Psyllid ID: psy17906

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170----
MTITRKISFLVYKPLLKQCMSLLPPATPFLFKFNYLARFSTMANDDFKPVTHYFRHEENHFSHAFGHERKPAVTHEFDNGEKRVTHDFGKYTVDLIPALKDNYMYLVVDKASKHAAAIDPVEPHKILDAVNSHSAQLKHIWTTHHHQDHAGGNYDLVSRYPHLKEHPVYGLKMD
ccEEEEEEEEEEHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccEEEEEEEEccccccccccccccccccccccccEEEEEEcccEEEEEEEcccccEEEEEEEccccEEEEEccccHHHHHHHHHHcccEEcEEEEcccccccccHHHHHHHHccccccccEEEcccc
cccEEHEEEHEHHHHHHHHHHcccccccHHEEHHHHHHHHHccccccccEEEEEEEccccccHHHHHcccccEEEEcccccEEEEEEcccEEEEEEEEcccEEEEEEEcccccEEEEEccccHHHHHHHHHHcccEEEEEEcccccHHHHccHHHHHHHccccEccEEEccccc
MTITRKISFLVYKPLLKQCmsllppatpflfkfnylarfstmanddfkpvthyfrheenhfshafgherkpavthefdngekrvthdfgKYTVDLIPALKDNYMYLVVDKAskhaaaidpvephkiLDAVNSHSAQLKHIWTthhhqdhaggnydlvsryphlkehpvyglkmd
mtitrkisFLVYKPLLKQCMSLLPPATPFLFKFNYLARFSTMANDDFKPVTHYFRHEENHFSHAFGHERKPAVTHEFDNGEKRVTHDFGKYTVDLIPALKDNYMYLVVDKASKHAAAIDPVEPHKILDAVNSHSAQLKHIWTTHHHQDHAGGNYDLVSRYPHLkehpvyglkmd
MTITRKISFLVYKPLLKQCMSLLPPATPFLFKFNYLARFSTMANDDFKPVTHYFRHEENHFSHAFGHERKPAVTHEFDNGEKRVTHDFGKYTVDLIPALKDNYMYLVVDKASKHAAAIDPVEPHKILDAVNSHSAQLKHIWTTHHHQDHAGGNYDLVSRYPHLKEHPVYGLKMD
****RKISFLVYKPLLKQCMSLLPPATPFLFKFNYLARFSTMANDDFKPVTHYFRHEENHFSHAFGHERKPAVTHEFDNGEKRVTHDFGKYTVDLIPALKDNYMYLVVDKASKHAAAIDPVEPHKILDAVNSHSAQLKHIWTTHHHQDHAGGNYDLVSRYPHLKEHPV******
***TRKISFLVYKPLLKQCMSLLPPATPFLFKFNYLARFSTMANDDFKPVTHYFRHEENHFSHAFGHE*********************KYTVDLIPALKDNYMYLVVDKASKHAAAIDPVEPHKILDAVNSHSAQLKHIWTTHHHQDHAGGNYDLVSRYPHLKEHPVYGLK**
MTITRKISFLVYKPLLKQCMSLLPPATPFLFKFNYLARFSTMANDDFKPVTHYFRHEENHFSHAFGHERKPAVTHEFDNGEKRVTHDFGKYTVDLIPALKDNYMYLVVDKASKHAAAIDPVEPHKILDAVNSHSAQLKHIWTTHHHQDHAGGNYDLVSRYPHLKEHPVYGLKMD
MTITRKISFLVYKPLLKQCMSLLPPATPFLFKFNYLARFSTMANDDFKPVTHYFRHEENHFSHAFGHERKPAVTHEFDNGEKRVTHDFGKYTVDLIPALKDNYMYLVVDKASKHAAAIDPVEPHKILDAVNSHSAQLKHIWTTHHHQDHAGGNYDLVSRYPHLKEHPVYGL***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTITRKISFLVYKPLLKQCMSLLPPATPFLFKFNYLARFSTMANDDFKPVTHYFRHEENHFSHAFGHERKPAVTHEFDNGEKRVTHDFGKYTVDLIPALKDNYMYLVVDKASKHAAAIDPVEPHKILDAVNSHSAQLKHIWTTHHHQDHAGGNYDLVSRYPHLKEHPVYGLKMD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query174 2.2.26 [Sep-21-2011]
Q6P963 303 Hydroxyacylglutathione hy yes N/A 0.431 0.247 0.576 6e-20
Q4R6C1 308 Hydroxyacylglutathione hy N/A N/A 0.494 0.279 0.528 1e-19
B4F6K2 313 Hydroxyacylglutathione hy yes N/A 0.431 0.239 0.576 3e-19
Q16775 308 Hydroxyacylglutathione hy yes N/A 0.494 0.279 0.516 3e-19
Q3B7M2 308 Hydroxyacylglutathione hy yes N/A 0.494 0.279 0.505 3e-19
Q28333 280 Hydroxyacylglutathione hy no N/A 0.494 0.307 0.505 9e-19
Q5ZI23 310 Hydroxyacylglutathione hy yes N/A 0.431 0.241 0.538 3e-18
O35952 309 Hydroxyacylglutathione hy yes N/A 0.431 0.242 0.512 4e-18
Q99KB8 309 Hydroxyacylglutathione hy yes N/A 0.431 0.242 0.525 9e-18
O24496 258 Hydroxyacylglutathione hy yes N/A 0.436 0.294 0.443 2e-15
>sp|Q6P963|GLO2_DANRE Hydroxyacylglutathione hydrolase, mitochondrial OS=Danio rerio GN=hagh PE=2 SV=2 Back     alignment and function desciption
 Score = 96.7 bits (239), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 45/78 (57%), Positives = 56/78 (71%), Gaps = 3/78 (3%)

Query: 93  VDLIPALKDNYMYLVVDKASKHAAAIDPVEPHKILDAVNSHSAQLKHIWTTHHHQDHAGG 152
           V+L+PAL DNYMYL++D+ +K AA +DPVEP K++DAV  H  +LK + TTHHH DHAGG
Sbjct: 46  VELLPALTDNYMYLLIDEETKEAAIVDPVEPQKVVDAVKKHGVKLKTVLTTHHHWDHAGG 105

Query: 153 NYDLVSRYPHLKEHPVYG 170
           N  LV   P L    VYG
Sbjct: 106 NEKLVKLMPGLT---VYG 120
Thiolesterase that catalyzes the hydrolysis of S-D-lactoyl-glutathione to form glutathione and D-lactic acid.
Danio rerio (taxid: 7955)
EC: 3EC: .EC: 1EC: .EC: 2EC: .EC: 6
>sp|Q4R6C1|GLO2_MACFA Hydroxyacylglutathione hydrolase, mitochondrial OS=Macaca fascicularis GN=HAGH PE=2 SV=2 Back     alignment and function description
>sp|B4F6K2|GLO2_XENTR Hydroxyacylglutathione hydrolase, mitochondrial OS=Xenopus tropicalis GN=hagh PE=2 SV=1 Back     alignment and function description
>sp|Q16775|GLO2_HUMAN Hydroxyacylglutathione hydrolase, mitochondrial OS=Homo sapiens GN=HAGH PE=1 SV=2 Back     alignment and function description
>sp|Q3B7M2|GLO2_BOVIN Hydroxyacylglutathione hydrolase, mitochondrial OS=Bos taurus GN=HAGH PE=2 SV=3 Back     alignment and function description
>sp|Q28333|GLO2_CALJA Hydroxyacylglutathione hydrolase, mitochondrial (Fragment) OS=Callithrix jacchus GN=HAGH PE=2 SV=2 Back     alignment and function description
>sp|Q5ZI23|GLO2_CHICK Hydroxyacylglutathione hydrolase, mitochondrial OS=Gallus gallus GN=HAGH PE=2 SV=1 Back     alignment and function description
>sp|O35952|GLO2_RAT Hydroxyacylglutathione hydrolase, mitochondrial OS=Rattus norvegicus GN=Hagh PE=1 SV=2 Back     alignment and function description
>sp|Q99KB8|GLO2_MOUSE Hydroxyacylglutathione hydrolase, mitochondrial OS=Mus musculus GN=Hagh PE=2 SV=2 Back     alignment and function description
>sp|O24496|GLO2C_ARATH Hydroxyacylglutathione hydrolase cytoplasmic OS=Arabidopsis thaliana GN=GLX2-2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query174
403273622 372 PREDICTED: hydroxyacylglutathione hydrol 0.591 0.276 0.462 2e-18
73959572 309 PREDICTED: hydroxyacylglutathione hydrol 0.494 0.278 0.5 2e-18
257096631 303 RecName: Full=Hydroxyacylglutathione hyd 0.431 0.247 0.576 3e-18
426254175 308 PREDICTED: hydroxyacylglutathione hydrol 0.494 0.279 0.516 3e-18
41053309260 hydroxyacylglutathione hydrolase, mitoch 0.431 0.288 0.576 3e-18
257051016 308 RecName: Full=Hydroxyacylglutathione hyd 0.494 0.279 0.528 5e-18
410985549 385 PREDICTED: hydroxyacylglutathione hydrol 0.477 0.215 0.518 6e-18
354478767 342 PREDICTED: hydroxyacylglutathione hydrol 0.494 0.251 0.528 9e-18
410288546 308 hydroxyacylglutathione hydrolase [Pan tr 0.494 0.279 0.516 9e-18
327280119 307 PREDICTED: hydroxyacylglutathione hydrol 0.431 0.244 0.564 1e-17
>gi|403273622|ref|XP_003928605.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Saimiri boliviensis boliviensis] Back     alignment and taxonomy information
 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 66/108 (61%), Gaps = 5/108 (4%)

Query: 65  FGHERKPAVTHEF--DNGEKRVTHDFGKYTVDLIPALKDNYMYLVVDKASKHAAAIDPVE 122
            G +  PA+   F   +  KR+T D G   V+++PAL DNYMYLV+D  +K AA +DPV+
Sbjct: 85  LGEKTGPALLGVFHHTDFRKRLTVDEGTMKVEVLPALTDNYMYLVIDDETKEAAIVDPVQ 144

Query: 123 PHKILDAVNSHSAQLKHIWTTHHHQDHAGGNYDLVSRYPHLKEHPVYG 170
           P K+++    H  +L  + TTHHH DHAGGN  LV   P LK   VYG
Sbjct: 145 PQKVVEEAKKHGVKLTTVLTTHHHWDHAGGNEKLVKLEPGLK---VYG 189

Source: Saimiri boliviensis boliviensis

Species: Saimiri boliviensis

Genus: Saimiri

Family: Cebidae

Order: Primates

Class: Mammalia

Phylum: Chordata

Superkingdom: Eukaryota
>gi|73959572|ref|XP_537013.2| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Canis lupus familiaris] Back     alignment and taxonomy information
>gi|257096631|sp|Q6P963.2|GLO2_DANRE RecName: Full=Hydroxyacylglutathione hydrolase, mitochondrial; AltName: Full=Glyoxalase II; Short=Glx II; Flags: Precursor Back     alignment and taxonomy information
>gi|426254175|ref|XP_004020757.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Ovis aries] Back     alignment and taxonomy information
>gi|41053309|ref|NP_956337.1| hydroxyacylglutathione hydrolase, mitochondrial [Danio rerio] gi|37681823|gb|AAQ97789.1| hydroxyacyl glutathione hydrolase [Danio rerio] gi|38511595|gb|AAH60913.1| Hydroxyacylglutathione hydrolase [Danio rerio] gi|42744557|gb|AAH66607.1| Hagh protein [Danio rerio] Back     alignment and taxonomy information
>gi|257051016|sp|Q4R6C1.2|GLO2_MACFA RecName: Full=Hydroxyacylglutathione hydrolase, mitochondrial; AltName: Full=Glyoxalase II; Short=Glx II; Flags: Precursor gi|90082751|dbj|BAE90557.1| unnamed protein product [Macaca fascicularis] Back     alignment and taxonomy information
>gi|410985549|ref|XP_003999083.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial [Felis catus] Back     alignment and taxonomy information
>gi|354478767|ref|XP_003501586.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like [Cricetulus griseus] Back     alignment and taxonomy information
>gi|410288546|gb|JAA22873.1| hydroxyacylglutathione hydrolase [Pan troglodytes] Back     alignment and taxonomy information
>gi|327280119|ref|XP_003224801.1| PREDICTED: hydroxyacylglutathione hydrolase, mitochondrial-like [Anolis carolinensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query174
UNIPROTKB|E2R7A0 309 HAGH "Uncharacterized protein" 0.528 0.297 0.483 3.5e-20
ZFIN|ZDB-GENE-030131-8921 303 hagh "hydroxyacylglutathione h 0.431 0.247 0.576 4.4e-20
UNIPROTKB|Q3B7M2 308 HAGH "Hydroxyacylglutathione h 0.494 0.279 0.505 1.2e-19
UNIPROTKB|E7EN93 236 HAGH "Hydroxyacylglutathione h 0.494 0.364 0.516 1.2e-19
UNIPROTKB|Q16775 308 HAGH "Hydroxyacylglutathione h 0.494 0.279 0.516 1.2e-19
UNIPROTKB|J9NVH3 449 HAGH "Uncharacterized protein" 0.528 0.204 0.483 1.3e-19
UNIPROTKB|G1K303 286 HAGH "Hydroxyacylglutathione h 0.517 0.314 0.489 8.3e-19
UNIPROTKB|Q5ZI23 310 HAGH "Hydroxyacylglutathione h 0.431 0.241 0.538 1.4e-18
RGD|2779 309 Hagh "hydroxyacyl glutathione 0.494 0.278 0.471 1.4e-18
UNIPROTKB|O35952 309 Hagh "Hydroxyacylglutathione h 0.494 0.278 0.471 1.4e-18
UNIPROTKB|E2R7A0 HAGH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
 Score = 239 (89.2 bits), Expect = 3.5e-20, P = 3.5e-20
 Identities = 45/93 (48%), Positives = 62/93 (66%)

Query:    72 AVTHEFDNGEKRVTHDFGKYTVDLIPALKDNYMYLVVDKASKHAAAIDPVEPHKILDAVN 131
             A+ +  D+ +K VT + G   V+L+PAL DNYMYL++D  +K A  +DPV+P K+++AV 
Sbjct:    32 ALLYHADS-QKSVTVEQGTMKVELLPALTDNYMYLIIDDETKEAGVVDPVQPQKVVEAVK 90

Query:   132 SHSAQLKHIWTTHHHQDHAGGNYDLVSRYPHLK 164
              H  +L  + TTHHH DHAGGN  LV   P LK
Sbjct:    91 KHGVRLTTVLTTHHHWDHAGGNEKLVKLEPGLK 123
GO:0005739 "mitochondrion" evidence=IEA
GO:0004416 "hydroxyacylglutathione hydrolase activity" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0006750 "glutathione biosynthetic process" evidence=IEA
ZFIN|ZDB-GENE-030131-8921 hagh "hydroxyacylglutathione hydrolase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q3B7M2 HAGH "Hydroxyacylglutathione hydrolase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E7EN93 HAGH "Hydroxyacylglutathione hydrolase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q16775 HAGH "Hydroxyacylglutathione hydrolase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9NVH3 HAGH "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|G1K303 HAGH "Hydroxyacylglutathione hydrolase, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZI23 HAGH "Hydroxyacylglutathione hydrolase, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|2779 Hagh "hydroxyacyl glutathione hydrolase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O35952 Hagh "Hydroxyacylglutathione hydrolase, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O35952GLO2_RAT3, ., 1, ., 2, ., 60.51280.43100.2427yesN/A
Q99KB8GLO2_MOUSE3, ., 1, ., 2, ., 60.52560.43100.2427yesN/A
Q3B7M2GLO2_BOVIN3, ., 1, ., 2, ., 60.50560.49420.2792yesN/A
Q16775GLO2_HUMAN3, ., 1, ., 2, ., 60.51680.49420.2792yesN/A
Q5ZI23GLO2_CHICK3, ., 1, ., 2, ., 60.53840.43100.2419yesN/A
Q6P963GLO2_DANRE3, ., 1, ., 2, ., 60.57690.43100.2475yesN/A
B4F6K2GLO2_XENTR3, ., 1, ., 2, ., 60.57690.43100.2396yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
PLN02469 258 PLN02469, PLN02469, hydroxyacylglutathione hydrola 3e-25
TIGR03413 248 TIGR03413, GSH_gloB, hydroxyacylglutathione hydrol 8e-21
PLN02398 329 PLN02398, PLN02398, hydroxyacylglutathione hydrola 2e-14
PRK10241 251 PRK10241, PRK10241, hydroxyacylglutathione hydrola 2e-12
COG0491 252 COG0491, GloB, Zn-dependent hydrolases, including 6e-06
smart00849 177 smart00849, Lactamase_B, Metallo-beta-lactamase su 1e-04
pfam00753148 pfam00753, Lactamase_B, Metallo-beta-lactamase sup 1e-04
>gnl|CDD|178088 PLN02469, PLN02469, hydroxyacylglutathione hydrolase Back     alignment and domain information 
 Score = 97.1 bits (242), Expect = 3e-25
 Identities = 38/79 (48%), Positives = 55/79 (69%), Gaps = 3/79 (3%)

Query: 96  IPALKDNYMYLVVDKASKHAAAIDPVEPHKILDAVNSHSAQLKHIWTTHHHQDHAGGNYD 155
           +P L+DNY YL++D+++K AA +DPV+P K+L A + H A++K + TTHHH DHAGGN  
Sbjct: 6   VPCLEDNYAYLIIDESTKDAAVVDPVDPEKVLQAAHEHGAKIKLVLTTHHHWDHAGGNEK 65

Query: 156 LVSRYPHLKEHPVYGLKMD 174
           +    P +K   VYG  +D
Sbjct: 66  IKKLVPGIK---VYGGSLD 81

Length = 258
>gnl|CDD|234201 TIGR03413, GSH_gloB, hydroxyacylglutathione hydrolase Back     alignment and domain information
>gnl|CDD|215223 PLN02398, PLN02398, hydroxyacylglutathione hydrolase Back     alignment and domain information
>gnl|CDD|182327 PRK10241, PRK10241, hydroxyacylglutathione hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|223565 COG0491, GloB, Zn-dependent hydrolases, including glyoxylases [General function prediction only] Back     alignment and domain information
>gnl|CDD|214854 smart00849, Lactamase_B, Metallo-beta-lactamase superfamily Back     alignment and domain information
>gnl|CDD|216099 pfam00753, Lactamase_B, Metallo-beta-lactamase superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 174
PLN02469 258 hydroxyacylglutathione hydrolase 99.78
PRK10241 251 hydroxyacylglutathione hydrolase; Provisional 99.74
PLN02398 329 hydroxyacylglutathione hydrolase 99.72
TIGR03413 248 GSH_gloB hydroxyacylglutathione hydrolase. Members 99.7
KOG0813|consensus 265 99.54
PLN02962 251 hydroxyacylglutathione hydrolase 99.54
PRK00055 270 ribonuclease Z; Reviewed 99.25
PRK02126 334 ribonuclease Z; Provisional 99.17
PF00753 194 Lactamase_B: Metallo-beta-lactamase superfamily; I 99.14
TIGR00649 422 MG423 conserved hypothetical protein. Contains an 99.1
smart00849 183 Lactamase_B Metallo-beta-lactamase superfamily. Ap 99.1
PRK11921 394 metallo-beta-lactamase/flavodoxin domain-containin 99.06
COG1237 259 Metal-dependent hydrolases of the beta-lactamase s 99.04
TIGR02651 299 RNase_Z ribonuclease Z. Processing of the 3-prime 98.96
COG0491 252 GloB Zn-dependent hydrolases, including glyoxylase 98.96
PRK05452 479 anaerobic nitric oxide reductase flavorubredoxin; 98.95
PRK05184 302 pyrroloquinoline quinone biosynthesis protein PqqB 98.93
PRK02113 252 putative hydrolase; Provisional 98.92
TIGR02649 303 true_RNase_BN ribonuclease BN. Members of this pro 98.89
PRK11539 755 ComEC family competence protein; Provisional 98.87
TIGR00361 662 ComEC_Rec2 DNA internalization-related competence 98.86
KOG0814|consensus 237 98.8
TIGR03675 630 arCOG00543 arCOG00543 universal archaeal KH-domain 98.78
PRK11244 250 phnP carbon-phosphorus lyase complex accessory pro 98.77
COG1234 292 ElaC Metal-dependent hydrolases of the beta-lactam 98.76
PRK04286 298 hypothetical protein; Provisional 98.72
TIGR02108 302 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B. 98.72
COG0595 555 mRNA degradation ribonucleases J1/J2 (metallo-beta 98.69
TIGR03307 238 PhnP phosphonate metabolism protein PhnP. This fam 98.62
PRK00685 228 metal-dependent hydrolase; Provisional 98.59
COG0426 388 FpaA Uncharacterized flavoproteins [Energy product 98.42
COG2333 293 ComEC Predicted hydrolase (metallo-beta-lactamase 98.34
PF12706 194 Lactamase_B_2: Beta-lactamase superfamily domain; 98.32
COG1235 269 PhnP Metal-dependent hydrolases of the beta-lactam 98.2
TIGR02650 277 RNase_Z_T_toga ribonuclease Z, Thermotoga type. Me 98.02
COG1782 637 Predicted metal-dependent RNase, consists of a met 97.98
COG1236 427 YSH1 Predicted exonuclease of the beta-lactamase f 97.81
KOG1136|consensus 501 97.44
PF13483163 Lactamase_B_3: Beta-lactamase superfamily domain; 97.24
KOG1135|consensus 764 97.21
COG2220 258 Predicted Zn-dependent hydrolases of the beta-lact 97.17
COG2015 655 Alkyl sulfatase and related hydrolases [Secondary 97.11
PF14597 199 Lactamase_B_5: Metallo-beta-lactamase superfamily; 96.93
PRK11709 355 putative L-ascorbate 6-phosphate lactonase; Provis 96.91
KOG2121|consensus 746 96.39
COG3491322 PcbC Isopenicillin N synthase and related dioxygen 95.51
PLN03002332 oxidoreductase, 2OG-Fe(II) oxygenase family protei 95.3
PLN02365300 2-oxoglutarate-dependent dioxygenase 95.21
PLN02984341 oxidoreductase, 2OG-Fe(II) oxygenase family protei 95.11
PLN03001262 oxidoreductase, 2OG-Fe(II) oxygenase family protei 95.09
PLN00417348 oxidoreductase, 2OG-Fe(II) oxygenase family protei 95.06
PLN02750345 oxidoreductase, 2OG-Fe(II) oxygenase family protei 95.01
PF02112 335 PDEase_II: cAMP phosphodiesterases class-II; Inter 94.99
COG2248 304 Predicted hydrolase (metallo-beta-lactamase superf 94.97
PLN02254358 gibberellin 3-beta-dioxygenase 94.8
PLN02216357 protein SRG1 94.79
PLN02156335 gibberellin 2-beta-dioxygenase 94.78
PLN02704335 flavonol synthase 94.73
KOG1137|consensus 668 94.7
PLN02299321 1-aminocyclopropane-1-carboxylate oxidase 94.7
PLN02485329 oxidoreductase 94.68
PLN02912348 oxidoreductase, 2OG-Fe(II) oxygenase family protei 94.66
PLN02904357 oxidoreductase 94.65
PLN02515358 naringenin,2-oxoglutarate 3-dioxygenase 94.59
PLN02639337 oxidoreductase, 2OG-Fe(II) oxygenase family protei 94.56
PLN02997325 flavonol synthase 94.51
PLN02393362 leucoanthocyanidin dioxygenase like protein 94.47
PF1369163 Lactamase_B_4: tRNase Z endonuclease 94.43
PTZ00273320 oxidase reductase; Provisional 94.41
PLN03178360 leucoanthocyanidin dioxygenase; Provisional 94.33
PLN02276361 gibberellin 20-oxidase 94.26
PLN02758361 oxidoreductase, 2OG-Fe(II) oxygenase family protei 93.83
PLN02403303 aminocyclopropanecarboxylate oxidase 93.79
PLN02947374 oxidoreductase 93.31
KOG0143|consensus322 91.97
PF14234 285 DUF4336: Domain of unknown function (DUF4336) 80.37
>PLN02469 hydroxyacylglutathione hydrolase Back     alignment and domain information 
Probab=99.78  E-value=6.6e-19  Score=149.35  Aligned_cols=80  Identities=46%  Similarity=0.833  Sum_probs=74.2

Q ss_pred             eEEEEecccCCeeEEEEEECCCCeEEEEeCCChhHHHHHHHhcCCCccEEEeCCCCcchhcCHHHHHHHCCCCccccEEE
Q psy17906         91 YTVDLIPALKDNYMYLVVDKASKHAAAIDPVEPHKILDAVNSHSAQLKHIWTTHHHQDHAGGNYDLVSRYPHLKEHPVYG  170 (174)
Q Consensus        91 M~I~~ip~~~~Ny~YLI~de~t~~aiLVDpG~~~~i~~~i~~~g~~I~~VllTH~H~DHigGl~~L~~~~p~~~~ipVy~  170 (174)
                      |+|..+|++.+||+|+|.++++++++|||||+.+.+++.+++.+.+|++||+||+|+||+||+..|++.+|+++   ||+
T Consensus         1 ~~i~~~~~~~dNy~Yli~d~~~~~~vlIDp~~~~~il~~l~~~g~~l~~Il~TH~H~DH~gG~~~l~~~~~~~~---V~~   77 (258)
T PLN02469          1 MKIIPVPCLEDNYAYLIIDESTKDAAVVDPVDPEKVLQAAHEHGAKIKLVLTTHHHWDHAGGNEKIKKLVPGIK---VYG   77 (258)
T ss_pred             CeEEEeccccceEEEEEEeCCCCeEEEECCCChHHHHHHHHHcCCcccEEEecCCCCccccCHHHHHHHCCCCE---EEE
Confidence            67888999999999999988778999999999999999999999999999999999999999999999998787   999


Q ss_pred             cCC
Q psy17906        171 LKM  173 (174)
Q Consensus       171 ~~~  173 (174)
                      +..
T Consensus        78 ~~~   80 (258)
T PLN02469         78 GSL   80 (258)
T ss_pred             ech
Confidence            864

>PRK10241 hydroxyacylglutathione hydrolase; Provisional Back     alignment and domain information
>PLN02398 hydroxyacylglutathione hydrolase Back     alignment and domain information
>TIGR03413 GSH_gloB hydroxyacylglutathione hydrolase Back     alignment and domain information
>KOG0813|consensus Back     alignment and domain information
>PLN02962 hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK00055 ribonuclease Z; Reviewed Back     alignment and domain information
>PRK02126 ribonuclease Z; Provisional Back     alignment and domain information
>PF00753 Lactamase_B: Metallo-beta-lactamase superfamily; InterPro: IPR001279 Apart from the beta-lactamases and metallo-beta-lactamases, a number of other proteins contain this domain [] Back     alignment and domain information
>TIGR00649 MG423 conserved hypothetical protein Back     alignment and domain information
>smart00849 Lactamase_B Metallo-beta-lactamase superfamily Back     alignment and domain information
>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional Back     alignment and domain information
>COG1237 Metal-dependent hydrolases of the beta-lactamase superfamily II [General function prediction only] Back     alignment and domain information
>TIGR02651 RNase_Z ribonuclease Z Back     alignment and domain information
>COG0491 GloB Zn-dependent hydrolases, including glyoxylases [General function prediction only] Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>PRK05184 pyrroloquinoline quinone biosynthesis protein PqqB; Provisional Back     alignment and domain information
>PRK02113 putative hydrolase; Provisional Back     alignment and domain information
>TIGR02649 true_RNase_BN ribonuclease BN Back     alignment and domain information
>PRK11539 ComEC family competence protein; Provisional Back     alignment and domain information
>TIGR00361 ComEC_Rec2 DNA internalization-related competence protein ComEC/Rec2 Back     alignment and domain information
>KOG0814|consensus Back     alignment and domain information
>TIGR03675 arCOG00543 arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein Back     alignment and domain information
>PRK11244 phnP carbon-phosphorus lyase complex accessory protein; Provisional Back     alignment and domain information
>COG1234 ElaC Metal-dependent hydrolases of the beta-lactamase superfamily III [General function prediction only] Back     alignment and domain information
>PRK04286 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02108 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B Back     alignment and domain information
>COG0595 mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair] Back     alignment and domain information
>TIGR03307 PhnP phosphonate metabolism protein PhnP Back     alignment and domain information
>PRK00685 metal-dependent hydrolase; Provisional Back     alignment and domain information
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information
>COG2333 ComEC Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>PF12706 Lactamase_B_2: Beta-lactamase superfamily domain; PDB: 3BV6_F 1WW1_A 2E7Y_A 3RPC_D 3ZWF_A 3JXP_A 1XTO_A 2CBN_A 3G1P_B 3P2U_A Back     alignment and domain information
>COG1235 PhnP Metal-dependent hydrolases of the beta-lactamase superfamily I [General function prediction only] Back     alignment and domain information
>TIGR02650 RNase_Z_T_toga ribonuclease Z, Thermotoga type Back     alignment and domain information
>COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] Back     alignment and domain information
>COG1236 YSH1 Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1136|consensus Back     alignment and domain information
>PF13483 Lactamase_B_3: Beta-lactamase superfamily domain; PDB: 1VJN_B 3KL7_A Back     alignment and domain information
>KOG1135|consensus Back     alignment and domain information
>COG2220 Predicted Zn-dependent hydrolases of the beta-lactamase fold [General function prediction only] Back     alignment and domain information
>COG2015 Alkyl sulfatase and related hydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF14597 Lactamase_B_5: Metallo-beta-lactamase superfamily; PDB: 2P97_B Back     alignment and domain information
>PRK11709 putative L-ascorbate 6-phosphate lactonase; Provisional Back     alignment and domain information
>KOG2121|consensus Back     alignment and domain information
>COG3491 PcbC Isopenicillin N synthase and related dioxygenases [General function prediction only] Back     alignment and domain information
>PLN03002 oxidoreductase, 2OG-Fe(II) oxygenase family protein Back     alignment and domain information
>PLN02365 2-oxoglutarate-dependent dioxygenase Back     alignment and domain information
>PLN02984 oxidoreductase, 2OG-Fe(II) oxygenase family protein Back     alignment and domain information
>PLN03001 oxidoreductase, 2OG-Fe(II) oxygenase family protein Back     alignment and domain information
>PLN00417 oxidoreductase, 2OG-Fe(II) oxygenase family protein Back     alignment and domain information
>PLN02750 oxidoreductase, 2OG-Fe(II) oxygenase family protein Back     alignment and domain information
>PF02112 PDEase_II: cAMP phosphodiesterases class-II; InterPro: IPR000396 Cyclic-AMP phosphodiesterase (3 Back     alignment and domain information
>COG2248 Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>PLN02254 gibberellin 3-beta-dioxygenase Back     alignment and domain information
>PLN02216 protein SRG1 Back     alignment and domain information
>PLN02156 gibberellin 2-beta-dioxygenase Back     alignment and domain information
>PLN02704 flavonol synthase Back     alignment and domain information
>KOG1137|consensus Back     alignment and domain information
>PLN02299 1-aminocyclopropane-1-carboxylate oxidase Back     alignment and domain information
>PLN02485 oxidoreductase Back     alignment and domain information
>PLN02912 oxidoreductase, 2OG-Fe(II) oxygenase family protein Back     alignment and domain information
>PLN02904 oxidoreductase Back     alignment and domain information
>PLN02515 naringenin,2-oxoglutarate 3-dioxygenase Back     alignment and domain information
>PLN02639 oxidoreductase, 2OG-Fe(II) oxygenase family protein Back     alignment and domain information
>PLN02997 flavonol synthase Back     alignment and domain information
>PLN02393 leucoanthocyanidin dioxygenase like protein Back     alignment and domain information
>PF13691 Lactamase_B_4: tRNase Z endonuclease Back     alignment and domain information
>PTZ00273 oxidase reductase; Provisional Back     alignment and domain information
>PLN03178 leucoanthocyanidin dioxygenase; Provisional Back     alignment and domain information
>PLN02276 gibberellin 20-oxidase Back     alignment and domain information
>PLN02758 oxidoreductase, 2OG-Fe(II) oxygenase family protein Back     alignment and domain information
>PLN02403 aminocyclopropanecarboxylate oxidase Back     alignment and domain information
>PLN02947 oxidoreductase Back     alignment and domain information
>KOG0143|consensus Back     alignment and domain information
>PF14234 DUF4336: Domain of unknown function (DUF4336) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
1qh3_A 260 Human Glyoxalase Ii With Cacodylate And Acetate Ion 1e-18
1xm8_A 254 X-Ray Structure Of Glyoxalase Ii From Arabidopsis T 9e-12
2qed_A 258 Crystal Structure Of Salmonella Thyphimurium Lt2 Gl 2e-05
2p18_A 311 Crystal Structure Of The Leishmania Infantum Glyoxa 2e-05
>pdb|1QH3|A Chain A, Human Glyoxalase Ii With Cacodylate And Acetate Ions Present In The Active Site Length = 260 Back     alignment and structure 
Iteration: 1

 Score = 89.0 bits (219), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 42/78 (53%), Positives = 53/78 (67%), Gaps = 3/78 (3%)
Query: 93  VDLIPALKDNYMYLVVDKASKHAAAIDPVEPHKILDAVNSHSAQLKHIWTTHHHQDHAGG 152
           V+++PAL DNYMYLV+D  +K AA +DPV+P K++DA   H  +L  + TTHHH DHAGG
Sbjct: 3   VEVLPALTDNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGG 62
Query: 153 NYDLVSRYPHLKEHPVYG 170
           N  LV     LK   VYG
Sbjct: 63  NEKLVKLESGLK---VYG 77
>pdb|1XM8|A Chain A, X-Ray Structure Of Glyoxalase Ii From Arabidopsis Thaliana Gene At2g31350 Length = 254 Back     alignment and structure
>pdb|2QED|A Chain A, Crystal Structure Of Salmonella Thyphimurium Lt2 Glyoxalase Ii Length = 258 Back     alignment and structure
>pdb|2P18|A Chain A, Crystal Structure Of The Leishmania Infantum Glyoxalase Ii Length = 311 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
1qh5_A 260 Glyoxalase II, protein (hydroxyacylglutathione hyd 5e-32
1xm8_A 254 Glyoxalase II; structural genomics, protein struct 1e-29
2qed_A 258 Hydroxyacylglutathione hydrolase; metallo-B- super 1e-28
2p18_A 311 Glyoxalase II; metalloprotein, beta sandwich, alph 2e-25
2xf4_A 210 Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A 3e-13
2zwr_A 207 Metallo-beta-lactamase superfamily protein; hydrol 2e-11
3tp9_A 474 Beta-lactamase and rhodanese domain protein; struc 7e-08
3r2u_A 466 Metallo-beta-lactamase family protein; structural 3e-07
2gcu_A 245 Putative hydroxyacylglutathione hydrolase 3; ethyl 1e-06
4ad9_A 289 Lactb2, beta-lactamase-like protein 2; hydrolase, 3e-06
4efz_A 298 Metallo-beta-lactamase family protein; structural 3e-06
1k07_A 263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA 9e-06
3m8t_A 294 'BLR6230 protein; subclass B3 beta-lactamase, zinc 9e-06
1jjt_A 228 IMP-1 metallo beta-lactamase; metallo-beta-lactama 2e-04
3adr_A 261 Putative uncharacterized protein ST1585; quorum se 2e-04
1sml_A 269 Protein (penicillinase); metallo-beta-lactamase, a 3e-04
1a7t_A 232 Metallo-beta-lactamase; hydrolase (beta-lactamase) 8e-04
>1qh5_A Glyoxalase II, protein (hydroxyacylglutathione hydrolase); metallo-hydrolase; HET: GSH GBP; 1.45A {Homo sapiens} SCOP: d.157.1.2 PDB: 1qh3_A* Length = 260 Back     alignment and structure
 Score =  114 bits (287), Expect = 5e-32
 Identities = 41/79 (51%), Positives = 52/79 (65%), Gaps = 3/79 (3%)

Query: 92  TVDLIPALKDNYMYLVVDKASKHAAAIDPVEPHKILDAVNSHSAQLKHIWTTHHHQDHAG 151
            V+++PAL DNYMYLV+D  +K AA +DPV+P K++DA   H  +L  + TTHHH DHAG
Sbjct: 2   KVEVLPALTDNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAG 61

Query: 152 GNYDLVSRYPHLKEHPVYG 170
           GN  LV     L    VYG
Sbjct: 62  GNEKLVKLESGL---KVYG 77
>1xm8_A Glyoxalase II; structural genomics, protein structure initiative, CESG, AT2G31350, metallo-hydrolase, zinc/iron binuclear center; 1.74A {Arabidopsis thaliana} SCOP: d.157.1.2 PDB: 2q42_A Length = 254 Back     alignment and structure
>2qed_A Hydroxyacylglutathione hydrolase; metallo-B- superfamily, salmonella typhimurium LT2; 1.45A {Salmonella typhimurium} SCOP: d.157.1.2 Length = 258 Back     alignment and structure
>2p18_A Glyoxalase II; metalloprotein, beta sandwich, alpha-helical domain, hydrola; HET: SPD; 1.80A {Leishmania infantum} PDB: 2p1e_A* Length = 311 Back     alignment and structure
>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica} Length = 210 Back     alignment and structure
>2zwr_A Metallo-beta-lactamase superfamily protein; hydrolase; 2.20A {Thermus thermophilus} PDB: 2zzi_A Length = 207 Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Length = 474 Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Length = 466 Back     alignment and structure
>2gcu_A Putative hydroxyacylglutathione hydrolase 3; ethylmalonic encephalopathy, ETHE1, structural genomics, protein structure initiative; 1.48A {Arabidopsis thaliana} Length = 245 Back     alignment and structure
>4ad9_A Lactb2, beta-lactamase-like protein 2; hydrolase, metallo-beta lactamase, mitochondria; 2.60A {Homo sapiens} Length = 289 Back     alignment and structure
>4efz_A Metallo-beta-lactamase family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.60A {Burkholderia pseudomallei} Length = 298 Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER AS UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Length = 263 Back     alignment and structure
>3m8t_A 'BLR6230 protein; subclass B3 beta-lactamase, zinc enzyme, sulfonamide complex hydrolase-hydrolase inhibitor complex; HET: 4NZ; 1.33A {Bradyrhizobium japonicum} PDB: 3lvz_A* 2gmn_A Length = 294 Back     alignment and structure
>1jjt_A IMP-1 metallo beta-lactamase; metallo-beta-lactamase inhibitor, succinic acid inhibitor, I metallo-beta-lactamase, hydrolase; HET: BDS; 1.80A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1dd6_A* 1vgn_A* 2doo_A* 1wup_A 1wuo_A 1jje_A* 1ddk_A Length = 228 Back     alignment and structure
>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii} Length = 261 Back     alignment and structure
>1sml_A Protein (penicillinase); metallo-beta-lactamase, antibiotic resistance, binuclear zinc, hydrolase; 1.70A {Stenotrophomonas maltophilia} SCOP: d.157.1.1 PDB: 2aio_A* 2fm6_A 2fu6_A 2fu7_A* 2fu8_A* 2fu9_A* 2gfj_A* 2gfk_A* 2h6a_A 2hb9_A* 2qdt_A* 2qjs_A 2qin_A Length = 269 Back     alignment and structure
>1a7t_A Metallo-beta-lactamase; hydrolase (beta-lactamase), zinc; HET: MES; 1.85A {Bacteroides fragilis} SCOP: d.157.1.1 PDB: 1a8t_A* 2bmi_A 1kr3_A 1znb_A 2znb_A 3znb_A 4znb_A 1hlk_A* Length = 232 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query174
1qh5_A 260 Glyoxalase II, protein (hydroxyacylglutathione hyd 99.71
1xm8_A 254 Glyoxalase II; structural genomics, protein struct 99.68
2qed_A 258 Hydroxyacylglutathione hydrolase; metallo-B- super 99.68
2p18_A 311 Glyoxalase II; metalloprotein, beta sandwich, alph 99.59
2zwr_A 207 Metallo-beta-lactamase superfamily protein; hydrol 99.58
2xf4_A 210 Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A 99.58
4efz_A 298 Metallo-beta-lactamase family protein; structural 99.55
3r2u_A 466 Metallo-beta-lactamase family protein; structural 99.54
3tp9_A 474 Beta-lactamase and rhodanese domain protein; struc 99.54
2gcu_A 245 Putative hydroxyacylglutathione hydrolase 3; ethyl 99.53
3m8t_A 294 'BLR6230 protein; subclass B3 beta-lactamase, zinc 99.39
1k07_A 263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA 99.37
4eyb_A 270 Beta-lactamase NDM-1; metallo beta lactamase, anti 99.34
3iog_A 227 Beta-lactamase; hydrolase, antibiotic resistance, 99.34
1sml_A 269 Protein (penicillinase); metallo-beta-lactamase, a 99.33
4hl2_A 243 Beta-lactamase NDM-1; structural genomics, PSI-bio 99.31
2vw8_A 303 PA1000, PQSE; quinolone signal response protein, s 99.3
4ad9_A 289 Lactb2, beta-lactamase-like protein 2; hydrolase, 99.3
4ax1_B 303 Metallo-beta-lactamase AIM-1; hydrolase, antibioti 99.29
3q6v_A 233 Beta-lactamase; metalloenzyme, alpha-beta, hydrola 99.28
1m2x_A 223 Class B carbapenemase BLAB-1; alpha-beta/BETA-alph 99.26
3l6n_A 219 Metallo-beta-lactamase; zinc, hydolase, antibiotic 99.26
1jjt_A 228 IMP-1 metallo beta-lactamase; metallo-beta-lactama 99.24
2cbn_A 306 Ribonuclease Z; phosphodiesterase beta lactamase t 99.24
2zo4_A 317 Metallo-beta-lactamase family protein; hydrolase; 99.24
3aj3_A 274 MLR6805 protein, 4-pyridoxolactonase; Zn-protein, 99.23
2p4z_A 284 Metal-dependent hydrolases of the beta-lactamase s 99.21
2y8b_A 265 Metallo-B-lactamase; hydrolase, cephalosporins, an 99.21
3hnn_A 262 Putative diflavin flavoprotein A 5; PSI-2, protein 99.2
3esh_A 280 Protein similar to metal-dependent hydrolase; stru 99.2
1a7t_A 232 Metallo-beta-lactamase; hydrolase (beta-lactamase) 99.2
1mqo_A 227 Beta-lactamase II; alpha-beta/BETA-alpha fold, hyd 99.2
3dha_A 254 N-acyl homoserine lactone hydrolase; zinc bimetall 99.18
2bib_A 547 CBPE, teichoic acid phosphorylcholine esterase/ ch 99.18
1ztc_A 221 Hypothetical protein TM0894; structural genomics, 99.18
3adr_A 261 Putative uncharacterized protein ST1585; quorum se 99.17
2ohh_A 404 Type A flavoprotein FPRA; beta-lactamase like doma 99.16
2fhx_A 246 SPM-1; metallo-beta-lactamase, dinuclear zinc, ant 99.16
1ycg_A 398 Nitric oxide reductase; DIIRON site, oxidoreductas 99.13
1e5d_A 402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase 99.13
3zwf_A 368 Zinc phosphodiesterase ELAC protein 1; beta-lactam 99.12
3md7_A 293 Beta-lactamase-like; ssgcid, hydrolase, structural 99.12
1zkp_A 268 Hypothetical protein BA1088; zinc binding protein, 99.11
1y44_A 320 Ribonuclease Z; zinc-dependent metal hydrolase, hy 99.11
3bk2_A 562 RNAse J, metal dependent hydrolase; endoribonuclea 99.11
3iek_A 431 Ribonuclease TTHA0252; metallo beta lactamase fold 99.1
2e7y_A 280 TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, 99.1
3zq4_A 555 Ribonuclease J 1, RNAse J1; hydrolase, RNA maturat 99.09
2r2d_A 276 AGR_PTI_140P, Zn-dependent hydrolases; lactonase, 99.07
2q9u_A 414 A-type flavoprotein; flavodoxin like, beta lactama 99.07
2p97_A 201 Hypothetical protein; putative metal-dependent hyd 99.06
1p9e_A 331 Methyl parathion hydrolase; Zn containing; 2.40A { 99.05
2i7x_A 717 Protein CFT2; polyadenylation, metallo-B-lactamase 99.04
4dik_A 410 Flavoprotein; TM0755, electron transport, DI-iron 99.03
2i7t_A 459 Cleavage and polyadenylation specificity factor 73 98.99
3g1p_A 258 Protein PHNP; C-P lyase, phosphodiesterase, phosph 98.97
3h3e_A 267 Uncharacterized protein TM1679; structural genomic 98.95
2ycb_A 636 Beta-CAsp RNAse, cleavage and polyadenylation spec 98.93
2cfu_A 658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1 98.93
2az4_A 429 Hypothetical protein EF2904; structural genomics, 98.92
2xr1_A 640 Cleavage and polyadenylation specificity factor 1 98.89
3af5_A 651 Putative uncharacterized protein PH1404; archaeal 98.87
2yhe_A 668 SEC-alkyl sulfatase; hydrolase, inversion, metallo 98.27
3kl7_A 235 Putative metal-dependent hydrolase; structural gen 98.65
3jxp_A 321 Coenzyme PQQ synthesis protein B; alpha-beta prote 98.65
3rpc_A 264 Possible metal-dependent hydrolase; structural gen 98.54
3bv6_A 379 Metal-dependent hydrolase; metallo protein, beta-l 98.42
2wyl_A 360 L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 98.41
1vjn_A 220 Zn-dependent hydrolase of metallo-beta-lactamase s 97.97
4b87_A 367 DNA cross-LINK repair 1A protein; dclre1A, DCLRE, 97.41
3zdk_A 336 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A 96.61
3on7_A280 Oxidoreductase, iron/ascorbate family; structural 95.05
3oox_A312 Putative 2OG-Fe(II) oxygenase family protein; stru 94.78
1w9y_A319 1-aminocyclopropane-1-carboxylate oxidase 1; oxyge 94.56
1dcs_A311 Deacetoxycephalosporin C synthase; ferrous oxygena 94.49
1odm_A331 Isopenicillin N synthase; antibiotic biosynthesis, 94.37
1gp6_A356 Leucoanthocyanidin dioxygenase; 2-oxoglutarate dep 94.2
>1qh5_A Glyoxalase II, protein (hydroxyacylglutathione hydrolase); metallo-hydrolase; HET: GSH GBP; 1.45A {Homo sapiens} SCOP: d.157.1.2 PDB: 1qh3_A* Back     alignment and structure
Probab=99.71  E-value=2.8e-17  Score=136.76  Aligned_cols=80  Identities=53%  Similarity=0.854  Sum_probs=72.8

Q ss_pred             eEEEEecccCCeeEEEEEECCCCeEEEEeCCChhHHHHHHHhcCCCccEEEeCCCCcchhcCHHHHHHHCCCCccccEEE
Q psy17906         91 YTVDLIPALKDNYMYLVVDKASKHAAAIDPVEPHKILDAVNSHSAQLKHIWTTHHHQDHAGGNYDLVSRYPHLKEHPVYG  170 (174)
Q Consensus        91 M~I~~ip~~~~Ny~YLI~de~t~~aiLVDpG~~~~i~~~i~~~g~~I~~VllTH~H~DHigGl~~L~~~~p~~~~ipVy~  170 (174)
                      |+|+.++..++||||+|.++++++++|||||..+.+.+++++.|.++++|++||.|+||+||+..|++.+|+++   ||+
T Consensus         1 m~i~~i~~~~~n~~yli~~~~~~~~vlID~G~~~~i~~~l~~~g~~i~~IllTH~H~DH~gg~~~l~~~~~~~~---v~~   77 (260)
T 1qh5_A            1 MKVEVLPALTDNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLESGLK---VYG   77 (260)
T ss_dssp             CEEEEEEETTTEEEEEEEETTTTEEEEESCSSHHHHHHHHHHHTCEEEEEECCCSSHHHHTTHHHHHHHSTTCE---EEE
T ss_pred             CEEEEEEecCceEEEEEEECCCCEEEEEcCCCHHHHHHHHHHcCCCccEEEeCCCCccccCCHHHHHHHCCCCE---EEE
Confidence            78899998899999999986557899999998888999999999999999999999999999999999997777   999


Q ss_pred             cCC
Q psy17906        171 LKM  173 (174)
Q Consensus       171 ~~~  173 (174)
                      ++.
T Consensus        78 ~~~   80 (260)
T 1qh5_A           78 GDD   80 (260)
T ss_dssp             SCT
T ss_pred             Ccc
Confidence            854
>1xm8_A Glyoxalase II; structural genomics, protein structure initiative, CESG, AT2G31350, metallo-hydrolase, zinc/iron binuclear center; 1.74A {Arabidopsis thaliana} SCOP: d.157.1.2 PDB: 2q42_A Back     alignment and structure
>2qed_A Hydroxyacylglutathione hydrolase; metallo-B- superfamily, salmonella typhimurium LT2; 1.45A {Salmonella typhimurium} SCOP: d.157.1.2 Back     alignment and structure
>2p18_A Glyoxalase II; metalloprotein, beta sandwich, alpha-helical domain, hydrola; HET: SPD; 1.80A {Leishmania infantum} PDB: 2p1e_A* Back     alignment and structure
>2zwr_A Metallo-beta-lactamase superfamily protein; hydrolase; 2.20A {Thermus thermophilus} PDB: 2zzi_A Back     alignment and structure
>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica} Back     alignment and structure
>4efz_A Metallo-beta-lactamase family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3r2u_A Metallo-beta-lactamase family protein; structural genomics, for structural genomics of infectious diseases, csgid, HYDR; 2.10A {Staphylococcus aureus} Back     alignment and structure
>3tp9_A Beta-lactamase and rhodanese domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.70A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>2gcu_A Putative hydroxyacylglutathione hydrolase 3; ethylmalonic encephalopathy, ETHE1, structural genomics, protein structure initiative; 1.48A {Arabidopsis thaliana} Back     alignment and structure
>3m8t_A 'BLR6230 protein; subclass B3 beta-lactamase, zinc enzyme, sulfonamide complex hydrolase-hydrolase inhibitor complex; HET: 4NZ; 1.33A {Bradyrhizobium japonicum} PDB: 3lvz_A* 2gmn_A Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER AS UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Back     alignment and structure
>4eyb_A Beta-lactamase NDM-1; metallo beta lactamase, antibiotic, hydrolase-antibiotic COM; HET: 0WO; 1.16A {Klebsiella pneumoniae} PDB: 4ey2_A* 4eyf_A* 4exy_A 4exs_B 4eyl_A* 3spu_A 3q6x_A* 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>3iog_A Beta-lactamase; hydrolase, antibiotic resistance, metal-binding; HET: SDF; 1.41A {Aeromonas hydrophila} SCOP: d.157.1.1 PDB: 1x8i_A 3fai_A* 3iof_A* 1x8h_A 2qds_A* 2gkl_A* 1x8g_A* 3f9o_A 3t9m_A 3sw3_A Back     alignment and structure
>1sml_A Protein (penicillinase); metallo-beta-lactamase, antibiotic resistance, binuclear zinc, hydrolase; 1.70A {Stenotrophomonas maltophilia} SCOP: d.157.1.1 PDB: 2aio_A* 2fm6_A 2fu6_A 2fu7_A* 2fu8_A* 2fu9_A* 2gfj_A* 2gfk_A* 2h6a_A 2hb9_A* 2qdt_A* 2qjs_A 2qin_A Back     alignment and structure
>4hl2_A Beta-lactamase NDM-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: ZZ7; 1.05A {Klebsiella pneumoniae} PDB: 4hl1_A* 4h0d_A* 4gyu_A* 4gyq_A 3q6x_A* 3spu_A 3rkj_A 3sfp_A* 3rkk_A* 3sbl_A* 3srx_A 3zr9_A 3s0z_A 3pg4_A Back     alignment and structure
>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A* Back     alignment and structure
>4ad9_A Lactb2, beta-lactamase-like protein 2; hydrolase, metallo-beta lactamase, mitochondria; 2.60A {Homo sapiens} Back     alignment and structure
>4ax1_B Metallo-beta-lactamase AIM-1; hydrolase, antibiotic resistance, acquired B3, drug binding; 1.40A {Pseudomonas aeruginosa} PDB: 4awy_B 4awz_A 4ax0_B Back     alignment and structure
>3q6v_A Beta-lactamase; metalloenzyme, alpha-beta, hydrolase; 1.37A {Serratia fonticola} PDB: 3sd9_A Back     alignment and structure
>1m2x_A Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fold., hydrolase; HET: MCO; 1.50A {Elizabethkingia meningoseptica} SCOP: d.157.1.1 Back     alignment and structure
>3l6n_A Metallo-beta-lactamase; zinc, hydolase, antibiotics resistance, hydrolase; 1.65A {Chryseobacterium indologenes} SCOP: d.157.1.0 Back     alignment and structure
>1jjt_A IMP-1 metallo beta-lactamase; metallo-beta-lactamase inhibitor, succinic acid inhibitor, I metallo-beta-lactamase, hydrolase; HET: BDS; 1.80A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1dd6_A* 1vgn_A* 2doo_A* 1wup_A 1wuo_A 1jje_A* 1ddk_A Back     alignment and structure
>2cbn_A Ribonuclease Z; phosphodiesterase beta lactamase tRNAse Z, hydrolase, metal- binding, endonuclease, tRNA processing, zinc; 2.9A {Escherichia coli} SCOP: d.157.1.7 Back     alignment and structure
>2zo4_A Metallo-beta-lactamase family protein; hydrolase; 2.10A {Thermus thermophilus} Back     alignment and structure
>3aj3_A MLR6805 protein, 4-pyridoxolactonase; Zn-protein, metallo-beta-lactamase, hydrolase; 1.58A {Mesorhizobium loti} PDB: 3aj0_A Back     alignment and structure
>2p4z_A Metal-dependent hydrolases of the beta-lactamase superfamily II; metal-dependent hydrolases of the beta-lactamase superfamily hydrolase; 2.10A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>2y8b_A Metallo-B-lactamase; hydrolase, cephalosporins, antibiotic recognition; 1.70A {Pseudomonas aeruginosa} PDB: 2y8a_A 2y87_A 2yz3_A* 2whg_A* 2wrs_A* 1ko3_A 1ko2_A Back     alignment and structure
>3esh_A Protein similar to metal-dependent hydrolase; structural genomics, PSI-2, protein structure initiative; 2.50A {Staphylococcus aureus subsp} Back     alignment and structure
>1a7t_A Metallo-beta-lactamase; hydrolase (beta-lactamase), zinc; HET: MES; 1.85A {Bacteroides fragilis} SCOP: d.157.1.1 PDB: 1a8t_A* 2bmi_A 1kr3_A 1znb_A 2znb_A 3znb_A 4znb_A 1hlk_A* Back     alignment and structure
>1mqo_A Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolase; HET: CIT; 1.35A {Bacillus cereus} SCOP: d.157.1.1 PDB: 1bc2_A 1bvt_A* 3i0v_A 3i11_A 3i13_A 3i14_A 3i15_A 2uyx_A 2bc2_A 3bc2_A 2bfl_A 2bfk_A 2bfz_B 2bg2_A 2bg7_A 2bg8_A 1dxk_A 3kns_A 3knr_A 2bfz_A ... Back     alignment and structure
>3dha_A N-acyl homoserine lactone hydrolase; zinc bimetallohydrolase, quorum quenching; HET: C6L GOL; 0.95A {Bacillus thuringiensis serovar kurstakorganism_taxid} PDB: 3dhb_A* 3dhc_A* 2a7m_A* 2br6_A 2btn_A Back     alignment and structure
>2bib_A CBPE, teichoic acid phosphorylcholine esterase/ choline protein; choline-binding protein, PCE, phosphorylcholine estera hydrolase; HET: PC BTB; 1.92A {Streptococcus pneumoniae} SCOP: b.109.1.1 d.157.1.8 PDB: 1wra_A* Back     alignment and structure
>1ztc_A Hypothetical protein TM0894; structural genomics, joint center for structural genomics, J protein structure initiative, PSI, hydrolase; HET: MSE; 2.10A {Thermotoga maritima} SCOP: d.157.1.11 Back     alignment and structure
>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidore; HET: FMN; 1.70A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 2ohi_A* 2ohj_A* Back     alignment and structure
>2fhx_A SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiotic resistanc hydrolase, metal binding protein; 1.90A {Pseudomonas aeruginosa} Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>3zwf_A Zinc phosphodiesterase ELAC protein 1; beta-lactamase, hydrolase, metal-binding, tRNA processing, zinc-binding, catabolism; 1.70A {Homo sapiens} Back     alignment and structure
>3md7_A Beta-lactamase-like; ssgcid, hydrolase, structural genomics, structural genomics center for infectious disease; HET: 5GP TLA; 1.27A {Brucella melitensis biovar abortus} PDB: 3qh8_A* 3py6_A* 3py5_A* Back     alignment and structure
>1zkp_A Hypothetical protein BA1088; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.50A {Bacillus anthracis str} SCOP: d.157.1.9 Back     alignment and structure
>1y44_A Ribonuclease Z; zinc-dependent metal hydrolase, hydrolase; HET: MES; 2.10A {Bacillus subtilis} SCOP: d.157.1.7 PDB: 2fk6_A* Back     alignment and structure
>3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus} PDB: 3bk1_A* 3t3o_A* 3t3n_A* Back     alignment and structure
>3iek_A Ribonuclease TTHA0252; metallo beta lactamase fold, endonuclease, hydrolase, metal- nuclease, RNA-binding, rRNA processing; HET: FLC; 2.05A {Thermus thermophilus} SCOP: d.157.1.10 PDB: 2dkf_A* 3iel_A* 3iem_A* 2zdf_A* 3idz_A* 2zdd_A* 3ie0_A* 2zde_A* 3ie1_A* 2zdw_A* 3a4y_A* 2yvd_A* 3ie2_A* Back     alignment and structure
>2e7y_A TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.97A {Thermotoga maritima} SCOP: d.157.1.7 PDB: 1ww1_A Back     alignment and structure
>3zq4_A Ribonuclease J 1, RNAse J1; hydrolase, RNA maturation; 3.00A {Bacillus subtilis} Back     alignment and structure
>2r2d_A AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acyl hompserine lactone, DI-nuclear zinc center quenching, AIIB, phosphate; HET: PO4; 1.75A {Agrobacterium tumefaciens} Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Back     alignment and structure
>2p97_A Hypothetical protein; putative metal-dependent hydrolase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.157.1.12 Back     alignment and structure
>1p9e_A Methyl parathion hydrolase; Zn containing; 2.40A {Pseudomonas SP} SCOP: d.157.1.5 Back     alignment and structure
>2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 Back     alignment and structure
>4dik_A Flavoprotein; TM0755, electron transport, DI-iron protein; 1.75A {Thermotoga maritima} PDB: 4dil_A 1vme_A* Back     alignment and structure
>2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A Back     alignment and structure
>3g1p_A Protein PHNP; C-P lyase, phosphodiesterase, phosphonate utilization, alkylphosphonate uptake; 1.40A {Escherichia coli} PDB: 3p2u_A Back     alignment and structure
>3h3e_A Uncharacterized protein TM1679; structural genomics, surface entropy reduction, ISFI, beta- lactamase superfamily, PSI-2; 2.75A {Thermotoga maritima} Back     alignment and structure
>2ycb_A Beta-CAsp RNAse, cleavage and polyadenylation specificity factor; hydrolase, KH, metallo-beta-lactamase; 3.10A {Methanothermobacter thermautotrophicusorganism_taxid} Back     alignment and structure
>2cfu_A SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1.9A {Pseudomonas aeruginosa} SCOP: d.106.1.3 d.157.1.13 PDB: 2cfz_A* 2cg2_A 2cg3_A* Back     alignment and structure
>2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein STR initiative, midwest center for structural genomics, MCSG, U function; 2.00A {Enterococcus faecalis} SCOP: d.157.1.10 Back     alignment and structure
>2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} Back     alignment and structure
>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Back     alignment and structure
>2yhe_A SEC-alkyl sulfatase; hydrolase, inversion, metallo-beta-lactamase fold; 2.70A {Pseudomonas SP} Back     alignment and structure
>3kl7_A Putative metal-dependent hydrolase; structural genomics, JOI for structural genomics, JCSG; 2.30A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>3jxp_A Coenzyme PQQ synthesis protein B; alpha-beta protein, PQQ biosynthesis, transport, biosyntheti; 2.20A {Pseudomonas putida} SCOP: d.157.1.6 PDB: 1xto_A Back     alignment and structure
>3rpc_A Possible metal-dependent hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.49A {Veillonella parvula} Back     alignment and structure
>3bv6_A Metal-dependent hydrolase; metallo protein, beta-lactamase like fold, MCSG, structural PSI-2, protein structure initiative; 1.80A {Vibrio cholerae o1 biovar eltor} Back     alignment and structure
>2wyl_A L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 2.59A {Escherichia coli} PDB: 2wym_A* Back     alignment and structure
>1vjn_A Zn-dependent hydrolase of metallo-beta-lactamase superfamily TM0207; metallo-hydrolase/oxidoreductase fold, structural genomics; 2.00A {Thermotoga maritima} SCOP: d.157.1.4 Back     alignment and structure
>4b87_A DNA cross-LINK repair 1A protein; dclre1A, DCLRE, interstrand crosslink repair, hydrolase, NIT mustard, cancer, chemotherapy, PSO2 homolog,; HET: DNA; 2.16A {Homo sapiens} Back     alignment and structure
>3zdk_A 5' exonuclease apollo; hydrolase; HET: TLA; 2.16A {Homo sapiens} Back     alignment and structure
>3on7_A Oxidoreductase, iron/ascorbate family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.20A {Shewanella oneidensis} Back     alignment and structure
>3oox_A Putative 2OG-Fe(II) oxygenase family protein; structural genomics, joint center for structural genomics; HET: MSE; 1.44A {Caulobacter crescentus CB15} Back     alignment and structure
>1w9y_A 1-aminocyclopropane-1-carboxylate oxidase 1; oxygenase, 2OG oxygenase, ACCO, ACC oxidase; 2.1A {Petunia hybrida} SCOP: b.82.2.1 PDB: 1wa6_X Back     alignment and structure
>1dcs_A Deacetoxycephalosporin C synthase; ferrous oxygenase, 2-oxoglutarate, oxidoreduc antibiotics, merohedral twinning; 1.30A {Streptomyces clavuligerus} SCOP: b.82.2.1 PDB: 1rxf_A 1rxg_A* 1unb_A* 1uo9_A 1uob_A* 1uof_A* 1uog_A* 2jb8_A 1w28_A 1w2a_X 1w2n_A* 1w2o_A* 1hjg_A 1hjf_A 1e5h_A 1e5i_A* Back     alignment and structure
>1odm_A Isopenicillin N synthase; antibiotic biosynthesis, B-lactam antibiotic, oxygenase, penicillin biosynthesis, oxidoreductase, iron; HET: ASV; 1.15A {Emericella nidulans} SCOP: b.82.2.1 PDB: 1blz_A* 1hb1_A* 1hb2_A* 1hb3_A* 1hb4_A* 1ips_A 1obn_A* 1oc1_A* 1bk0_A* 1odn_A* 1qiq_A* 1qje_A* 1qjf_A* 1uzw_A* 1w03_A* 1w04_A* 1w05_A* 1w06_A* 1w3v_A* 1w3x_A* ... Back     alignment and structure
>1gp6_A Leucoanthocyanidin dioxygenase; 2-oxoglutarate dependent dioxygenase, flavonoid biosynthesis; HET: MES QUE DH2; 1.75A {Arabidopsis thaliana} SCOP: b.82.2.1 PDB: 1gp5_A* 1gp4_A* 2brt_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 174
d1xm8a_ 254 d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathio 7e-16
d1qh5a_ 260 d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathio 2e-15
d2qeda1 251 d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglut 3e-12
>d1xm8a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 254 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: Glyoxalase II (hydroxyacylglutathione hydrolase)
domain: Glyoxalase II (hydroxyacylglutathione hydrolase)
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]

 Score = 70.7 bits (172), Expect = 7e-16
 Identities = 28/70 (40%), Positives = 41/70 (58%)

Query: 93  VDLIPALKDNYMYLVVDKASKHAAAIDPVEPHKILDAVNSHSAQLKHIWTTHHHQDHAGG 152
           ++L+P LKDNY Y++ D+ +     +DP E   I+D++      L +I  THHH DH GG
Sbjct: 3   IELVPCLKDNYAYILHDEDTGTVGVVDPSEAEPIIDSLKRSGRNLTYILNTHHHYDHTGG 62

Query: 153 NYDLVSRYPH 162
           N +L  RY  
Sbjct: 63  NLELKDRYGA 72
>d1qh5a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Length = 260 Back     information, alignment and structure
>d2qeda1 d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglutathione hydrolase) {Salmonella typhimurium [TaxId: 90371]} Length = 251 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query174
d1qh5a_ 260 Glyoxalase II (hydroxyacylglutathione hydrolase) { 99.79
d1xm8a_ 254 Glyoxalase II (hydroxyacylglutathione hydrolase) { 99.78
d2qeda1 251 Glyoxalase II (hydroxyacylglutathione hydrolase) { 99.75
d2aioa1 266 Zn metallo-beta-lactamase {Xanthomonas maltophilia 99.38
d2q0ia1 298 Quinolone signal response protein PqsE {Pseudomona 99.35
d2gmna1 264 Zn metallo-beta-lactamase {Bradyrhizobium japonicu 99.35
d1k07a_ 262 Zn metallo-beta-lactamase {Fluoribacter gormanii, 99.29
d2cbna1 305 Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 99.24
d1x8ha_ 228 Zn metallo-beta-lactamase {Aeromonas hydrophila, C 99.23
d2dkfa1 431 Putative RNA-degradation protein TTHA0252 {Thermus 99.21
d1ycga2 249 Nitric oxide reductase N-terminal domain {Moorella 99.2
d1ztca1 207 Hypothetical protein TM0894 {Thermotoga maritima [ 99.19
d1vmea2 250 ROO-like flavoprotein TM0755, N-terminal domain {T 99.17
d1y44a1 307 Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId 99.17
d1jjta_ 220 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 99.14
d1e5da2 249 Rubredoxin oxygen:oxidoreductase (ROO), N-terminal 99.13
d1ko3a_ 230 Zn metallo-beta-lactamase {Pseudomonas aeruginosa, 99.13
d1m2xa_ 219 Zn metallo-beta-lactamase {Chryseobacterium mening 99.11
d1zkpa1 244 Hypothetical protein BA1088 (BAS1016) {Bacillus an 99.11
d1wraa1 305 Teichoic acid phosphorylcholine esterase Pce (LytD 99.1
d1znba_ 230 Zn metallo-beta-lactamase {Bacteroides fragilis [T 99.07
d1mqoa_ 221 Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 99.05
d2i7ta1 451 Cleavage and polyadenylation specificity factor su 99.03
d1p9ea_ 294 Methyl parathion hydrolase {Pseudomonas sp. WBC-3 98.99
d1xtoa_ 304 Coenzyme PQQ synthesis protein B, PqqB {Pseudomona 98.92
d2e7ya1 280 Ribonuclease Z (RNase Z) {Thermotoga maritima [Tax 98.86
d2p97a1 200 Hypothetical protein Ava3068 {Anabaena variabilis 98.84
d2i7xa1 514 Cleavage factor two protein 2, CFT2 {Baker's yeast 98.8
d2cfua2 505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 98.73
d2az4a1 183 Hypothetical protein EF2904 {Enterococcus faecalis 97.96
d1vjna_ 209 Hypothetical protein TM0207 {Thermotoga maritima [ 97.27
d1w9ya1307 1-aminocyclopropane-1-carboxylate oxidase 1 {Petun 94.81
d1odma_329 Isopenicillin N synthase {Emericella nidulans [Tax 94.64
d1dcsa_311 Deacetoxycephalosporin C synthase {Streptomyces cl 93.78
d1gp6a_349 Anthocyanidin synthase {Mouse-ear cress (Arabidops 93.29
>d1qh5a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-hydrolase/oxidoreductase
superfamily: Metallo-hydrolase/oxidoreductase
family: Glyoxalase II (hydroxyacylglutathione hydrolase)
domain: Glyoxalase II (hydroxyacylglutathione hydrolase)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.79  E-value=1.1e-19  Score=150.93  Aligned_cols=79  Identities=53%  Similarity=0.877  Sum_probs=73.3

Q ss_pred             eEEEEecccCCeeEEEEEECCCCeEEEEeCCChhHHHHHHHhcCCCccEEEeCCCCcchhcCHHHHHHHCCCCccccEEE
Q psy17906         91 YTVDLIPALKDNYMYLVVDKASKHAAAIDPVEPHKILDAVNSHSAQLKHIWTTHHHQDHAGGNYDLVSRYPHLKEHPVYG  170 (174)
Q Consensus        91 M~I~~ip~~~~Ny~YLI~de~t~~aiLVDpG~~~~i~~~i~~~g~~I~~VllTH~H~DHigGl~~L~~~~p~~~~ipVy~  170 (174)
                      |+|++||++++||+|+|.++++++++|||||+.+.++++++++++++++||+||+|+||++|+..|++.++...   +|+
T Consensus         1 m~I~~ip~l~DNy~Yli~d~~t~~a~vIDP~~~~~i~~~l~~~~~~l~~Il~TH~H~DHi~g~~~l~~~~~~~~---~~~   77 (260)
T d1qh5a_           1 MKVEVLPALTDNYMYLVIDDETKEAAIVDPVQPQKVVDAARKHGVKLTTVLTTHHHWDHAGGNEKLVKLESGLK---VYG   77 (260)
T ss_dssp             CEEEEEEETTTEEEEEEEETTTTEEEEESCSSHHHHHHHHHHHTCEEEEEECCCSSHHHHTTHHHHHHHSTTCE---EEE
T ss_pred             CeEEEeeeecceEEEEEEECCCCEEEEEeCCCCHHHHHHHHHCCCeEEEEEcCCCChhhhccchhhhccccCcc---ccc
Confidence            89999999999999999998889999999999999999999999999999999999999999999999996655   666


Q ss_pred             cC
Q psy17906        171 LK  172 (174)
Q Consensus       171 ~~  172 (174)
                      +.
T Consensus        78 ~~   79 (260)
T d1qh5a_          78 GD   79 (260)
T ss_dssp             SC
T ss_pred             cc
Confidence            54
>d1xm8a_ d.157.1.2 (A:) Glyoxalase II (hydroxyacylglutathione hydrolase) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2qeda1 d.157.1.2 (A:1-251) Glyoxalase II (hydroxyacylglutathione hydrolase) {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2aioa1 d.157.1.1 (A:23-311) Zn metallo-beta-lactamase {Xanthomonas maltophilia [TaxId: 40324]} Back     information, alignment and structure
>d2q0ia1 d.157.1.14 (A:1-298) Quinolone signal response protein PqsE {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gmna1 d.157.1.1 (A:29-292) Zn metallo-beta-lactamase {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1k07a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Fluoribacter gormanii, (Legionella gormanii) FEZ-1 [TaxId: 464]} Back     information, alignment and structure
>d2cbna1 d.157.1.7 (A:1-305) Ribonuclease Z (RNase Z) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x8ha_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Aeromonas hydrophila, CphA [TaxId: 644]} Back     information, alignment and structure
>d2dkfa1 d.157.1.10 (A:1-431) Putative RNA-degradation protein TTHA0252 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ycga2 d.157.1.3 (A:2-250) Nitric oxide reductase N-terminal domain {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1ztca1 d.157.1.11 (A:1-207) Hypothetical protein TM0894 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vmea2 d.157.1.3 (A:1-250) ROO-like flavoprotein TM0755, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y44a1 d.157.1.7 (A:1-307) Ribonuclease Z (RNase Z) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1jjta_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, IMP-1 [TaxId: 287]} Back     information, alignment and structure
>d1e5da2 d.157.1.3 (A:2-250) Rubredoxin oxygen:oxidoreductase (ROO), N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1ko3a_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Pseudomonas aeruginosa, VIM-2 [TaxId: 287]} Back     information, alignment and structure
>d1m2xa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Chryseobacterium meningosepticum, carbapenemase BLAB-1 [TaxId: 238]} Back     information, alignment and structure
>d1zkpa1 d.157.1.9 (A:1-244) Hypothetical protein BA1088 (BAS1016) {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1wraa1 d.157.1.8 (A:30-334) Teichoic acid phosphorylcholine esterase Pce (LytD), N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1znba_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacteroides fragilis [TaxId: 817]} Back     information, alignment and structure
>d1mqoa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2i7ta1 d.157.1.10 (A:9-459) Cleavage and polyadenylation specificity factor subunit 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ea_ d.157.1.5 (A:) Methyl parathion hydrolase {Pseudomonas sp. WBC-3 [TaxId: 165468]} Back     information, alignment and structure
>d1xtoa_ d.157.1.6 (A:) Coenzyme PQQ synthesis protein B, PqqB {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2e7ya1 d.157.1.7 (A:1-280) Ribonuclease Z (RNase Z) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2p97a1 d.157.1.12 (A:1-200) Hypothetical protein Ava3068 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2i7xa1 d.157.1.10 (A:1-422,A:626-717) Cleavage factor two protein 2, CFT2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2az4a1 d.157.1.10 (A:56-238) Hypothetical protein EF2904 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1vjna_ d.157.1.4 (A:) Hypothetical protein TM0207 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1w9ya1 b.82.2.1 (A:2-308) 1-aminocyclopropane-1-carboxylate oxidase 1 {Petunia hybrida [TaxId: 4102]} Back     information, alignment and structure
>d1odma_ b.82.2.1 (A:) Isopenicillin N synthase {Emericella nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1dcsa_ b.82.2.1 (A:) Deacetoxycephalosporin C synthase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d1gp6a_ b.82.2.1 (A:) Anthocyanidin synthase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure