||+||||+..   ++.+
T Consensus       213 ~~~~~~vl~ns~~eLE~~~~~~~~~~~~~v~~vGPl~~~~~~~~~~~~~~~~~wLd~~~~~~vVyvsfGS~~~---~~~~  289 (454)
T 3hbf_A          213 LPRANAVAINSFATIHPLIENELNSKFKLLLNVGPFNLTTPQRKVSDEHGCLEWLDQHENSSVVYISFGSVVT---PPPH  289 (454)
T ss_dssp             GGGSSCEEESSCGGGCHHHHHHHHTTSSCEEECCCHHHHSCCSCCCCTTCHHHHHHTSCTTCEEEEECCSSCC---CCHH
T ss_pred             hccCCEEEECChhHhCHHHHHHHHhcCCCEEEECCcccccccccccchHHHHHHHhcCCCCceEEEecCCCCc---CCHH
Confidence            446789999999999987     7888999999999875432   2357899999987 48999999999975   6777


Q ss_pred             HHHHHHHHHhcCCCceEeeeeccccccCCCCccccCCCCCCCCCccchhhhhhhhcCCCceEEEecCCcccchhhhhHHH
Q psy17870        118 KRTAILAALARFPDYRIIWKWENEELEGLPSNVICRKWLPQHDLLGTVDLAKWVEGGKKGAIYFSLGSNVKSAALEDSKR  197 (406)
Q Consensus       118 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~~~~w~~~~~~~~~~~l~~fl~~~~~~~V~vs~GS~~~~~~~~~~~~  197 (406)
                      +++++                                                                           
T Consensus       290 ~~~el---------------------------------------------------------------------------  294 (454)
T 3hbf_A          290 ELTAL---------------------------------------------------------------------------  294 (454)
T ss_dssp             HHHHH---------------------------------------------------------------------------
T ss_pred             HHHHH---------------------------------------------------------------------------
Confidence            77777                                                                           


Q ss_pred             HHHHHHHhcCCCceEEEEecCccc---C-----CCCCcEEEeeccCchhhccCCCceEEEEeCCcchHHHHHHcCCCeEe
Q psy17870        198 TAILAALARFPDYRIIWKWENEEL---E-----GLPSNVICRKWLPQHDLLAHPNIKLFITQGGLQSLQEAVHFEVPVIG  269 (406)
Q Consensus       198 ~~i~~al~~~~~~~vI~~~~~~~~---~-----~~~~nv~~~~~~pq~~lL~h~~~~l~IthgG~~sv~Eal~~GvP~i~  269 (406)
                         +++|++.+ ++|||+++....   +     ..++|+++++|+||.++|.|+++++||||||+||++|++++|||+|+
T Consensus       295 ---~~~l~~~~-~~flw~~~~~~~~~lp~~~~~~~~~~~~vv~w~Pq~~vL~h~~v~~fvtH~G~~S~~Eal~~GvP~i~  370 (454)
T 3hbf_A          295 ---AESLEECG-FPFIWSFRGDPKEKLPKGFLERTKTKGKIVAWAPQVEILKHSSVGVFLTHSGWNSVLECIVGGVPMIS  370 (454)
T ss_dssp             ---HHHHHHHC-CCEEEECCSCHHHHSCTTHHHHTTTTEEEESSCCHHHHHHSTTEEEEEECCCHHHHHHHHHHTCCEEE
T ss_pred             ---HHHHHhCC-CeEEEEeCCcchhcCCHhHHhhcCCceEEEeeCCHHHHHhhcCcCeEEecCCcchHHHHHHcCCCEec
Confidence               55555556 777777765321   1     23578999999999999999999999999999999999999999999


Q ss_pred             eccccchHHHHHHHHH-hCceeeecCCCCCHHHHHHHHHHHHhChH---HHHHHHHHHHHHHhhC
Q psy17870        270 IPFFGDQNYNVKIIRR-LGIGSYMEFEDIHTETLFENIQEILNNYD---RYKKAVKRASDISKTQ  330 (406)
Q Consensus       270 iP~~~DQ~~NA~~l~~-~G~G~~l~~~~~t~~~l~~ai~~lL~~~~---~y~~~a~~ls~~~~~~  330 (406)
                      +|+++||+.||+++++ .|+|+.+....++.++|.++|+++|++ +   +||++|+++++.+++.
T Consensus       371 ~P~~~DQ~~Na~~v~~~~g~Gv~l~~~~~~~~~l~~av~~ll~~-~~~~~~r~~a~~l~~~~~~a  434 (454)
T 3hbf_A          371 RPFFGDQGLNTILTESVLEIGVGVDNGVLTKESIKKALELTMSS-EKGGIMRQKIVKLKESAFKA  434 (454)
T ss_dssp             CCCSTTHHHHHHHHHTTSCSEEECGGGSCCHHHHHHHHHHHHSS-HHHHHHHHHHHHHHHHHHHH
T ss_pred             CcccccHHHHHHHHHHhhCeeEEecCCCCCHHHHHHHHHHHHCC-ChHHHHHHHHHHHHHHHHHh
Confidence            9999999999999999 599999988889999999999999988 6   8999999999999864
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Back     alignment and structure
>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae} PDB: 2ks6_A Back     alignment and structure
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Back     alignment and structure
>3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A* Back     alignment and structure
>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 Back     alignment and structure
>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* Back     alignment and structure
>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes} Back     alignment and structure
>2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 Back     alignment and structure
>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae} Back     alignment and structure
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A Back     alignment and structure
>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Back     alignment and structure
>4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii} Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Back     alignment and structure
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Back     alignment and structure
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8 Back     alignment and structure
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Back     alignment and structure
>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* Back     alignment and structure
>3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* Back     alignment and structure
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Back     alignment and structure
>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A Back     alignment and structure
>3rhz_A GTF3, nucleotide sugar synthetase-like protein; glycosyltransferase, transferase; HET: UDP; 1.90A {Streptococcus parasanguinis} PDB: 3qkw_A* Back     alignment and structure
>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A Back     alignment and structure
>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A Back     alignment and structure
>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* Back     alignment and structure
>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* Back     alignment and structure
>2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A* Back     alignment and structure
>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A* Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Back     alignment and structure
>2gt1_A Lipopolysaccharide heptosyltransferase-1; GT-B fold; 1.90A {Escherichia coli UTI89} PDB: 2h1f_A* 2h1h_A* Back     alignment and structure
>1psw_A ADP-heptose LPS heptosyltransferase II; structural genomics, NYSGXRC, LPS biosynthetic pathway, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.87.1.7 Back     alignment and structure
>3nb0_A Glycogen [starch] synthase isoform 2; glycogen synthase, glucose-6-phosphate, yeast, allosteric AC transferase; HET: G6P; 2.41A {Saccharomyces cerevisiae} PDB: 3rt1_A* 3nch_A 3naz_A 3o3c_A* 3rsz_A* Back     alignment and structure
>2iz6_A Molybdenum cofactor carrier protein; metal transport; 1.60A {Chlamydomonas reinhardtii} PDB: 2iz5_A 2iz7_A Back     alignment and structure
>3tov_A Glycosyl transferase family 9; structural genomics, PSI-BIOL protein structure initiative, midwest center for structural genomics, MCSG; 2.98A {Veillonella parvula} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 406
d2c1xa1450 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-gluc 3e-25
d1rrva_401 c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Am 3e-20
d1iira_401 c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycol 2e-19
d2pq6a1473 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransfe 1e-18
d2pq6a1473 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransfe 2e-04
d1pn3a_391 c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA 9e-17
d2acva1461 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transf 1e-15
d2vcha1471 c.87.1.10 (A:6-476) Hydroquinone glucosyltransfera 4e-15
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Length = 450 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: UDPGT-like
domain: UDP glucose:flavonoid 3-o-glucosyltransferase
species: Grape (Vitis vinifera) [TaxId: 29760]

 Score =  104 bits (259), Expect = 3e-25
 Identities = 57/319 (17%), Positives = 105/319 (32%), Gaps = 30/319 (9%)

Query: 58  MWIFEYTRPVFPNTIHVGPLHIGDTKPLPQDLAKWVE-----GGKKGAIYFSLGSNVKSA 112
            W+  +T      + HV    I +   +     +  E      G     +  L   +   
Sbjct: 129 AWLPFWTAGPNSLSTHVYIDEIREKIGVSGIQGREDELLNFIPGMSKVRFRDLQEGIVFG 188

Query: 113 ALEDSKRTAILAALARFPDYRIIWKWENEELEGLPSNVICRKWLPQHDLLGTV------- 165
            L       +       P    ++    EEL+   +N +  K     ++           
Sbjct: 189 NLNSLFSRMLHRMGQVLPKATAVFINSFEELDDSLTNDLKSKLKTYLNIGPFNLITPPPV 248

Query: 166 --DLAKWVEGGKKGAIYFSLGSNVKSAALEDSKRTAILAALARFPDYRIIWKWENEELEG 223
             +    ++  K+      +  +  +           L+          IW   ++    
Sbjct: 249 VPNTTGCLQWLKERKPTSVVYISFGTVTTPPPAEVVALSEALEASRVPFIWSLRDKARVH 308

Query: 224 LPS--------NVICRKWLPQHDLLAHPNIKLFITQGGLQSLQEAVHFEVPVIGIPFFGD 275
           LP           +   W PQ ++LAH  +  F+T  G  SL E+V   VP+I  PFFGD
Sbjct: 309 LPEGFLEKTRGYGMVVPWAPQAEVLAHEAVGAFVTHCGWNSLWESVAGGVPLICRPFFGD 368

Query: 276 QNYNVKIIRR-LGIGSYMEFEDIHTETLFENIQEILNNYDRYKKAVKRASDISKTQMM-- 332
           Q  N +++   L IG  +E        L     +IL+  ++ KK  +    + +T     
Sbjct: 369 QRLNGRMVEDVLEIGVRIEGGVFTKSGLMSCFDQILSQ-EKGKKLRENLRALRETADRAV 427

Query: 333 ----SPRDTAVWWVEYLLK 347
               S  +  +  V+ + K
Sbjct: 428 GPKGSSTENFITLVDLVSK 446
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Length = 473 Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Length = 473 Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Length = 391 Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Length = 461 Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 471 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query406
d2c1xa1450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 100.0
d1rrva_401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 99.97
d1iira_401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 99.97
d2pq6a1473 (Iso)flavonoid glycosyltransferase {Medicago trunc 99.96
d2acva1461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 99.96
d2vcha1471 Hydroquinone glucosyltransferase {Thale cress (Ara 99.96
d1pn3a_391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 99.96
d1f0ka_351 Peptidoglycan biosynthesis glycosyltransferase Mur 99.76
d2iw1a1370 Lipopolysaccharide core biosynthesis protein RfaG 98.17
d2f9fa1166 First mannosyl transferase WbaZ {Archaeoglobus ful 97.64
d2bisa1437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 97.02
d2bfwa1196 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 96.88
d1v4va_373 UDP-N-acetylglucosamine 2-epimerase {Thermus therm 96.81
d1o6ca_377 UDP-N-acetylglucosamine 2-epimerase {Bacillus subt 96.76
d1rzua_477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 95.48
d1f6da_376 UDP-N-acetylglucosamine 2-epimerase {Escherichia c 95.19
d1uqta_456 Trehalose-6-phosphate synthase, OtsA {Escherichia 86.37
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: UDPGT-like
domain: UDP glucose:flavonoid 3-o-glucosyltransferase
species: Grape (Vitis vinifera) [TaxId: 29760]

Probab=100.00  E-value=3.6e-34  Score=285.56  Aligned_cols=219  Identities=22%  Similarity=0.383  Sum_probs=174.6

Q ss_pred             cCccEEEEcccccc-----ccCcCCCCCEEEeCCcccCCCC---CChHHHHHHHhcCC-cceEEEecCccccCCCCCHHH
Q psy17870         48 RNRSLLLSSSMWIF-----EYTRPVFPNTIHVGPLHIGDTK---PLPQDLAKWVEGGK-KGAIYFSLGSNVKSAALEDSK  118 (406)
Q Consensus        48 ~~~~l~l~n~~~~~-----~~~~p~~p~v~~vG~~~~~~~~---~l~~~~~~~l~~~~-~~vi~~s~Gs~~~~~~~~~~~  118 (406)
                      ...+....++...+     +++++..|.+..+||.+.....   +.++++..|++..+ +++||++|||...   .+.+.
T Consensus       206 ~~~~~~~~~~~~~l~~~~~~~~~~~~p~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~s~gs~~~---~~~~~  282 (450)
T d2c1xa1         206 PKATAVFINSFEELDDSLTNDLKSKLKTYLNIGPFNLITPPPVVPNTTGCLQWLKERKPTSVVYISFGTVTT---PPPAE  282 (450)
T ss_dssp             GGSSCEEESSCGGGCHHHHHHHHHHSSCEEECCCHHHHC---------CHHHHHHTSCTTCEEEEECCSSCC---CCHHH
T ss_pred             hcccccccccHHhhhhhhhhhccccCCceeecCCccccCCCCCCcchhhhccccccCCccceeeeccccccc---CCHHH
Confidence            34556666765554     5568889999999998776543   34567888888874 7899999999875   66777


Q ss_pred             HHHHHHHHhcCCCceEeeeeccccccCCCCccccCCCCCCCCCccchhhhhhhhcCCCceEEEecCCcccchhhhhHHHH
Q psy17870        119 RTAILAALARFPDYRIIWKWENEELEGLPSNVICRKWLPQHDLLGTVDLAKWVEGGKKGAIYFSLGSNVKSAALEDSKRT  198 (406)
Q Consensus       119 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~n~~~~~w~~~~~~~~~~~l~~fl~~~~~~~V~vs~GS~~~~~~~~~~~~~  198 (406)
                      ++++                                                                            
T Consensus       283 ~~~~----------------------------------------------------------------------------  286 (450)
T d2c1xa1         283 VVAL----------------------------------------------------------------------------  286 (450)
T ss_dssp             HHHH----------------------------------------------------------------------------
T ss_pred             HHHH----------------------------------------------------------------------------
Confidence            7777                                                                            


Q ss_pred             HHHHHHhcCCCceEEEEecCcccC--------CCCCcEEEeeccCchhhccCCCceEEEEeCCcchHHHHHHcCCCeEee
Q psy17870        199 AILAALARFPDYRIIWKWENEELE--------GLPSNVICRKWLPQHDLLAHPNIKLFITQGGLQSLQEAVHFEVPVIGI  270 (406)
Q Consensus       199 ~i~~al~~~~~~~vI~~~~~~~~~--------~~~~nv~~~~~~pq~~lL~h~~~~l~IthgG~~sv~Eal~~GvP~i~i  270 (406)
                        +.++++.+ ++|||+.+.....        ..+.|+.+..|+||.++|.||+|++||||||.||++||+++|||+|++
T Consensus       287 --~~~~~~~~-~~vl~~~~~~~~~~l~~~~~~~~~~nv~~~~~~pq~~lL~hp~~~~fItHGG~~s~~eal~~GvP~v~~  363 (450)
T d2c1xa1         287 --SEALEASR-VPFIWSLRDKARVHLPEGFLEKTRGYGMVVPWAPQAEVLAHEAVGAFVTHCGWNSLWESVAGGVPLICR  363 (450)
T ss_dssp             --HHHHHHHT-CCEEEECCGGGGGGSCTTHHHHHTTTEEEESCCCHHHHHTSTTEEEEEECCCHHHHHHHHHHTCCEEEC
T ss_pred             --HHHHHhcC-CeEEEEECCCccccCChhhhhhccccccccccCChHhhhccCceeEEEccCCccHHHHHHHcCCCEEec
Confidence              56666666 7888876542211        246799999999999999999999999999999999999999999999


Q ss_pred             ccccchHHHHHHHHH-hCceeeecCCCCCHHHHHHHHHHHHhChHHHHH---HHHHHHHHHhhCCC----CHHHHHHHHH
Q psy17870        271 PFFGDQNYNVKIIRR-LGIGSYMEFEDIHTETLFENIQEILNNYDRYKK---AVKRASDISKTQMM----SPRDTAVWWV  342 (406)
Q Consensus       271 P~~~DQ~~NA~~l~~-~G~G~~l~~~~~t~~~l~~ai~~lL~~~~~y~~---~a~~ls~~~~~~p~----~~~~~av~~i  342 (406)
                      |+++||+.||+++++ .|+|+.++..++|+++|.++|+++|+| ++|++   |++++++..+ +|.    ++.+.+++||
T Consensus       364 P~~~DQ~~na~rv~~~~G~G~~l~~~~~t~~~l~~ai~~vL~d-~~y~~~~~r~~~l~~~~~-~a~~~~gss~~~~~~~~  441 (450)
T d2c1xa1         364 PFFGDQRLNGRMVEDVLEIGVRIEGGVFTKSGLMSCFDQILSQ-EKGKKLRENLRALRETAD-RAVGPKGSSTENFITLV  441 (450)
T ss_dssp             CCSTTHHHHHHHHHHTSCCEEECGGGSCCHHHHHHHHHHHHHS-HHHHHHHHHHHHHHHHHH-HHTSTTCHHHHHHHHHH
T ss_pred             ccccchHHHHHHHHHHcCcEEEecCCCcCHHHHHHHHHHHhcC-cHHHHHHHHHHHHHHHHH-HhccCCCCHHHHHHHHH
Confidence            999999999999987 699999999999999999999999999 98875   5555444433 333    3489999999


Q ss_pred             HHHHHhCC
Q psy17870        343 EYLLKADG  350 (406)
Q Consensus       343 e~v~~~~~  350 (406)
                      |+++||+.
T Consensus       442 e~v~r~~~  449 (450)
T d2c1xa1         442 DLVSKPKD  449 (450)
T ss_dssp             HHHTSCCC
T ss_pred             HHHhhhcC
Confidence            99999975
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1f6da_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure