Psyllid ID: psy17880
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 120 | ||||||
| 321477965 | 995 | hypothetical protein DAPPUDRAFT_95700 [D | 0.75 | 0.090 | 0.784 | 2e-42 | |
| 270013886 | 806 | hypothetical protein TcasGA2_TC012552 [T | 0.7 | 0.104 | 0.811 | 5e-40 | |
| 242017898 | 785 | ablim, putative [Pediculus humanus corpo | 0.733 | 0.112 | 0.806 | 1e-39 | |
| 427782711 | 735 | Putative actin-binding lim zn-finger pro | 0.741 | 0.121 | 0.736 | 6e-38 | |
| 312375194 | 585 | hypothetical protein AND_14456 [Anophele | 0.775 | 0.158 | 0.698 | 3e-37 | |
| 260817802 | 2313 | hypothetical protein BRAFLDRAFT_86604 [B | 0.408 | 0.021 | 0.709 | 4e-36 | |
| 427782719 | 711 | Putative actin-binding lim zn-finger pro | 0.75 | 0.126 | 0.736 | 4e-36 | |
| 357625276 | 805 | hypothetical protein KGM_20056 [Danaus p | 0.741 | 0.110 | 0.688 | 1e-34 | |
| 158294174 | 830 | AGAP005425-PA [Anopheles gambiae str. PE | 0.725 | 0.104 | 0.698 | 1e-33 | |
| 157118566 | 725 | ablim [Aedes aegypti] gi|108875655|gb|EA | 0.716 | 0.118 | 0.698 | 1e-33 |
| >gi|321477965|gb|EFX88923.1| hypothetical protein DAPPUDRAFT_95700 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
Score = 176 bits (446), Expect = 2e-42, Method: Composition-based stats.
Identities = 73/93 (78%), Positives = 79/93 (84%)
Query: 3 KAYCTSCKKKCSGEVLRVQDKYFHITCFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFG 62
K C SCKKKCSGEVLRVQDKYFHI CF+C VC+ SLAQGG+F KDG YYCT DYQ +FG
Sbjct: 161 KTQCQSCKKKCSGEVLRVQDKYFHIACFKCRVCQTSLAQGGFFCKDGEYYCTRDYQDRFG 220
Query: 63 TKCAQCGEYVEGEVVTALGKTYHQKCFTCARCR 95
TKC+ CG +VEGEVVTALGKTYH CFTCARCR
Sbjct: 221 TKCSHCGRFVEGEVVTALGKTYHSSCFTCARCR 253
|
Source: Daphnia pulex Species: Daphnia pulex Genus: Daphnia Family: Daphniidae Order: Diplostraca Class: Branchiopoda Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270013886|gb|EFA10334.1| hypothetical protein TcasGA2_TC012552 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|242017898|ref|XP_002429421.1| ablim, putative [Pediculus humanus corporis] gi|212514347|gb|EEB16683.1| ablim, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|427782711|gb|JAA56807.1| Putative actin-binding lim zn-finger protein limatin involved in axon guidance [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|312375194|gb|EFR22612.1| hypothetical protein AND_14456 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|260817802|ref|XP_002603774.1| hypothetical protein BRAFLDRAFT_86604 [Branchiostoma floridae] gi|229289097|gb|EEN59785.1| hypothetical protein BRAFLDRAFT_86604 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
| >gi|427782719|gb|JAA56811.1| Putative actin-binding lim zn-finger protein limatin involved in axon guidance [Rhipicephalus pulchellus] | Back alignment and taxonomy information |
|---|
| >gi|357625276|gb|EHJ75777.1| hypothetical protein KGM_20056 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|158294174|ref|XP_315432.4| AGAP005425-PA [Anopheles gambiae str. PEST] gi|157015442|gb|EAA11937.4| AGAP005425-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|157118566|ref|XP_001653201.1| ablim [Aedes aegypti] gi|108875655|gb|EAT39880.1| AAEL008358-PA, partial [Aedes aegypti] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 120 | ||||||
| FB|FBgn0260463 | 806 | Unc-115b [Drosophila melanogas | 0.775 | 0.115 | 0.677 | 7.8e-35 | |
| FB|FBgn0051352 | 844 | Unc-115a [Drosophila melanogas | 0.775 | 0.110 | 0.677 | 8.8e-35 | |
| UNIPROTKB|D4A6Z5 | 261 | D4A6Z5 "Uncharacterized protei | 0.758 | 0.348 | 0.626 | 1.4e-30 | |
| UNIPROTKB|Q5T6N2 | 702 | ABLIM1 "Actin-binding LIM prot | 0.758 | 0.129 | 0.626 | 8.2e-30 | |
| UNIPROTKB|F1LWK7 | 655 | F1LWK7 "Uncharacterized protei | 0.758 | 0.138 | 0.626 | 8.5e-30 | |
| UNIPROTKB|F8W8M4 | 718 | ABLIM1 "Actin-binding LIM prot | 0.758 | 0.126 | 0.626 | 8.7e-30 | |
| UNIPROTKB|F1LX72 | 701 | F1LX72 "Uncharacterized protei | 0.758 | 0.129 | 0.626 | 1e-29 | |
| UNIPROTKB|O14639 | 778 | ABLIM1 "Actin-binding LIM prot | 0.758 | 0.116 | 0.626 | 1.1e-29 | |
| UNIPROTKB|F1NC68 | 609 | Gga.10869 "Uncharacterized pro | 0.75 | 0.147 | 0.622 | 1.1e-29 | |
| UNIPROTKB|F1MI97 | 790 | F1MI97 "Uncharacterized protei | 0.758 | 0.115 | 0.626 | 1.1e-29 |
| FB|FBgn0260463 Unc-115b [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 386 (140.9 bits), Expect = 7.8e-35, P = 7.8e-35
Identities = 63/93 (67%), Positives = 73/93 (78%)
Query: 3 KAYCTSCKKKCSGEVLRVQDKYFHITCFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFG 62
K YC C KKCSGEVLRV D +FH CFQC CK SLA GG+F KD AYYC DYQ+ +G
Sbjct: 5 KIYCAKCTKKCSGEVLRVADNHFHKACFQCCQCKKSLATGGFFTKDNAYYCIPDYQRLYG 64
Query: 63 TKCAQCGEYVEGEVVTALGKTYHQKCFTCARCR 95
TKCA C +YVEGEVV+ +GKTYHQKCFTC++C+
Sbjct: 65 TKCANCQQYVEGEVVSTMGKTYHQKCFTCSKCK 97
|
|
| FB|FBgn0051352 Unc-115a [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A6Z5 D4A6Z5 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5T6N2 ABLIM1 "Actin-binding LIM protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LWK7 F1LWK7 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F8W8M4 ABLIM1 "Actin-binding LIM protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LX72 F1LX72 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O14639 ABLIM1 "Actin-binding LIM protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NC68 Gga.10869 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MI97 F1MI97 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 120 | |||
| cd09327 | 52 | cd09327, LIM1_abLIM, The first LIM domain of actin | 2e-21 | |
| cd09328 | 56 | cd09328, LIM2_abLIM, The second LIM domain on acti | 6e-14 | |
| pfam00412 | 58 | pfam00412, LIM, LIM domain | 7e-09 | |
| cd08368 | 53 | cd08368, LIM, LIM is a small protein-protein inter | 7e-09 | |
| smart00132 | 54 | smart00132, LIM, Zinc-binding domain present in Li | 1e-08 | |
| cd09360 | 52 | cd09360, LIM_ALP_like, The LIM domain of ALP (acti | 7e-07 | |
| cd09456 | 52 | cd09456, LIM2_Enigma, The second LIM domain of Eni | 9e-07 | |
| cd09362 | 52 | cd09362, LIM2_Enigma_like, The second LIM domain o | 2e-06 | |
| cd09336 | 53 | cd09336, LIM1_Paxillin_like, The first LIM domain | 3e-06 | |
| cd09457 | 52 | cd09457, LIM2_ENH, The second LIM domain of the En | 4e-06 | |
| cd09405 | 54 | cd09405, LIM1_Paxillin, The first LIM domain of pa | 6e-06 | |
| cd09377 | 59 | cd09377, LIM2_Lhx2_Lhx9, The second LIM domain of | 7e-06 | |
| cd09450 | 53 | cd09450, LIM_ALP, This family represents the LIM d | 1e-05 | |
| cd09391 | 57 | cd09391, LIM1_Lrg1p_like, The first LIM domain of | 1e-05 | |
| cd09375 | 56 | cd09375, LIM2_Lhx1_Lhx5, The second LIM domain of | 2e-05 | |
| cd09372 | 53 | cd09372, LIM2_FBLP-1, The second LIM domain of the | 2e-05 | |
| cd09451 | 53 | cd09451, LIM_RIL, The LIM domain of RIL | 4e-05 | |
| cd09336 | 53 | cd09336, LIM1_Paxillin_like, The first LIM domain | 6e-05 | |
| cd09364 | 53 | cd09364, LIM1_LIMK, The first LIM domain of LIMK ( | 6e-05 | |
| cd09353 | 60 | cd09353, LIM2_Zyxin, The second LIM domain of Zyxi | 8e-05 | |
| cd09406 | 55 | cd09406, LIM1_Leupaxin, The first LIM domain of Le | 9e-05 | |
| cd08368 | 53 | cd08368, LIM, LIM is a small protein-protein inter | 1e-04 | |
| cd09406 | 55 | cd09406, LIM1_Leupaxin, The first LIM domain of Le | 1e-04 | |
| cd09463 | 53 | cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 | 1e-04 | |
| cd09340 | 58 | cd09340, LIM1_Testin_like, The first LIM domain of | 2e-04 | |
| cd09329 | 52 | cd09329, LIM3_abLIM, The third LIM domain of actin | 2e-04 | |
| cd09452 | 52 | cd09452, LIM1_Enigma, The first LIM domain of Enig | 2e-04 | |
| cd09354 | 60 | cd09354, LIM2_LPP, The second LIM domain of lipoma | 2e-04 | |
| cd09362 | 52 | cd09362, LIM2_Enigma_like, The second LIM domain o | 3e-04 | |
| cd09358 | 53 | cd09358, LIM_Mical_like, The LIM domain of Mical ( | 3e-04 | |
| cd09343 | 59 | cd09343, LIM1_FHL, The first LIM domain of Four an | 3e-04 | |
| cd09422 | 62 | cd09422, LIM1_FHL2, The first LIM domain of Four a | 3e-04 | |
| cd09334 | 54 | cd09334, LIM4_PINCH, The fourth LIM domain of prot | 4e-04 | |
| cd09456 | 52 | cd09456, LIM2_Enigma, The second LIM domain of Eni | 5e-04 | |
| cd09393 | 56 | cd09393, LIM3_Lrg1p_like, The third LIM domain of | 5e-04 | |
| cd09351 | 54 | cd09351, LIM1_LPP, The first LIM domain of lipoma | 6e-04 | |
| cd09349 | 87 | cd09349, LIM1_Zyxin, The first LIM domain of Zyxin | 6e-04 | |
| cd09338 | 53 | cd09338, LIM3_Paxillin_like, The third LIM domain | 7e-04 | |
| cd09374 | 55 | cd09374, LIM2_Isl, The second LIM domain of Isl, a | 7e-04 | |
| cd09387 | 55 | cd09387, LIM2_LMO4, The second LIM domain of LMO4 | 8e-04 | |
| cd09442 | 53 | cd09442, LIM_Eplin_like, The Lim domain of Epithel | 9e-04 | |
| smart00132 | 54 | smart00132, LIM, Zinc-binding domain present in Li | 0.001 | |
| cd09457 | 52 | cd09457, LIM2_ENH, The second LIM domain of the En | 0.001 | |
| cd09351 | 54 | cd09351, LIM1_LPP, The first LIM domain of lipoma | 0.001 | |
| cd09361 | 52 | cd09361, LIM1_Enigma_like, The first LIM domain of | 0.001 | |
| cd09376 | 56 | cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of | 0.001 | |
| cd09332 | 52 | cd09332, LIM2_PINCH, The second LIM domain of prot | 0.001 | |
| cd09353 | 60 | cd09353, LIM2_Zyxin, The second LIM domain of Zyxi | 0.002 | |
| cd09387 | 55 | cd09387, LIM2_LMO4, The second LIM domain of LMO4 | 0.002 | |
| cd09361 | 52 | cd09361, LIM1_Enigma_like, The first LIM domain of | 0.002 | |
| cd09472 | 57 | cd09472, LIM2_Lhx3b, The second LIM domain of Lhx3 | 0.002 | |
| cd09330 | 56 | cd09330, LIM4_abLIM, The fourth LIM domain of acti | 0.002 | |
| cd09378 | 55 | cd09378, LIM2_Lmx1a_Lmx1b, The second LIM domain o | 0.002 | |
| cd09473 | 56 | cd09473, LIM2_Lhx4, The second LIM domain of Lhx4 | 0.002 | |
| cd09371 | 53 | cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b | 0.002 | |
| cd09360 | 52 | cd09360, LIM_ALP_like, The LIM domain of ALP (acti | 0.003 | |
| cd09355 | 53 | cd09355, LIM2_Ajuba_like, The second LIM domain of | 0.003 | |
| cd09453 | 52 | cd09453, LIM1_ENH, The first LIM domain of the Eni | 0.003 | |
| cd09439 | 55 | cd09439, LIM_Mical, The LIM domain of Mical (molec | 0.004 |
| >gnl|CDD|188713 cd09327, LIM1_abLIM, The first LIM domain of actin binding LIM (abLIM) proteins | Back alignment and domain information |
|---|
Score = 79.6 bits (197), Expect = 2e-21
Identities = 37/52 (71%), Positives = 39/52 (75%)
Query: 6 CTSCKKKCSGEVLRVQDKYFHITCFQCSVCKNSLAQGGYFNKDGAYYCTSDY 57
C C KKC GEVLRVQDKYFHI CF C VC LAQGG+F K+G YYCT DY
Sbjct: 1 CYKCGKKCKGEVLRVQDKYFHIKCFTCKVCGCDLAQGGFFVKEGEYYCTDDY 52
|
The first LIM domain of actin binding LIM (abLIM) proteins: Three homologous members of the abLIM protein family have been identified; abLIM-1, abLIM-2 and abLIM-3. The N-terminal of abLIM consists of four tandem repeats of LIM domains and the C-terminal of acting binding LIM protein is a villin headpiece domain, which has strong actin binding activity. The abLIM-1, which is expressed in retina, brain, and muscle tissue, has been indicated to function as a tumor suppressor. AbLIM-2 and -3, mainly expressed in muscle and neuronal tissue, bind to F-actin strongly. They may serve as a scaffold for signaling modules of the actin cytoskeleton and thereby modulate transcription. It has shown that LIM domains of abLIMs interact with STARS (striated muscle activator of Rho signaling), which directly binds actin and stimulates serum-response factor (SRF)-dependent transcription. All LIM domains are 50-60 amino acids in size and share two characteristic highly conserved zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein complexes. Length = 52 |
| >gnl|CDD|188714 cd09328, LIM2_abLIM, The second LIM domain on actin binding LIM (abLIM) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215907 pfam00412, LIM, LIM domain | Back alignment and domain information |
|---|
| >gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >gnl|CDD|188746 cd09360, LIM_ALP_like, The LIM domain of ALP (actinin-associated LIM protein) family | Back alignment and domain information |
|---|
| >gnl|CDD|188840 cd09456, LIM2_Enigma, The second LIM domain of Enigma | Back alignment and domain information |
|---|
| >gnl|CDD|188748 cd09362, LIM2_Enigma_like, The second LIM domain of Enigma-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188841 cd09457, LIM2_ENH, The second LIM domain of the Enigma Homolog (ENH) family | Back alignment and domain information |
|---|
| >gnl|CDD|188789 cd09405, LIM1_Paxillin, The first LIM domain of paxillin | Back alignment and domain information |
|---|
| >gnl|CDD|188763 cd09377, LIM2_Lhx2_Lhx9, The second LIM domain of Lhx2 and Lhx9 family | Back alignment and domain information |
|---|
| >gnl|CDD|188834 cd09450, LIM_ALP, This family represents the LIM domain of ALP, actinin-associated LIM protein | Back alignment and domain information |
|---|
| >gnl|CDD|188777 cd09391, LIM1_Lrg1p_like, The first LIM domain of Lrg1p, a LIM and RhoGap domain containing protein | Back alignment and domain information |
|---|
| >gnl|CDD|188761 cd09375, LIM2_Lhx1_Lhx5, The second LIM domain of Lhx1 (also known as Lim1) and Lhx5 | Back alignment and domain information |
|---|
| >gnl|CDD|188758 cd09372, LIM2_FBLP-1, The second LIM domain of the filamin-binding LIM protein-1 (FBLP-1) | Back alignment and domain information |
|---|
| >gnl|CDD|188835 cd09451, LIM_RIL, The LIM domain of RIL | Back alignment and domain information |
|---|
| >gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase ) | Back alignment and domain information |
|---|
| >gnl|CDD|188739 cd09353, LIM2_Zyxin, The second LIM domain of Zyxin | Back alignment and domain information |
|---|
| >gnl|CDD|188790 cd09406, LIM1_Leupaxin, The first LIM domain of Leupaxin | Back alignment and domain information |
|---|
| >gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|188790 cd09406, LIM1_Leupaxin, The first LIM domain of Leupaxin | Back alignment and domain information |
|---|
| >gnl|CDD|188847 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 (LIM domain Kinase 2) | Back alignment and domain information |
|---|
| >gnl|CDD|188726 cd09340, LIM1_Testin_like, The first LIM domain of Testin-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188715 cd09329, LIM3_abLIM, The third LIM domain of actin binding LIM (abLIM) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188836 cd09452, LIM1_Enigma, The first LIM domain of Enigma | Back alignment and domain information |
|---|
| >gnl|CDD|188740 cd09354, LIM2_LPP, The second LIM domain of lipoma preferred partner (LPP) | Back alignment and domain information |
|---|
| >gnl|CDD|188748 cd09362, LIM2_Enigma_like, The second LIM domain of Enigma-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188744 cd09358, LIM_Mical_like, The LIM domain of Mical (molecule interacting with CasL) like family | Back alignment and domain information |
|---|
| >gnl|CDD|188729 cd09343, LIM1_FHL, The first LIM domain of Four and a half LIM domains protein (FHL) | Back alignment and domain information |
|---|
| >gnl|CDD|188806 cd09422, LIM1_FHL2, The first LIM domain of Four and a half LIM domains protein 2 (FHL2) | Back alignment and domain information |
|---|
| >gnl|CDD|188720 cd09334, LIM4_PINCH, The fourth LIM domain of protein PINCH | Back alignment and domain information |
|---|
| >gnl|CDD|188840 cd09456, LIM2_Enigma, The second LIM domain of Enigma | Back alignment and domain information |
|---|
| >gnl|CDD|188779 cd09393, LIM3_Lrg1p_like, The third LIM domain of Lrg1p, a LIM and RhoGap domain containing protein | Back alignment and domain information |
|---|
| >gnl|CDD|188737 cd09351, LIM1_LPP, The first LIM domain of lipoma preferred partner (LPP) | Back alignment and domain information |
|---|
| >gnl|CDD|188735 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin | Back alignment and domain information |
|---|
| >gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin like protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188760 cd09374, LIM2_Isl, The second LIM domain of Isl, a member of LHX protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188773 cd09387, LIM2_LMO4, The second LIM domain of LMO4 (LIM domain only protein 4) | Back alignment and domain information |
|---|
| >gnl|CDD|188826 cd09442, LIM_Eplin_like, The Lim domain of Epithelial Protein Lost in Neoplasm (Eplin) like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >gnl|CDD|188841 cd09457, LIM2_ENH, The second LIM domain of the Enigma Homolog (ENH) family | Back alignment and domain information |
|---|
| >gnl|CDD|188737 cd09351, LIM1_LPP, The first LIM domain of lipoma preferred partner (LPP) | Back alignment and domain information |
|---|
| >gnl|CDD|188747 cd09361, LIM1_Enigma_like, The first LIM domain of Enigma-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188762 cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of Lhx3-Lhx4 family | Back alignment and domain information |
|---|
| >gnl|CDD|188718 cd09332, LIM2_PINCH, The second LIM domain of protein PINCH | Back alignment and domain information |
|---|
| >gnl|CDD|188739 cd09353, LIM2_Zyxin, The second LIM domain of Zyxin | Back alignment and domain information |
|---|
| >gnl|CDD|188773 cd09387, LIM2_LMO4, The second LIM domain of LMO4 (LIM domain only protein 4) | Back alignment and domain information |
|---|
| >gnl|CDD|188747 cd09361, LIM1_Enigma_like, The first LIM domain of Enigma-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188856 cd09472, LIM2_Lhx3b, The second LIM domain of Lhx3b | Back alignment and domain information |
|---|
| >gnl|CDD|188716 cd09330, LIM4_abLIM, The fourth LIM domain of actin binding LIM (abLIM) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188764 cd09378, LIM2_Lmx1a_Lmx1b, The second LIM domain of Lmx1a and Lmx1b | Back alignment and domain information |
|---|
| >gnl|CDD|188857 cd09473, LIM2_Lhx4, The second LIM domain of Lhx4 | Back alignment and domain information |
|---|
| >gnl|CDD|188757 cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b | Back alignment and domain information |
|---|
| >gnl|CDD|188746 cd09360, LIM_ALP_like, The LIM domain of ALP (actinin-associated LIM protein) family | Back alignment and domain information |
|---|
| >gnl|CDD|188741 cd09355, LIM2_Ajuba_like, The second LIM domain of Ajuba-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|188837 cd09453, LIM1_ENH, The first LIM domain of the Enigma Homolog (ENH) family | Back alignment and domain information |
|---|
| >gnl|CDD|188823 cd09439, LIM_Mical, The LIM domain of Mical (molecule interacting with CasL) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 120 | |||
| KOG1701|consensus | 468 | 99.93 | ||
| KOG1701|consensus | 468 | 99.92 | ||
| KOG2272|consensus | 332 | 99.91 | ||
| KOG4577|consensus | 383 | 99.89 | ||
| KOG2272|consensus | 332 | 99.87 | ||
| KOG1703|consensus | 479 | 99.86 | ||
| KOG1703|consensus | 479 | 99.86 | ||
| KOG1044|consensus | 670 | 99.83 | ||
| KOG1044|consensus | 670 | 99.7 | ||
| PF00412 | 58 | LIM: LIM domain; InterPro: IPR001781 Zinc finger ( | 99.66 | |
| PF00412 | 58 | LIM: LIM domain; InterPro: IPR001781 Zinc finger ( | 99.64 | |
| KOG1700|consensus | 200 | 99.5 | ||
| smart00132 | 39 | LIM Zinc-binding domain present in Lin-11, Isl-1, | 99.02 | |
| smart00132 | 39 | LIM Zinc-binding domain present in Lin-11, Isl-1, | 98.88 | |
| KOG4577|consensus | 383 | 98.36 | ||
| KOG0490|consensus | 235 | 97.98 | ||
| KOG1700|consensus | 200 | 97.77 | ||
| KOG1702|consensus | 264 | 97.54 | ||
| KOG1702|consensus | 264 | 97.44 | ||
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 93.27 | |
| KOG0490|consensus | 235 | 92.03 | ||
| PF08394 | 37 | Arc_trans_TRASH: Archaeal TRASH domain; InterPro: | 91.84 | |
| PF14835 | 65 | zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM | 90.94 | |
| PF10083 | 158 | DUF2321: Uncharacterized protein conserved in bact | 90.62 | |
| PF09943 | 101 | DUF2175: Uncharacterized protein conserved in arch | 87.93 | |
| PF10367 | 109 | Vps39_2: Vacuolar sorting protein 39 domain 2; Int | 87.24 | |
| smart00504 | 63 | Ubox Modified RING finger domain. Modified RING fi | 87.12 | |
| PF02069 | 52 | Metallothio_Pro: Prokaryotic metallothionein; Inte | 86.45 | |
| PF11781 | 36 | RRN7: RNA polymerase I-specific transcription init | 86.14 | |
| PF07191 | 70 | zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 | 85.81 | |
| PF01258 | 36 | zf-dskA_traR: Prokaryotic dksA/traR C4-type zinc f | 85.39 | |
| PF13920 | 50 | zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); | 84.86 | |
| COG1645 | 131 | Uncharacterized Zn-finger containing protein [Gene | 84.76 | |
| PRK14890 | 59 | putative Zn-ribbon RNA-binding protein; Provisiona | 83.56 | |
| PF13248 | 26 | zf-ribbon_3: zinc-ribbon domain | 81.47 | |
| COG2191 | 206 | Formylmethanofuran dehydrogenase subunit E [Energy | 80.18 | |
| COG4847 | 103 | Uncharacterized protein conserved in archaea [Func | 80.03 |
| >KOG1701|consensus | Back alignment and domain information |
|---|
Probab=99.93 E-value=2.9e-28 Score=175.69 Aligned_cols=117 Identities=32% Similarity=0.709 Sum_probs=109.1
Q ss_pred Cccccccccccccc--eEEECCcccccccccccccccccCCCCeeecCCeeccHhHHHhHhCCCCCCCCCcccCcEEEEe
Q psy17880 3 KAYCTSCKKKCSGE--VLRVQDKYFHITCFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFGTKCAQCGEYVEGEVVTAL 80 (120)
Q Consensus 3 ~~~C~~C~~~i~~~--~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~i~~~~~~~~ 80 (120)
..+|.+|++.|.++ .+.++++.||..||+|..|++.|.++.||..|+++||+.||.... .+|..|+++|++++|.|.
T Consensus 274 ~~iC~~C~K~V~g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq~FY~v~~k~~CE~cyq~tl-ekC~~Cg~~I~d~iLrA~ 352 (468)
T KOG1701|consen 274 FGICAFCHKTVSGQGLAVEAMDQLFHVQCFTCRTCRRQLAGQSFYQVDGKPYCEGCYQDTL-EKCNKCGEPIMDRILRAL 352 (468)
T ss_pred hhhhhhcCCcccCcchHHHHhhhhhcccceehHhhhhhhccccccccCCcccchHHHHHHH-HHHhhhhhHHHHHHHHhc
Confidence 34899999999765 678999999999999999999999999999999999999999887 899999999999999999
Q ss_pred CccccccccccccCCCcCCCCceeee-CCeeeeccCCCcCC
Q psy17880 81 GKTYHQKCFTCARCRFSKKREIYNWL-GGRAYENRLGGRAY 120 (120)
Q Consensus 81 ~~~~H~~Cf~C~~C~~~l~~~~~~~~-~g~~yC~~~~~~~~ 120 (120)
|+.||+.||+|..|++.|++..|.+. ++++||-.|+-+.|
T Consensus 353 GkayHp~CF~Cv~C~r~ldgipFtvd~~n~v~Cv~dfh~kf 393 (468)
T KOG1701|consen 353 GKAYHPGCFTCVVCARCLDGIPFTVDSQNNVYCVPDFHKKF 393 (468)
T ss_pred ccccCCCceEEEEeccccCCccccccCCCceeeehhhhhhc
Confidence 99999999999999999999998876 79999999987765
|
|
| >KOG1701|consensus | Back alignment and domain information |
|---|
| >KOG2272|consensus | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >KOG2272|consensus | Back alignment and domain information |
|---|
| >KOG1703|consensus | Back alignment and domain information |
|---|
| >KOG1703|consensus | Back alignment and domain information |
|---|
| >KOG1044|consensus | Back alignment and domain information |
|---|
| >KOG1044|consensus | Back alignment and domain information |
|---|
| >PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1700|consensus | Back alignment and domain information |
|---|
| >smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >KOG1700|consensus | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >PF08394 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators | Back alignment and domain information |
|---|
| >PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B | Back alignment and domain information |
|---|
| >PF10083 DUF2321: Uncharacterized protein conserved in bacteria (DUF2321); InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454 | Back alignment and domain information |
|---|
| >PF09943 DUF2175: Uncharacterized protein conserved in archaea (DUF2175); InterPro: IPR018686 This family of various hypothetical archaeal proteins has no known function | Back alignment and domain information |
|---|
| >PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 | Back alignment and domain information |
|---|
| >smart00504 Ubox Modified RING finger domain | Back alignment and domain information |
|---|
| >PF02069 Metallothio_Pro: Prokaryotic metallothionein; InterPro: IPR000518 Metallothioneins (MT) are small proteins that bind heavy metals, such as zinc, copper, cadmium and nickel | Back alignment and domain information |
|---|
| >PF11781 RRN7: RNA polymerase I-specific transcription initiation factor Rrn7; InterPro: IPR021752 Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[] | Back alignment and domain information |
|---|
| >PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length | Back alignment and domain information |
|---|
| >PF01258 zf-dskA_traR: Prokaryotic dksA/traR C4-type zinc finger; InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A | Back alignment and domain information |
|---|
| >COG1645 Uncharacterized Zn-finger containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14890 putative Zn-ribbon RNA-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF13248 zf-ribbon_3: zinc-ribbon domain | Back alignment and domain information |
|---|
| >COG2191 Formylmethanofuran dehydrogenase subunit E [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG4847 Uncharacterized protein conserved in archaea [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 120 | ||||
| 1v6g_A | 81 | Solution Structure Of The Lim Domain Of The Human A | 6e-11 | ||
| 1rut_X | 188 | Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 L | 7e-10 | ||
| 2dfy_X | 195 | Crystal Structure Of A Cyclized Protein Fusion Of L | 7e-10 | ||
| 3mmk_A | 169 | The Structural Basis For Partial Redundancy In A Cl | 3e-09 | ||
| 2rgt_A | 169 | Crystal Structure Of Lhx3 Lim Domains 1 And 2 With | 4e-08 | ||
| 2jtn_A | 182 | Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Compl | 6e-08 | ||
| 2dj7_A | 80 | Solution Structure Of 3rd Lim Domain Of Actin-Bindi | 1e-07 | ||
| 2d8y_A | 91 | Solution Structure Of The Lim Domain Of Epithelial | 1e-05 | ||
| 2xjy_A | 131 | Crystal Structure Of The Lmo2:ldb1-Lid Complex, P21 | 4e-05 | ||
| 1x64_A | 89 | Solution Structure Of The Lim Domain Of Alpha-Actin | 7e-05 | ||
| 1x3h_A | 80 | Solution Structure Of The Lim Domain Of Human Leupa | 5e-04 | ||
| 2cup_A | 101 | Solution Structure Of The Skeletal Muscle Lim-Prote | 5e-04 | ||
| 2dar_A | 90 | Solution Structure Of First Lim Domain Of Enigma-Li | 6e-04 |
| >pdb|1V6G|A Chain A, Solution Structure Of The Lim Domain Of The Human Actin Binding Lim Protein 2 Length = 81 | Back alignment and structure |
|
| >pdb|1RUT|X Chain X, Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 Lid Domain Length = 188 | Back alignment and structure |
| >pdb|2DFY|X Chain X, Crystal Structure Of A Cyclized Protein Fusion Of Lmo4 Lim Domains 1 And 2 With The Lim Interacting Domain Of Ldb1 Length = 195 | Back alignment and structure |
| >pdb|3MMK|A Chain A, The Structural Basis For Partial Redundancy In A Class Of Transcription Factors, The Lim-Homeodomain Proteins, In Neural Cell Type Specification Length = 169 | Back alignment and structure |
| >pdb|2RGT|A Chain A, Crystal Structure Of Lhx3 Lim Domains 1 And 2 With The Binding Domain Of Isl1 Length = 169 | Back alignment and structure |
| >pdb|2JTN|A Chain A, Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Complex Length = 182 | Back alignment and structure |
| >pdb|2DJ7|A Chain A, Solution Structure Of 3rd Lim Domain Of Actin-Binding Lim Protein 3 Length = 80 | Back alignment and structure |
| >pdb|2D8Y|A Chain A, Solution Structure Of The Lim Domain Of Epithelial Protein Lost In Neoplasm Length = 91 | Back alignment and structure |
| >pdb|2XJY|A Chain A, Crystal Structure Of The Lmo2:ldb1-Lid Complex, P21 Crystal Form Length = 131 | Back alignment and structure |
| >pdb|1X64|A Chain A, Solution Structure Of The Lim Domain Of Alpha-Actinin-2 Associated Lim Protein Length = 89 | Back alignment and structure |
| >pdb|1X3H|A Chain A, Solution Structure Of The Lim Domain Of Human Leupaxin Length = 80 | Back alignment and structure |
| >pdb|2CUP|A Chain A, Solution Structure Of The Skeletal Muscle Lim-Protein 1 Length = 101 | Back alignment and structure |
| >pdb|2DAR|A Chain A, Solution Structure Of First Lim Domain Of Enigma-Like Pdz And Lim Domains Protein Length = 90 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 120 | |||
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 4e-26 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 4e-06 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 4e-23 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 6e-08 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 6e-23 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 1e-07 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 2e-07 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 2e-22 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 3e-19 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 3e-21 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 3e-10 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 2e-20 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 1e-07 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 1e-04 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 4e-20 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 3e-09 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 2e-18 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 2e-08 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 3e-17 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 1e-11 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 4e-15 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 2e-13 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 1e-14 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 4e-08 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 1e-14 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 8e-08 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 2e-14 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 6e-08 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 4e-14 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 1e-08 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 4e-14 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 1e-11 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 9e-14 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 1e-05 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 1e-13 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 3e-06 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 2e-13 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 2e-08 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 2e-13 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 3e-10 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 2e-13 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 6e-09 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 3e-13 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 3e-07 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 4e-13 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 9e-05 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 6e-13 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 7e-06 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 2e-12 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 2e-04 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 2e-12 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 1e-04 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 6e-12 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 3e-07 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 8e-12 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 3e-05 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 2e-11 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 4e-11 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 3e-05 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 3e-11 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 3e-11 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 1e-09 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 5e-11 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 3e-05 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 1e-10 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 8e-10 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 8e-05 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 1e-09 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 2e-05 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 2e-09 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 3e-07 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 3e-09 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 7e-08 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 6e-09 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 2e-06 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 2e-08 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 7e-05 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 3e-07 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 2e-05 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 5e-07 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 9e-06 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 6e-07 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 5e-04 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 9e-04 |
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
Score = 92.9 bits (231), Expect = 4e-26
Identities = 22/93 (23%), Positives = 42/93 (45%), Gaps = 4/93 (4%)
Query: 6 CTSCKKKCSGE--VLRVQDKYFHITCFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFGT 63
C C+K + + +++++H TCF+C+ C + LA + KD C ++
Sbjct: 8 CVECRKPIGADSKEVHYKNRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSP 67
Query: 64 KCAQCGEYVEG--EVVTALGKTYHQKCFTCARC 94
KC C + + + V G +H+ CF+
Sbjct: 68 KCKGCFKAIVAGDQNVEYKGTVWHKDCFSGPSS 100
|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 120 | |||
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 100.0 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 100.0 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 100.0 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 99.98 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 99.97 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 99.97 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 99.96 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 99.93 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 99.89 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 99.87 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 99.86 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 99.85 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 99.85 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 99.84 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 99.83 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 99.81 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 99.81 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 99.8 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 99.79 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 99.78 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 99.77 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 99.77 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 99.77 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 99.77 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 99.76 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 99.76 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 99.76 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.76 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 99.75 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 99.74 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 99.74 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 99.74 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 99.73 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 99.73 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 99.73 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.73 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 99.72 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 99.72 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 99.72 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.71 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 99.71 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 99.71 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 99.71 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 99.71 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 99.71 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 99.7 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.7 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 99.7 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 99.7 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 99.69 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 99.68 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 99.68 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 99.68 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 99.67 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 99.67 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 99.66 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 99.66 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 99.66 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 99.66 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 99.66 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 99.66 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 99.65 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 99.65 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 99.65 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 99.65 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 99.65 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 99.64 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 99.64 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 99.63 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 99.63 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 99.62 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 99.62 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 99.61 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 99.6 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 99.59 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 99.59 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 99.58 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 99.58 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 99.54 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 99.51 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 99.5 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 99.48 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 99.45 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 99.39 | |
| 1zfo_A | 31 | LAsp-1; LIM domain, zinc-finger, metal-binding pro | 98.11 | |
| 1zfo_A | 31 | LAsp-1; LIM domain, zinc-finger, metal-binding pro | 98.03 | |
| 4ap4_A | 133 | E3 ubiquitin ligase RNF4; ligase-signalling protei | 94.22 | |
| 2jrp_A | 81 | Putative cytoplasmic protein; two-zinc binding pro | 90.21 | |
| 1t1h_A | 78 | Gspef-atpub14, armadillo repeat containing protein | 88.71 | |
| 2ecy_A | 66 | TNF receptor-associated factor 3; metal binding pr | 88.6 | |
| 2djb_A | 72 | Polycomb group ring finger protein 6; PCGF6, ring | 87.77 | |
| 1jjd_A | 55 | Metallothionein, SMTA; zinc finger, zinc cluster, | 85.48 | |
| 2xeu_A | 64 | Ring finger protein 4; transcription, zinc-finger, | 85.46 | |
| 2ysl_A | 73 | Tripartite motif-containing protein 31; ring-type | 83.78 | |
| 3ng2_A | 71 | RNF4, snurf, ring finger protein 4; ring domain, E | 83.45 | |
| 1jm7_B | 117 | BARD1, BRCA1-associated ring domain protein 1; rin | 81.76 | |
| 3vk6_A | 101 | E3 ubiquitin-protein ligase hakai; HYB, phosphotyr | 81.58 | |
| 1g25_A | 65 | CDK-activating kinase assembly factor MAT1; ring f | 81.48 | |
| 2ecm_A | 55 | Ring finger and CHY zinc finger domain- containing | 81.4 | |
| 2kwj_A | 114 | Zinc finger protein DPF3; acetyl-lysine, transcrip | 81.32 | |
| 2csy_A | 81 | Zinc finger protein 183-like 1; ring finger protei | 81.09 | |
| 4ayc_A | 138 | E3 ubiquitin-protein ligase RNF8; DNA damage, K63 | 80.72 | |
| 2y43_A | 99 | E3 ubiquitin-protein ligase RAD18; DNA repair, met | 80.63 | |
| 2kre_A | 100 | Ubiquitin conjugation factor E4 B; U-box domain, E | 80.45 | |
| 1chc_A | 68 | Equine herpes virus-1 ring domain; viral protein; | 80.39 |
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=9.8e-36 Score=187.63 Aligned_cols=119 Identities=20% Similarity=0.396 Sum_probs=111.2
Q ss_pred CCccccccccccc-cceEEECCcccccccccccccccccCCCCeeecCCeeccHhHHHhHhCCCCCCCCCccc--CcEEE
Q psy17880 2 IKAYCTSCKKKCS-GEVLRVQDKYFHITCFQCSVCKNSLAQGGYFNKDGAYYCTSDYQKKFGTKCAQCGEYVE--GEVVT 78 (120)
Q Consensus 2 ~~~~C~~C~~~i~-~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~c~~~~~~~~C~~C~~~i~--~~~~~ 78 (120)
..++|.+|+++|. ++++.++|+.||++||+|+.|+++|.+..|+.+++++||+.||.++++++|..|+++|. +.+|+
T Consensus 2 ~~~~C~~C~~~I~~~~~~~a~~~~~H~~CF~C~~C~~~L~~~~f~~~~g~~yC~~cy~~~~~~~C~~C~~~I~~~~~~~~ 81 (126)
T 2xqn_T 2 EKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVT 81 (126)
T ss_dssp CCCBBTTTSSBCCSSCEEEETTEEECGGGSBCTTTCCBCTTSEEEEETTEEEEHHHHHHHSCCBCTTTCSBCCTTSCEEE
T ss_pred cCCCCccCCCEeCCceEEeeCCCCccCCCCCcCCCCCCCCcCEEEeECCEEechHHhCcCcCccCcccCCcCCcCceEEE
Confidence 4689999999997 56899999999999999999999999888999999999999999999999999999997 46899
Q ss_pred EeCcccc--ccccccccCCCcCCCCceeeeCCeeeeccCCCcCC
Q psy17880 79 ALGKTYH--QKCFTCARCRFSKKREIYNWLGGRAYENRLGGRAY 120 (120)
Q Consensus 79 ~~~~~~H--~~Cf~C~~C~~~l~~~~~~~~~g~~yC~~~~~~~~ 120 (120)
+.++.|| ++||+|..|+++|.++.|+..||++||+.++.+.|
T Consensus 82 a~~~~~H~~~~CF~C~~C~~~l~~~~f~~~~~~~yC~~~~~~~f 125 (126)
T 2xqn_T 82 YNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKKRM 125 (126)
T ss_dssp ETTEEEESSTTTSBCTTTCCBCTTSEEEEETTEEESSHHHHHSC
T ss_pred CCCCEeeCCCCCcCcCCCCCccCCCeeEeECCEEcchHHhhhhc
Confidence 9999999 99999999999999889999999999998776665
|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 | Back alignment and structure |
|---|
| >1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 | Back alignment and structure |
|---|
| >4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2jrp_A Putative cytoplasmic protein; two-zinc binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium LT2} | Back alignment and structure |
|---|
| >1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 | Back alignment and structure |
|---|
| >2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1jjd_A Metallothionein, SMTA; zinc finger, zinc cluster, metal binding PR; NMR {Synechococcus elongatus} SCOP: g.46.1.1 | Back alignment and structure |
|---|
| >2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 | Back alignment and structure |
|---|
| >2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A | Back alignment and structure |
|---|
| >2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* | Back alignment and structure |
|---|
| >2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C | Back alignment and structure |
|---|
| >2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B | Back alignment and structure |
|---|
| >1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 120 | ||||
| d1v6ga1 | 41 | g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abL | 1e-11 | |
| d1x3ha1 | 35 | g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [ | 3e-11 | |
| d2dara2 | 45 | g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, En | 1e-05 | |
| d1u5sb1 | 31 | g.39.1.3 (B:72-102) Pinch (particularly interestin | 7e-04 | |
| d1g47a2 | 35 | g.39.1.3 (A:36-70) Pinch (particularly interesting | 8e-04 | |
| d1b8ta4 | 49 | g.39.1.3 (A:144-192) Cysteine-rich (intestinal) pr | 0.001 |
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: LIM domain domain: Actin-binding LIM protein 2, abLIM2 species: Human (Homo sapiens) [TaxId: 9606]
Score = 53.3 bits (128), Expect = 1e-11
Identities = 20/33 (60%), Positives = 27/33 (81%)
Query: 56 DYQKKFGTKCAQCGEYVEGEVVTALGKTYHQKC 88
DYQ+ +GT+C C +++EGEVV+ALGKTYH C
Sbjct: 9 DYQRLYGTRCFSCDQFIEGEVVSALGKTYHPDC 41
|
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 31 | Back information, alignment and structure |
|---|
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 49 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 120 | |||
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 99.46 | |
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 99.06 | |
| d2dara2 | 45 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 99.05 | |
| d1g47a2 | 35 | Pinch (particularly interesting new Cys-His) prote | 99.01 | |
| d2cuqa2 | 35 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.99 | |
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 98.99 | |
| d1v6ga1 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 98.91 | |
| d2dara2 | 45 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 98.9 | |
| d1u5sb1 | 31 | Pinch (particularly interesting new Cys-His) prote | 98.84 | |
| d1g47a2 | 35 | Pinch (particularly interesting new Cys-His) prote | 98.82 | |
| d1u5sb1 | 31 | Pinch (particularly interesting new Cys-His) prote | 98.81 | |
| d1x63a1 | 37 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.73 | |
| d1b8ta4 | 49 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.72 | |
| d2d8xa2 | 26 | Pinch (particularly interesting new Cys-His) prote | 98.71 | |
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 98.65 | |
| d2d8za2 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 98.6 | |
| d2d8xa2 | 26 | Pinch (particularly interesting new Cys-His) prote | 98.55 | |
| d1x3ha2 | 32 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 98.55 | |
| d2cuqa1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.54 | |
| d1x3ha2 | 32 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 98.5 | |
| d1x4la1 | 29 | Four and a half LIM domains protein 2, FHL2 {Human | 98.49 | |
| d1ibia2 | 31 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 98.48 | |
| d1x68a1 | 29 | Four and a half LIM domains protein 5, FHL-5 {Huma | 98.47 | |
| d1x6aa1 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 98.44 | |
| d1rutx1 | 30 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 98.44 | |
| d2d8za1 | 26 | Four and a half LIM domains protein 2, FHL2 {Human | 98.42 | |
| d2dj7a1 | 31 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 98.36 | |
| d2dj7a1 | 31 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 98.35 | |
| d1imla2 | 48 | Cysteine-rich (intestinal) protein, CRP, CRIP {Rat | 98.35 | |
| d1zfoa_ | 30 | LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | 98.35 | |
| d2cura2 | 26 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.34 | |
| d2cu8a1 | 30 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 98.3 | |
| d1u5sb2 | 35 | Pinch (particularly interesting new Cys-His) prote | 98.29 | |
| d1j2oa1 | 30 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 98.29 | |
| d1b8ta2 | 65 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.25 | |
| d2d8za1 | 26 | Four and a half LIM domains protein 2, FHL2 {Human | 98.24 | |
| d1rutx1 | 30 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 98.24 | |
| d2d8ya2 | 42 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 98.2 | |
| d2d8ya2 | 42 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 98.19 | |
| d2cuqa2 | 35 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.19 | |
| d2dj7a2 | 36 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 98.17 | |
| d1x4ka1 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 98.17 | |
| d2cura2 | 26 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.16 | |
| d1u5sb2 | 35 | Pinch (particularly interesting new Cys-His) prote | 98.15 | |
| d1wyha1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.11 | |
| d2dj7a2 | 36 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 98.1 | |
| d2dara1 | 32 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 98.1 | |
| d1x62a2 | 35 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 98.1 | |
| d1b8ta4 | 49 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.1 | |
| d1rutx3 | 31 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 98.08 | |
| d1j2oa1 | 30 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 98.06 | |
| d2d8za2 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 98.05 | |
| d1x4la1 | 29 | Four and a half LIM domains protein 2, FHL2 {Human | 98.04 | |
| d2cura1 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.04 | |
| d1x63a1 | 37 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.03 | |
| d2cu8a2 | 33 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 98.02 | |
| d1x68a1 | 29 | Four and a half LIM domains protein 5, FHL-5 {Huma | 98.01 | |
| d1x62a2 | 35 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 97.99 | |
| d1x64a1 | 45 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 97.97 | |
| d2cu8a1 | 30 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 97.93 | |
| d1imla2 | 48 | Cysteine-rich (intestinal) protein, CRP, CRIP {Rat | 97.93 | |
| d2d8ya1 | 35 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 97.92 | |
| d1x61a2 | 32 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.9 | |
| d1ibia2 | 31 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.89 | |
| d1v6ga1 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 97.88 | |
| d1x4ka2 | 27 | Four and a half LIM domains protein 2, FHL2 {Human | 97.87 | |
| d1wiga1 | 32 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 97.87 | |
| d1b8ta3 | 43 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.86 | |
| d1x64a1 | 45 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 97.85 | |
| d2cu8a2 | 33 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 97.85 | |
| d2dara1 | 32 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 97.79 | |
| d1x64a2 | 31 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 97.76 | |
| d2co8a2 | 36 | Nedd9 interacting protein with calponin homology, | 97.76 | |
| d1a7ia2 | 32 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.74 | |
| d1rutx3 | 31 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 97.73 | |
| d2cuqa1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.72 | |
| d1wyha2 | 27 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.68 | |
| d2d8ya1 | 35 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 97.66 | |
| d2cupa3 | 27 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.65 | |
| d1zfoa_ | 30 | LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | 97.62 | |
| d1rutx4 | 33 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 97.59 | |
| d1b8ta3 | 43 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.56 | |
| d1x63a2 | 32 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.54 | |
| d1b8ta2 | 65 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.52 | |
| d2dloa2 | 33 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.46 | |
| d2cupa3 | 27 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.42 | |
| d1x4ka1 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 97.4 | |
| d1wyha1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.39 | |
| d2co8a2 | 36 | Nedd9 interacting protein with calponin homology, | 97.37 | |
| d1x62a1 | 31 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 97.32 | |
| d1x4ka2 | 27 | Four and a half LIM domains protein 2, FHL2 {Human | 97.3 | |
| d1a7ia2 | 32 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.3 | |
| d1wiga1 | 32 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 97.3 | |
| d1wyha2 | 27 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.23 | |
| d2cupa2 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.1 | |
| d1x64a2 | 31 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 97.05 | |
| d1x61a2 | 32 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 96.95 | |
| d2cura1 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 96.88 | |
| d1ibia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 96.86 | |
| d2cupa2 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 96.85 | |
| d1ibia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 96.82 | |
| d1a7ia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 96.78 | |
| d1x63a2 | 32 | Four and a half LIM domains protein 1, FHL-1 {Huma | 96.75 | |
| d2cora2 | 35 | Pinch (particularly interesting new Cys-His) prote | 96.74 | |
| d1x6aa1 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 96.72 | |
| d1b8ta1 | 35 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 96.66 | |
| d1a7ia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 96.61 | |
| d1rutx2 | 34 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 96.59 | |
| d1b8ta1 | 35 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 96.47 | |
| d1x62a1 | 31 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 96.45 | |
| d1g47a1 | 35 | Pinch (particularly interesting new Cys-His) prote | 96.33 | |
| d1x61a1 | 27 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 96.27 | |
| d2dloa2 | 33 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 96.21 | |
| d1x61a1 | 27 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 96.21 | |
| d1x6aa2 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 95.42 | |
| d1x68a2 | 34 | Four and a half LIM domains protein 5, FHL-5 {Huma | 95.36 | |
| d2cora1 | 31 | Pinch (particularly interesting new Cys-His) prote | 95.33 | |
| d1rutx4 | 33 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 95.14 | |
| d2cora2 | 35 | Pinch (particularly interesting new Cys-His) prote | 94.53 | |
| d2d8xa1 | 32 | Pinch (particularly interesting new Cys-His) prote | 94.33 | |
| d1wiga2 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 94.25 | |
| d2d8xa1 | 32 | Pinch (particularly interesting new Cys-His) prote | 93.8 | |
| d1x68a2 | 34 | Four and a half LIM domains protein 5, FHL-5 {Huma | 93.42 | |
| d1x4la2 | 30 | Four and a half LIM domains protein 2, FHL2 {Human | 92.86 | |
| d2co8a1 | 33 | Nedd9 interacting protein with calponin homology, | 92.78 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 92.48 | |
| d2baya1 | 56 | Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac | 91.55 | |
| d1j2oa2 | 33 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 90.35 | |
| d1v6ga2 | 40 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 90.33 | |
| d2c2la2 | 80 | STIP1 homology and U box-containing protein 1, STU | 87.01 | |
| d1t1ha_ | 78 | E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi | 86.15 | |
| d1bora_ | 56 | Acute promyelocytic leukaemia proto-oncoprotein PM | 83.81 | |
| d1rmda2 | 86 | V(D)J recombination activating protein 1 (RAG1), d | 82.21 | |
| d1chca_ | 68 | Immediate early protein, IEEHV {Equine herpesvirus | 81.21 |
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: LIM domain domain: Leupaxin species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.46 E-value=2e-15 Score=72.51 Aligned_cols=34 Identities=29% Similarity=0.737 Sum_probs=32.4
Q ss_pred HHHhHhCCCCCCCCCcccCcEEEEeCcccccccc
Q psy17880 56 DYQKKFGTKCAQCGEYVEGEVVTALGKTYHQKCF 89 (120)
Q Consensus 56 c~~~~~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf 89 (120)
+|.++|+++|+.|+++|.|++|+|+|+.||++||
T Consensus 2 DY~~~fapkC~~C~~~I~g~~v~Al~~~wHpeCF 35 (35)
T d1x3ha1 2 DFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECF 35 (35)
T ss_dssp CCCCCCSCBCTTTCCBCCSSCEEETTEEECTTTC
T ss_pred cHHHHhChhhhhcCCcccchheeecCCccCcccC
Confidence 5788899999999999999999999999999998
|
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4la2 g.39.1.3 (A:37-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2co8a1 g.39.1.3 (A:44-76) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1j2oa2 g.39.1.3 (A:31-63) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v6ga2 g.39.1.3 (A:42-81) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} | Back information, alignment and structure |
|---|