Psyllid ID: psy17912

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------78
MVMRSPDMFELSRVYGRPSYSGGAPRGGAPRGGGGRGGYGAPRGYSRGGRGGGGSNYGSNSNLRTPNWNSMSMEQINKNLYTPNHLTVSRSQGEVESYLNHHDVTVKGRYYLLRLESRPGKCVPRPIQHFEECNFPPYIMKKIYEMGFQAPTAIQAQGWPIALSGCDLVAIAKTGSGKTLGYIAPAIVHVNSQRPLRSGEGPIVLVLAPTRELAQQIETVANDFGSATATRVACVFGGAPKGPQVKALQTGAEIVIATPGRLIDYLEQGTINLHRTSYLVLDEADRMLDMGFEPQIRKIIGQIRPDRQVLMWSATWPKEVQKLAEDFLVDYVQLNIGSLNPTANHNIVQIVDVCQEHEKDYKLQGLLSQIGSERTSKTIIFVETKRKADDITRSVRNKGWAAVAIHGNKSQQERDRVLNEFRIGRASILVSQYNKSQQERDRVLNEFRIGRASILVSQYKESQQKRDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSDFDILRQWRIAWDEAAVAEAQHLPCIETQPPGFELTRRLWVTLNRIRTKFGKCAANLHKWGLKSSAACDCGAEKQTILHIIQDCPRRRYSGDLKDFSTLNQSAINYINQLDLNV
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccEEEEEEEcccccccccccccccccccccccccHHHHHHHHHccccccccHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHHHcccccccccccEEEEEcccHHHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHccccEEEEcccHHHHHHHcccccccccEEEEEcccccccccccHHHHHHHHccccccccEEEEEcccHHHHHHHHHHHHcccEEEEEccccccccccEEEEEEEccccHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHcccccEEEEcccccccccccccccccccccccEEEEccccccccccccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccHHHcccccHHHHHHHcccHHHccHHHHHHHHHHHHHHHHHHHcHHcccccEEEEccccHHHHHHHcccccccccccEEEEccHHHHHHHHHccHHHHHHHHcccccccccccccEEEHHHHHHHHHHHHcccccHHHHHccccccccccccccccHHHHHHHHccccccccccccccccccHHHHHHHHcccccc
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccHHHHHccHHHHHHHHHHccEEEEccccccccEEEEccccccccccHHHccccHHHHHHHHHcccccccHHHHcccHHHcccccEEEEEEccccHHHHHHHHHHHHHHcccccccccccEEEEEccHHHHHHHHHHHHHHHcccccEEEEEEEccccccHHHHHHHccccEEEEcHHHHHHHHcccccccccccEEEEccHHHHHccccHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHccccEEEEEccccccccccEEEEEEEccHHHHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHcccccEEEEEEHHHccccHccccEcccccEEEEEEEEccccccHHHEEEEccccccccccEEEEEEcHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHHHHcccccccccccccccHHHHHHHHHHHHccccccccccccccHHHHHHHHcccccccEEcccccccccHHHHHHcccEccHHHHccccccHHHHHHHHHHHHHHHcHHHHEHHcccccHHHHHHHHHHHHHcHHEEEEcHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccc
mvmrspdmfelsrvygrpsysggaprggaprggggrggygaprgysrggrggggsnygsnsnlrtpnwnsMSMEQINknlytpnhltvsrsqgEVESYLNHHDVTVKGRYYLLRlesrpgkcvprpiqhfeecnfppyiMKKIYEMgfqaptaiqaqgwpialsgcDLVAIAktgsgktlgyiaPAIVhvnsqrplrsgegpivlvlaPTRELAQQIETVANDFGSATATRVACVfggapkgpqvkalQTGAEIVIATPGRLIDYLEQGTINLHRTSYLVLDEADRMLDMGFEPQIRKIIGQIRPDRQVLMWSATWPKEVQKLAEDFLVDYVQLnigslnptanhnIVQIVDVCQEHEKDYKLQGLLSqigsertsktIIFVETKRKADDITRSVRNKGWAAVAIHGNKSQQERDRVLNEFRIGRASILVSQYNKSQQERDRVLNEFRIGRASILVSQYKESQQKRDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSDFDILRQWRIAWDEAAVAEAqhlpcietqppgfeLTRRLWVTLNRIRTKFGKCAANLHkwglkssaacdcgaeKQTILHIIQdcprrrysgdlkdfsTLNQSAINYINQLDLNV
mvmrspdmFELSRVygrpsysggaprggaprggggrGGYGAPRGYSRGGRGGGGSNYGSNSNLRTPNWNSMSMEQINKNLYTPNHLTVSRSQGEVESYLNHHDVTVKGRYYLLRLEsrpgkcvprpiQHFEECNFPPYIMKKIYEMGFQAPTAIQAQGWPIALSGCDLVAIAKTGSGKTLGYIAPAIVHVNSQRPLRSGEGPIVLVLAPTRELAQQIETVANDFGSATATRVACVFGGAPKGPQVKALQTGAEIVIATPGRLIDYLEQGTINLHRTSYLVLDEADRMLDMGFEPQIRKIIGQIRPDRQVLMWSATWPKEVQKLAEDFLVDYVQLNIGslnptanhNIVQIVDVCQEHEKDYKLQGllsqigsertsktiifvetkrkadditrsvrnkgwaavaihgnksqqerdRVLNEFRIGRASIlvsqynksqqerDRVLNEFRIGRASilvsqykesqqkrdRVLNEFRIGRASIlvshynksqqerDRVLNEFRIGRASIlvshynksqqerDRVLNEFRIGRASIlvshynksqqerDRVLNEFRIGRASIlvshynksqqerDRVLNEFRIGRASIlvshynksqqerDRVLNEFRIGRASIlvshynksqqerDRVLNEFRIGRASIlvshynksqqerDRVLNEFRIGrasilvsdfdILRQWRIAWDEAAVAEAQHlpcietqppgfELTRRLWVTLNRIRTKFGKCAANLHKWGLKSSAACDCGAEKQTILHIIQDCPRRRYSGDLKdfstlnqsainyinqldlnv
MVMRSPDMFELSRVYgrpsysggaprggaprggggrggygaprgysrggrggggsnygsnsnLRTPNWNSMSMEQINKNLYTPNHLTVSRSQGEVESYLNHHDVTVKGRYYLLRLESRPGKCVPRPIQHFEECNFPPYIMKKIYEMGFQAPTAIQAQGWPIALSGCDLVAIAKTGSGKTLGYIAPAIVHVNSQRPLRSGEGPIVLVLAPTRELAQQIETVANDFGSATATRVACVFGGAPKGPQVKALQTGAEIVIATPGRLIDYLEQGTINLHRTSYLVLDEADRMLDMGFEPQIRKIIGQIRPDRQVLMWSATWPKEVQKLAEDFLVDYVQLNIGSLNPTANHNIVQIVDVCQEHEKDYKLQGLLSQIGSERTSKTIIFVETKRKADDITRSVRNKGWAAVAIHGNKSQQERDRVLNEFRIGRASILVSQYNKSQQERDRVLNEFRIGRASILVSQYKESQQKRDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSDFDILRQWRIAWDEAAVAEAQHLPCIETQPPGFELTRRLWVTLNRIRTKFGKCAANLHKWGLKSSAACDCGAEKQTILHIIQDCPRRRYSGDLKDFSTLNQSAINYINQLDLNV
********************************************************************************YT**HLT******EVESYLNHHDVTVKGRYYLLRLESRPGKCVPRPIQHFEECNFPPYIMKKIYEMGFQAPTAIQAQGWPIALSGCDLVAIAKTGSGKTLGYIAPAIVHVNSQRPLRSGEGPIVLVLAPTRELAQQIETVANDFGSATATRVACVFGGAPKGPQVKALQTGAEIVIATPGRLIDYLEQGTINLHRTSYLVLDEADRMLDMGFEPQIRKIIGQIRPDRQVLMWSATWPKEVQKLAEDFLVDYVQLNIGSLNPTANHNIVQIVDVCQEHEKDYKLQGLLSQIGSERTSKTIIFVETKRKADDITRSVRNKGWAAVAIHG********RVLNEFRIGRASILVSQY********RVLNEFRIGRASILVSQY********RVLNEFRIGRASILVSHYNK*****DRVLNEFRIGRASILVSHYNK*****DRVLNEFRIGRASILVSHYNK****RDRVLNEFRIGRASILVSHYNK****RDRVLNEFRIGRASILVSHYNK****RDRVLNEFRIGRASILVSHYNK****RDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSDFDILRQWRIAWDEAAVAEAQHLPCIETQPPGFELTRRLWVTLNRIRTKFGKCAANLHKWGLKSSAACDCGAEKQTILHIIQDCPRRRYSGDLKDFSTLNQSAINYINQ*****
************************************************************************MEQINKNLYTPNHLTVSRSQGEVESYLNHHDVTVKGRYYLLRLESRPGKCVPRPIQHFEECNFPPYIMKKIYEMGFQAPTAIQAQGWPIALSGCDLVAIAKTGSGKTLGYIAPAIVHVNSQ*****GEGPIVLVLAPTRELAQQIETVANDFGSATATRVACVFGGAPKGPQVKALQTGAEIVIATPGRLIDYLEQGTINLHRTSYLVLDEADRMLDMGFEPQIRKIIGQIRPDRQVLMWSATWPKEVQKLAEDFLVDYVQLNIGSLNPTANHNIVQIVDVCQEHEKDYKLQGLLSQIGSERTSKTIIFVETKRKADDITRSVRNKGWAAVAIHGNKSQQERDRVLNEFRIGRASILVSQYNKSQQERDRVLNEFRIGRASILVSQYKESQQKRDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVS************************************************************************************************GRASILV*****************************************EFRIGRASILVSDFDILRQWRIAWDEAAVAEAQHLPCIETQPPGFELTRRLWVTLNRIRTKFGKCAANLHKWGLKSSAACDCGAEKQTILHIIQDCPRRRYSGDLKDFSTLNQSAINYINQLDLN*
MVMRSPDMFELSRVYGRPSYSGGAPRGGAPRGGGGRGGYGAPRGYSRGGRGGGGSNYGSNSNLRTPNWNSMSMEQINKNLYTPNHLTVSRSQGEVESYLNHHDVTVKGRYYLLRLESRPGKCVPRPIQHFEECNFPPYIMKKIYEMGFQAPTAIQAQGWPIALSGCDLVAIAKTGSGKTLGYIAPAIVHVNSQRPLRSGEGPIVLVLAPTRELAQQIETVANDFGSATATRVACVFGGAPKGPQVKALQTGAEIVIATPGRLIDYLEQGTINLHRTSYLVLDEADRMLDMGFEPQIRKIIGQIRPDRQVLMWSATWPKEVQKLAEDFLVDYVQLNIGSLNPTANHNIVQIVDVCQEHEKDYKLQGLLSQIGSERTSKTIIFVETKRKADDITRSVRNKGWAAVAIHGNKSQQERDRVLNEFRIGRASILVS*********DRVLNEFRIGRASILVS*********DRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSDFDILRQWRIAWDEAAVAEAQHLPCIETQPPGFELTRRLWVTLNRIRTKFGKCAANLHKWGLKSSAACDCGAEKQTILHIIQDCPRRRYSGDLKDFSTLNQSAINYINQLDLNV
**************************************************************LRTPNWNSMSMEQINKNLYTPNHLTVSRSQGEVESYLNHHDVTVKGRYYLLRLESRPGKCVPRPIQHFEECNFPPYIMKKIYEMGFQAPTAIQAQGWPIALSGCDLVAIAKTGSGKTLGYIAPAIVHVNSQRPLRSGEGPIVLVLAPTRELAQQIETVANDFGSATATRVACVFGGAPKGPQVKALQTGAEIVIATPGRLIDYLEQGTINLHRTSYLVLDEADRMLDMGFEPQIRKIIGQIRPDRQVLMWSATWPKEVQKLAEDFLVDYVQLNIGSLNPTANHNIVQIVDVCQEHEKDYKLQGLLSQIGSERTSKTIIFVETKRKADDITRSVRNKGWAAVAIHGNKSQQERDRVLNEFRIGRASILVSQYNKSQQERDRVLNEFRIGRASILVSQYKESQQKRDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIG******************************************************SIL******SQQER*R***EFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSDFDILRQWRIAWDEAAVAEAQHLPCIETQPPGFELTRRLWVTLNRIRTKFGKCAANLHKWGLKSSAACDCGAEKQTILHIIQDCPRRRYSGDLKDFSTLNQSAINYINQLDLNV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVMRSPDMFELSRVYGRPSYSGGAPRGGAPRGGGGRGGYGAPRGYSRGGRGGGGSNYGSNSNLRTPNWNSMSMEQINKNLYTPNHLTVSRSQGEVESYLNHHDVTVKGRYYLLRLESRPGKCVPRPIQHFEECNFPPYIMKKIYEMGFQAPTAIQAQGWPIALSGCDLVAIAKTGSGKTLGYIAPAIVHVNSQRPLRSGEGPIVLVLAPTRELAQQIETVANDFGSATATRVACVFGGAPKGPQVKALQTGAEIVIATPGRLIDYLEQGTINLHRTSYLVLDEADRMLDMGFEPQIRKIIGQIRPDRQVLMWSATWPKEVQKLAEDFLVDYVQLNIGSLNPTANHNIVQIVDVCQEHEKDYKLQGLLSQIGSERTSKTIIFVETKRKADDITRSVRNKGWAAVAIHGNKSQQERDRVLNEFRIGRASILVSQYNKSQQERDRVLNEFRIGRASILVSQYKESQQKRDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSHYNKSQQERDRVLNEFRIGRASILVSDFDILRQWRIAWDEAAVAEAQHLPCIETQPPGFELTRRLWVTLNRIRTKFGKCAANLHKWGLKSSAACDCGAEKQTILHIIQDCPRRRYSGDLKDFSTLNQSAINYINQLDLNV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query779 2.2.26 [Sep-21-2011]
P17844614 Probable ATP-dependent RN yes N/A 0.490 0.622 0.564 1e-127
Q61656614 Probable ATP-dependent RN yes N/A 0.490 0.622 0.562 1e-126
Q4R6M5614 Probable ATP-dependent RN N/A N/A 0.490 0.622 0.562 1e-125
A5A6J2614 Probable ATP-dependent RN yes N/A 0.490 0.622 0.562 1e-125
Q5R4I9614 Probable ATP-dependent RN yes N/A 0.490 0.622 0.562 1e-125
P19109719 ATP-dependent RNA helicas no N/A 0.445 0.482 0.607 1e-124
Q501J6650 Probable ATP-dependent RN no N/A 0.458 0.549 0.572 1e-123
Q92841729 Probable ATP-dependent RN no N/A 0.458 0.489 0.572 1e-123
A1C6C4549 ATP-dependent RNA helicas N/A N/A 0.465 0.661 0.549 1e-118
A6RGE3542 ATP-dependent RNA helicas N/A N/A 0.465 0.669 0.550 1e-118
>sp|P17844|DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1 Back     alignment and function desciption
 Score =  454 bits (1169), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 223/395 (56%), Positives = 279/395 (70%), Gaps = 13/395 (3%)

Query: 38  GYGAPR-GYSRGGRGGGGSNYGSNSNLRTPNWNSMSMEQINKNLYTPNHLTVSRSQGEVE 96
           G+GAPR G SR G   G         L    WN   + +  KN Y  +     R+  EVE
Sbjct: 15  GFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVE 74

Query: 97  SYLNHHDVTVKGRYYLLRLESRPGKCVPRPIQHFEECNFPPYIMKKIYEMGFQAPTAIQA 156
           +Y    ++TV+G             C P+P+ +F E NFP  +M  I    F  PTAIQA
Sbjct: 75  TYRRSKEITVRGH-----------NC-PKPVLNFYEANFPANVMDVIARQNFTEPTAIQA 122

Query: 157 QGWPIALSGCDLVAIAKTGSGKTLGYIAPAIVHVNSQRPLRSGEGPIVLVLAPTRELAQQ 216
           QGWP+ALSG D+V +A+TGSGKTL Y+ PAIVH+N Q  L  G+GPI LVLAPTRELAQQ
Sbjct: 123 QGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQ 182

Query: 217 IETVANDFGSATATRVACVFGGAPKGPQVKALQTGAEIVIATPGRLIDYLEQGTINLHRT 276
           ++ VA ++  A   +  C++GGAPKGPQ++ L+ G EI IATPGRLID+LE G  NL RT
Sbjct: 183 VQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRT 242

Query: 277 SYLVLDEADRMLDMGFEPQIRKIIGQIRPDRQVLMWSATWPKEVQKLAEDFLVDYVQLNI 336
           +YLVLDEADRMLDMGFEPQIRKI+ QIRPDRQ LMWSATWPKEV++LAEDFL DY+ +NI
Sbjct: 243 TYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINI 302

Query: 337 GSLNPTANHNIVQIVDVCQEHEKDYKLQGLLSQIGSERTSKTIIFVETKRKADDITRSVR 396
           G+L  +ANHNI+QIVDVC + EKD KL  L+ +I SE+ +KTI+FVETKR+ D++TR +R
Sbjct: 303 GALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRKMR 362

Query: 397 NKGWAAVAIHGNKSQQERDRVLNEFRIGRASILVS 431
             GW A+ IHG+KSQQERD VLNEF+ G+A IL++
Sbjct: 363 RDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIA 397
Involved in the alternative regulation of pre-mRNA splicing; its RNA helicase activity is necessary for increasing tau exon 10 inclusion and occurs in a RBM4-dependent manner. Binds to the tau pre-mRNA in the stem-loop region downstream of exon 10. The rate of ATP hydrolysis is highly stimulated by single-stranded RNA. Involved in transcriptional regulation; the function is independent of the RNA helicase activity. Transcriptional coactivator for estrogen receptor ESR1 and androgen receptor AR. Increases ESR1 AF-1 domain-mediated transactivation and ESR1 AF-1 and AF-2 domains transcriptional synergistic activity. Synergizes with DDX17 and SRA1 RNA to activate MYOD1 transcriptional activity and involved in skeletal muscle differentiation. Transcriptional coactivator for p53/TP53 and involved in p53/TP53 transcriptional response to DNA damage and p53/TP53-dependent apoptosis. Transcriptional coactivator for RUNX2 and involved in regulation of osteoblast differentiation. Acts as transcriptional repressor in a promoter-specicic manner; the function probbaly involves association with histone deacetylases, such as HDAC1.
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 3
>sp|Q61656|DDX5_MOUSE Probable ATP-dependent RNA helicase DDX5 OS=Mus musculus GN=Ddx5 PE=1 SV=2 Back     alignment and function description
>sp|Q4R6M5|DDX5_MACFA Probable ATP-dependent RNA helicase DDX5 OS=Macaca fascicularis GN=DDX5 PE=2 SV=1 Back     alignment and function description
>sp|A5A6J2|DDX5_PANTR Probable ATP-dependent RNA helicase DDX5 OS=Pan troglodytes GN=DDX5 PE=2 SV=1 Back     alignment and function description
>sp|Q5R4I9|DDX5_PONAB Probable ATP-dependent RNA helicase DDX5 OS=Pongo abelii GN=DDX5 PE=2 SV=1 Back     alignment and function description
>sp|P19109|DDX17_DROME ATP-dependent RNA helicase p62 OS=Drosophila melanogaster GN=Rm62 PE=1 SV=3 Back     alignment and function description
>sp|Q501J6|DDX17_MOUSE Probable ATP-dependent RNA helicase DDX17 OS=Mus musculus GN=Ddx17 PE=2 SV=1 Back     alignment and function description
>sp|Q92841|DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 Back     alignment and function description
>sp|A1C6C4|DBP2_ASPCL ATP-dependent RNA helicase dbp2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp2 PE=3 SV=1 Back     alignment and function description
>sp|A6RGE3|DBP2_AJECN ATP-dependent RNA helicase DBP2 OS=Ajellomyces capsulata (strain NAm1 / WU24) GN=DBP2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query779
307191879627 Probable ATP-dependent RNA helicase DDX5 0.519 0.645 0.602 1e-140
345493220777 PREDICTED: probable ATP-dependent RNA he 0.485 0.486 0.602 1e-139
183979315539 DEAD box polypeptide 5 [Papilio xuthus] 0.465 0.673 0.647 1e-139
357620336592 DEAD box polypeptide 5 [Danaus plexippus 0.465 0.613 0.639 1e-138
332020300462 Putative ATP-dependent RNA helicase DDX5 0.534 0.900 0.600 1e-138
322796814 1201 hypothetical protein SINV_01003 [Solenop 0.482 0.313 0.621 1e-138
389614656539 DEAD box ATP-dependent RNA helicase [Pap 0.465 0.673 0.644 1e-138
242012227678 DEAD box ATP-dependent RNA helicase, put 0.458 0.526 0.642 1e-138
307173398639 Probable ATP-dependent RNA helicase DDX5 0.495 0.604 0.616 1e-138
340725165605 PREDICTED: probable ATP-dependent RNA he 0.519 0.669 0.597 1e-137
>gi|307191879|gb|EFN75298.1| Probable ATP-dependent RNA helicase DDX5 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  507 bits (1305), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 265/440 (60%), Positives = 308/440 (70%), Gaps = 35/440 (7%)

Query: 6   PDMFELSRVYGRPSYSGGAPRGGAPRGGG--------------GRGGYGAPRGYSRGGRG 51
           PDMF   R  GR S  G A RGG  RGG               GRG     RG  +G + 
Sbjct: 10  PDMFNRDRDQGR-SRRGSAVRGGISRGGSDNGRGHIVSRFSTRGRGSVSNVRGSLKGKQP 68

Query: 52  GGGSNYGSNSNLRTPNWNSMSMEQINKNLYTPNHLTVSRSQGEVESYLNHHDVTVKGRYY 111
           GGG        LR  NW+  S+E + K+ Y  +    +RS+ EV  +  + ++TVKG   
Sbjct: 69  GGG--------LRRVNWDLRSLEPLRKDFYVEHPAVRNRSKEEVSQFRENTEITVKG--- 117

Query: 112 LLRLESRPGKCVPRPIQHFEECNFPPYIMKKIYEMGFQAPTAIQAQGWPIALSGCDLVAI 171
                    + VP PIQ+FEE NFPPY+M+ I   G+  PT IQAQGWPIALSG DLVAI
Sbjct: 118 ---------ENVPNPIQYFEEGNFPPYVMEGIRRQGYSQPTPIQAQGWPIALSGRDLVAI 168

Query: 172 AKTGSGKTLGYIAPAIVHVNSQRPLRSGEGPIVLVLAPTRELAQQIETVANDFGSATATR 231
           A+TGSGKTLGYI PAIVH+  Q  L +G+GPI L+LAPTRELAQQI+ VAN FG + A R
Sbjct: 169 AQTGSGKTLGYILPAIVHIIHQPRLSNGDGPIALILAPTRELAQQIQEVANCFGESAAVR 228

Query: 232 VACVFGGAPKGPQVKALQTGAEIVIATPGRLIDYLEQGTINLHRTSYLVLDEADRMLDMG 291
             C+FGGAPKGPQ   L  G EI IATPGRLID+LE+GT NL R +YLVLDEADRMLDMG
Sbjct: 229 NTCIFGGAPKGPQAHDLDRGVEICIATPGRLIDFLEKGTTNLRRCTYLVLDEADRMLDMG 288

Query: 292 FEPQIRKIIGQIRPDRQVLMWSATWPKEVQKLAEDFLVDYVQLNIGSLNPTANHNIVQIV 351
           FEPQIRKII QIRPDRQVLMWSATWPKEV+ LAEDFL DY  LNIGSL  +ANHNI QI+
Sbjct: 289 FEPQIRKIIEQIRPDRQVLMWSATWPKEVRALAEDFLTDYTHLNIGSLTLSANHNITQII 348

Query: 352 DVCQEHEKDYKLQGLLSQIGSERTSKTIIFVETKRKADDITRSVRNKGWAAVAIHGNKSQ 411
           DVCQE EKD KL  LL +IG+E+ +KTIIFVETKRK DDITR++R  GW A++IHG+K+Q
Sbjct: 349 DVCQEFEKDSKLFRLLQEIGNEKENKTIIFVETKRKVDDITRNIRRDGWQALSIHGDKNQ 408

Query: 412 QERDRVLNEFRIGRASILVS 431
           QERD VL EFR GRA ILV+
Sbjct: 409 QERDHVLQEFRSGRAPILVA 428

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|345493220|ref|XP_001605420.2| PREDICTED: probable ATP-dependent RNA helicase DDX17-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|183979315|dbj|BAG30754.1| DEAD box polypeptide 5 [Papilio xuthus] Back     alignment and taxonomy information
>gi|357620336|gb|EHJ72566.1| DEAD box polypeptide 5 [Danaus plexippus] Back     alignment and taxonomy information
>gi|332020300|gb|EGI60731.1| Putative ATP-dependent RNA helicase DDX5 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322796814|gb|EFZ19232.1| hypothetical protein SINV_01003 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|389614656|dbj|BAM20360.1| DEAD box ATP-dependent RNA helicase [Papilio polytes] Back     alignment and taxonomy information
>gi|242012227|ref|XP_002426835.1| DEAD box ATP-dependent RNA helicase, putative [Pediculus humanus corporis] gi|212511048|gb|EEB14097.1| DEAD box ATP-dependent RNA helicase, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307173398|gb|EFN64357.1| Probable ATP-dependent RNA helicase DDX5 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340725165|ref|XP_003400944.1| PREDICTED: probable ATP-dependent RNA helicase DDX17-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query779
ZFIN|ZDB-GENE-030131-925617 ddx5 "DEAD (Asp-Glu-Ala-Asp) b 0.458 0.578 0.593 2.8e-123
FB|FBgn0035720818 CG10077 [Drosophila melanogast 0.451 0.430 0.609 1.9e-121
UNIPROTKB|F1NM08595 DDX5 "Uncharacterized protein" 0.458 0.6 0.585 8.5e-119
UNIPROTKB|F1NXI3603 DDX5 "Uncharacterized protein" 0.458 0.592 0.585 8.5e-119
UNIPROTKB|E1C2R8496 DDX17 "Uncharacterized protein 0.458 0.719 0.578 1.8e-118
ZFIN|ZDB-GENE-030131-18671 si:dkey-156n14.5 "si:dkey-156n 0.458 0.532 0.582 1.2e-117
UNIPROTKB|F1MBQ8614 DDX5 "Uncharacterized protein" 0.451 0.573 0.582 2.6e-117
UNIPROTKB|F1PEA6671 DDX5 "Uncharacterized protein" 0.451 0.524 0.582 2.6e-117
UNIPROTKB|J3KTA4614 DDX5 "Probable ATP-dependent R 0.451 0.573 0.582 2.6e-117
UNIPROTKB|P17844614 DDX5 "Probable ATP-dependent R 0.451 0.573 0.582 2.6e-117
ZFIN|ZDB-GENE-030131-925 ddx5 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 1123 (400.4 bits), Expect = 2.8e-123, Sum P(3) = 2.8e-123
 Identities = 219/369 (59%), Positives = 272/369 (73%)

Query:    63 LRTPNWNSMSMEQINKNLYTPNHLTVSRSQGEVESYLNHHDVTVKGRYYLLRLESRPGKC 122
             LR  +WN   + +  KN Y  N     RS  EVE Y    ++TVKGR          G  
Sbjct:    43 LRKKHWNLDELPKFEKNFYQENPDVARRSAQEVEHYRRSKEITVKGR---------DG-- 91

Query:   123 VPRPIQHFEECNFPPYIMKKIYEMGFQAPTAIQAQGWPIALSGCDLVAIAKTGSGKTLGY 182
              P+PI  F E NFP Y+M  I +  +  PT IQAQGWP+ALSG D+V IA+TGSGKTL Y
Sbjct:    92 -PKPIVKFHEANFPKYVMDVITKQNWTDPTPIQAQGWPVALSGKDMVGIAQTGSGKTLSY 150

Query:   183 IAPAIVHVNSQRPLRSGEGPIVLVLAPTRELAQQIETVANDFGSATATRVACVFGGAPKG 242
             + PAIVH+N Q  L  G+GPI LVLAPTRELAQQ++ VA ++G A+  +  C++GGAPKG
Sbjct:   151 LLPAIVHINHQPFLEHGDGPICLVLAPTRELAQQVQQVAAEYGKASRIKSTCIYGGAPKG 210

Query:   243 PQVKALQTGAEIVIATPGRLIDYLEQGTINLHRTSYLVLDEADRMLDMGFEPQIRKIIGQ 302
             PQ++ L+ G EI IATPGRLID+LE G  NL R +YLVLDEADRMLDMGFEPQIRKI+ Q
Sbjct:   211 PQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQ 270

Query:   303 IRPDRQVLMWSATWPKEVQKLAEDFLVDYVQLNIGSLNPTANHNIVQIVDVCQEHEKDYK 362
             IRPDRQ LMWSATWPKEV++LAEDFL +Y+Q+N+G+L  +ANHNI+QIVDVC + EK+ K
Sbjct:   271 IRPDRQTLMWSATWPKEVRQLAEDFLKEYIQINVGALQLSANHNILQIVDVCNDGEKEDK 330

Query:   363 LQGLLSQIGSERTSKTIIFVETKRKADDITRSVRNKGWAAVAIHGNKSQQERDRVLNEFR 422
             L  LL +I SE+ +KTIIFVETKR+ DD+TR +R  GW A+ IHG+K+QQERD VLNEF+
Sbjct:   331 LIRLLEEIMSEKENKTIIFVETKRRCDDLTRRMRRDGWPAMGIHGDKNQQERDWVLNEFK 390

Query:   423 IGRASILVS 431
              G+A IL++
Sbjct:   391 YGKAPILIA 399
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0004386 "helicase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0008026 "ATP-dependent helicase activity" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0016787 "hydrolase activity" evidence=IEA
FB|FBgn0035720 CG10077 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1NM08 DDX5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXI3 DDX5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1C2R8 DDX17 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-18 si:dkey-156n14.5 "si:dkey-156n14.5" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MBQ8 DDX5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PEA6 DDX5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J3KTA4 DDX5 "Probable ATP-dependent RNA helicase DDX5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P17844 DDX5 "Probable ATP-dependent RNA helicase DDX5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q61656DDX5_MOUSE3, ., 6, ., 4, ., 1, 30.56200.49030.6221yesN/A
P0CQ76DBP2_CRYNJ3, ., 6, ., 4, ., 1, 30.55280.45690.6592yesN/A
A2QC74DBP2_ASPNC3, ., 6, ., 4, ., 1, 30.54110.46590.6424yesN/A
Q5B0J9DBP2_EMENI3, ., 6, ., 4, ., 1, 30.53900.46080.6376yesN/A
Q6BY27DBP2_DEBHA3, ., 6, ., 4, ., 1, 30.52570.45820.6660yesN/A
A5A6J2DDX5_PANTR3, ., 6, ., 4, ., 1, 30.56200.49030.6221yesN/A
A3LQW7DBP2_PICST3, ., 6, ., 4, ., 1, 30.53380.45820.6735yesN/A
P17844DDX5_HUMAN3, ., 6, ., 4, ., 1, 30.56450.49030.6221yesN/A
Q6FLF3DBP2_CANGA3, ., 6, ., 4, ., 1, 30.50700.51470.7371yesN/A
Q5R4I9DDX5_PONAB3, ., 6, ., 4, ., 1, 30.56200.49030.6221yesN/A
Q4X195DBP2_ASPFU3, ., 6, ., 4, ., 1, 30.54370.46590.6636yesN/A
Q5N7W4RH30_ORYSJ3, ., 6, ., 4, ., 1, 30.51350.45690.5345yesN/A
Q755N4DBP2_ASHGO3, ., 6, ., 4, ., 1, 30.53380.45820.6409yesN/A
Q9C718RH20_ARATH3, ., 6, ., 4, ., 1, 30.51530.44280.6886yesN/A
P24783DBP2_YEAST3, ., 6, ., 4, ., 1, 30.51330.50570.7216yesN/A
Q6C4D4DBP2_YARLI3, ., 6, ., 4, ., 1, 30.54050.45950.6485yesN/A
Q4IF76DBP2_GIBZE3, ., 6, ., 4, ., 1, 30.53360.46080.6468yesN/A
Q54CE0DDX17_DICDI3, ., 6, ., 4, ., 1, 30.52770.46460.4611yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.6.4.130.824
3rd Layer3.6.40.766

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query779
PTZ00110545 PTZ00110, PTZ00110, helicase; Provisional 1e-157
COG0513513 COG0513, SrmB, Superfamily II DNA and RNA helicase 1e-106
cd00268203 cd00268, DEADc, DEAD-box helicases 1e-100
PRK11776460 PRK11776, PRK11776, ATP-dependent RNA helicase Dbp 1e-69
PRK10590456 PRK10590, PRK10590, ATP-dependent RNA helicase Rhl 6e-61
PLN00206518 PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel 7e-61
pfam00270169 pfam00270, DEAD, DEAD/DEAH box helicase 4e-57
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 2e-52
PRK11192434 PRK11192, PRK11192, ATP-dependent RNA helicase Srm 2e-51
PRK01297475 PRK01297, PRK01297, ATP-dependent RNA helicase Rhl 2e-49
PRK04537572 PRK04537, PRK04537, ATP-dependent RNA helicase Rhl 3e-46
PTZ00424401 PTZ00424, PTZ00424, helicase 45; Provisional 4e-45
PRK04837423 PRK04837, PRK04837, ATP-dependent RNA helicase Rhl 6e-45
PRK11634629 PRK11634, PRK11634, ATP-dependent RNA helicase Dea 1e-42
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 4e-40
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 4e-14
COG1061442 COG1061, SSL2, DNA or RNA helicases of superfamily 2e-09
COG1201 814 COG1201, Lhr, Lhr-like helicases [General function 2e-09
COG1205 851 COG1205, COG1205, Distinct helicase family with a 4e-07
COG0514590 COG0514, RecQ, Superfamily II DNA helicase [DNA re 5e-07
COG1202830 COG1202, COG1202, Superfamily II helicase, archaea 7e-07
TIGR00614470 TIGR00614, recQ_fam, ATP-dependent DNA helicase, R 4e-06
TIGR03817742 TIGR03817, DECH_helic, helicase/secretion neighbor 5e-06
TIGR01389591 TIGR01389, recQ, ATP-dependent DNA helicase RecQ 2e-05
pfam0027178 pfam00271, Helicase_C, Helicase conserved C-termin 2e-04
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 2e-04
smart0049082 smart00490, HELICc, helicase superfamily c-termina 4e-04
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 0.001
PRK11057607 PRK11057, PRK11057, ATP-dependent DNA helicase Rec 0.001
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 0.002
PTZ00146293 PTZ00146, PTZ00146, fibrillarin; Provisional 0.002
COG1111542 COG1111, MPH1, ERCC4-like helicases [DNA replicati 0.002
pfam0717291 pfam07172, GRP, Glycine rich protein family 0.003
cd00079131 cd00079, HELICc, Helicase superfamily c-terminal d 0.004
>gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional Back     alignment and domain information 
 Score =  466 bits (1202), Expect = e-157
 Identities = 204/428 (47%), Positives = 264/428 (61%), Gaps = 20/428 (4%)

Query: 12  SRVYGRPSYSGGAPRGGAPRGGGGRGGYGAPR-GYSRGGRGGGGSNYGSN------SNLR 64
           S  Y        +           +  YG  R GY     G GG    S         L+
Sbjct: 18  SNNYNSYGPYPDSSNPYGNYQANHQDNYGGFRPGYGNYSGGYGGFGMNSYGSSTLGKRLQ 77

Query: 65  TPNWNSMSMEQINKNLYTPNHLTVSRSQGEVESYLNHHDVTVKGRYYLLRLESRPGKCVP 124
             +W S+++    KN Y  +    + S  EV+      ++T+             G+ VP
Sbjct: 78  PIDWKSINLVPFEKNFYKEHPEVSALSSKEVDEIRKEKEITIIA-----------GENVP 126

Query: 125 RPIQHFEECNFPPYIMKKIYEMGFQAPTAIQAQGWPIALSGCDLVAIAKTGSGKTLGYIA 184
           +P+  FE  +FP YI+K +   GF  PT IQ QGWPIALSG D++ IA+TGSGKTL ++ 
Sbjct: 127 KPVVSFEYTSFPDYILKSLKNAGFTEPTPIQVQGWPIALSGRDMIGIAETGSGKTLAFLL 186

Query: 185 PAIVHVNSQRPLRSGEGPIVLVLAPTRELAQQIETVANDFGSATATRVACVFGGAPKGPQ 244
           PAIVH+N+Q  LR G+GPIVLVLAPTRELA+QI    N FG+++  R    +GG PK  Q
Sbjct: 187 PAIVHINAQPLLRYGDGPIVLVLAPTRELAEQIREQCNKFGASSKIRNTVAYGGVPKRGQ 246

Query: 245 VKALQTGAEIVIATPGRLIDYLEQGTINLHRTSYLVLDEADRMLDMGFEPQIRKIIGQIR 304
           + AL+ G EI+IA PGRLID+LE    NL R +YLVLDEADRMLDMGFEPQIRKI+ QIR
Sbjct: 247 IYALRRGVEILIACPGRLIDFLESNVTNLRRVTYLVLDEADRMLDMGFEPQIRKIVSQIR 306

Query: 305 PDRQVLMWSATWPKEVQKLAEDFLVDY-VQLNIGSLNPTANHNIVQIVDVCQEHEKDYKL 363
           PDRQ LMWSATWPKEVQ LA D   +  V +N+GSL+ TA HNI Q V V +EHEK  KL
Sbjct: 307 PDRQTLMWSATWPKEVQSLARDLCKEEPVHVNVGSLDLTACHNIKQEVFVVEEHEKRGKL 366

Query: 364 QGLLSQIGSERTSKTIIFVETKRKADDITRSVRNKGWAAVAIHGNKSQQERDRVLNEFRI 423
           + LL +I  +   K +IFVETK+ AD +T+ +R  GW A+ IHG+K Q+ER  VLNEF+ 
Sbjct: 367 KMLLQRIMRD-GDKILIFVETKKGADFLTKELRLDGWPALCIHGDKKQEERTWVLNEFKT 425

Query: 424 GRASILVS 431
           G++ I+++
Sbjct: 426 GKSPIMIA 433

Length = 545
>gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases Back     alignment and domain information
>gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional Back     alignment and domain information
>gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] Back     alignment and domain information
>gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>gnl|CDD|223588 COG0514, RecQ, Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|224123 COG1202, COG1202, Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>gnl|CDD|129701 TIGR00614, recQ_fam, ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>gnl|CDD|234365 TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>gnl|CDD|130456 TIGR01389, recQ, ATP-dependent DNA helicase RecQ Back     alignment and domain information
>gnl|CDD|201125 pfam00271, Helicase_C, Helicase conserved C-terminal domain Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|197757 smart00490, HELICc, helicase superfamily c-terminal domain Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|182933 PRK11057, PRK11057, ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>gnl|CDD|240291 PTZ00146, PTZ00146, fibrillarin; Provisional Back     alignment and domain information
>gnl|CDD|224036 COG1111, MPH1, ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|219320 pfam07172, GRP, Glycine rich protein family Back     alignment and domain information
>gnl|CDD|238034 cd00079, HELICc, Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 779
PTZ00110545 helicase; Provisional 100.0
KOG0331|consensus519 100.0
KOG0336|consensus629 100.0
KOG0333|consensus673 100.0
KOG0330|consensus476 100.0
KOG0339|consensus731 100.0
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 100.0
KOG0341|consensus610 100.0
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 100.0
KOG0334|consensus997 100.0
KOG0328|consensus400 100.0
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0335|consensus482 100.0
KOG0338|consensus691 100.0
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 100.0
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 100.0
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 100.0
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 100.0
KOG0340|consensus442 100.0
KOG0326|consensus459 100.0
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 100.0
KOG0342|consensus543 100.0
KOG0345|consensus567 100.0
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 100.0
KOG0343|consensus758 100.0
PTZ00424401 helicase 45; Provisional 100.0
KOG0348|consensus708 100.0
KOG0346|consensus569 100.0
KOG0332|consensus477 100.0
KOG0347|consensus731 100.0
TIGR03817742 DECH_helic helicase/secretion neighborhood putativ 100.0
KOG0327|consensus397 100.0
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 100.0
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 100.0
KOG4284|consensus 980 100.0
KOG0337|consensus529 100.0
KOG0344|consensus593 100.0
PRK11057607 ATP-dependent DNA helicase RecQ; Provisional 100.0
PRK02362737 ski2-like helicase; Provisional 100.0
KOG0350|consensus620 100.0
TIGR01389591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 100.0
PRK13767 876 ATP-dependent helicase; Provisional 100.0
PRK00254720 ski2-like helicase; Provisional 100.0
COG0514590 RecQ Superfamily II DNA helicase [DNA replication, 100.0
PRK01172674 ski2-like helicase; Provisional 100.0
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 100.0
COG1201 814 Lhr Lhr-like helicases [General function predictio 100.0
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 100.0
PRK106891147 transcription-repair coupling factor; Provisional 100.0
KOG0329|consensus387 100.0
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 100.0
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 100.0
TIGR00643630 recG ATP-dependent DNA helicase RecG. 100.0
KOG0352|consensus641 100.0
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 100.0
PHA02653675 RNA helicase NPH-II; Provisional 100.0
PRK09401 1176 reverse gyrase; Reviewed 100.0
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 100.0
PRK14701 1638 reverse gyrase; Provisional 100.0
KOG0351|consensus941 100.0
COG1111542 MPH1 ERCC4-like helicases [DNA replication, recomb 100.0
COG1204766 Superfamily II helicase [General function predicti 100.0
COG1202830 Superfamily II helicase, archaea-specific [General 100.0
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 100.0
PHA02558501 uvsW UvsW helicase; Provisional 100.0
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 100.0
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 100.0
KOG0353|consensus695 100.0
PRK13766773 Hef nuclease; Provisional 100.0
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 100.0
COG1205 851 Distinct helicase family with a unique C-terminal 100.0
KOG0349|consensus725 100.0
KOG0354|consensus746 100.0
PRK09200790 preprotein translocase subunit SecA; Reviewed 100.0
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 100.0
TIGR03714762 secA2 accessory Sec system translocase SecA2. Memb 100.0
TIGR00963745 secA preprotein translocase, SecA subunit. The pro 100.0
KOG0952|consensus 1230 99.98
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 99.97
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 99.96
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 99.96
COG1200677 RecG RecG-like helicase [DNA replication, recombin 99.96
KOG0947|consensus 1248 99.96
KOG0948|consensus 1041 99.96
PRK05580679 primosome assembly protein PriA; Validated 99.96
PRK09694878 helicase Cas3; Provisional 99.95
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 99.95
COG11971139 Mfd Transcription-repair coupling factor (superfam 99.95
PRK13104896 secA preprotein translocase subunit SecA; Reviewed 99.95
KOG0951|consensus 1674 99.95
PRK04914956 ATP-dependent helicase HepA; Validated 99.95
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.95
PRK12904830 preprotein translocase subunit SecA; Reviewed 99.94
TIGR00595505 priA primosomal protein N'. All proteins in this f 99.94
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 99.94
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 99.93
PRK12906796 secA preprotein translocase subunit SecA; Reviewed 99.93
PRK114481123 hsdR type I restriction enzyme EcoKI subunit R; Pr 99.92
KOG0950|consensus 1008 99.92
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 99.92
COG4098441 comFA Superfamily II DNA/RNA helicase required for 99.92
PRK13107908 preprotein translocase subunit SecA; Reviewed 99.92
KOG0922|consensus674 99.92
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.91
KOG0920|consensus924 99.9
KOG0923|consensus902 99.9
COG1203733 CRISPR-associated helicase Cas3 [Defense mechanism 99.89
KOG0924|consensus1042 99.87
KOG0385|consensus971 99.87
PRK129001025 secA preprotein translocase subunit SecA; Reviewed 99.83
KOG0926|consensus 1172 99.83
KOG0331|consensus519 99.82
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 99.82
smart00487201 DEXDc DEAD-like helicases superfamily. 99.8
TIGR01407850 dinG_rel DnaQ family exonuclease/DinG family helic 99.8
KOG0949|consensus 1330 99.8
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 99.79
PRK12326764 preprotein translocase subunit SecA; Reviewed 99.79
TIGR00348667 hsdR type I site-specific deoxyribonuclease, HsdR 99.78
COG1198730 PriA Primosomal protein N' (replication factor Y) 99.77
KOG0925|consensus699 99.76
COG4096875 HsdR Type I site-specific restriction-modification 99.76
PRK13103913 secA preprotein translocase subunit SecA; Reviewed 99.75
KOG0384|consensus 1373 99.72
PRK05298652 excinuclease ABC subunit B; Provisional 99.72
KOG4150|consensus 1034 99.71
COG0556663 UvrB Helicase subunit of the DNA excision repair c 99.71
PRK12903925 secA preprotein translocase subunit SecA; Reviewed 99.7
KOG0387|consensus923 99.68
PRK07246820 bifunctional ATP-dependent DNA helicase/DNA polyme 99.66
KOG1123|consensus776 99.65
COG4889 1518 Predicted helicase [General function prediction on 99.64
CHL00122870 secA preprotein translocase subunit SecA; Validate 99.63
KOG0390|consensus776 99.62
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 99.62
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 99.61
KOG0392|consensus1549 99.6
PRK12902 939 secA preprotein translocase subunit SecA; Reviewed 99.6
KOG0389|consensus941 99.6
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 99.6
KOG0951|consensus1674 99.58
PRK08074928 bifunctional ATP-dependent DNA helicase/DNA polyme 99.57
KOG0953|consensus700 99.55
TIGR03117636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 99.54
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.54
PF06862442 DUF1253: Protein of unknown function (DUF1253); In 99.47
TIGR025621110 cas3_yersinia CRISPR-associated helicase Cas3. The 99.44
KOG1000|consensus689 99.42
KOG2340|consensus698 99.42
PRK129011112 secA preprotein translocase subunit SecA; Reviewed 99.41
smart0049082 HELICc helicase superfamily c-terminal domain. 99.41
KOG0386|consensus1157 99.39
COG0513513 SrmB Superfamily II DNA and RNA helicases [DNA rep 99.34
PRK11747697 dinG ATP-dependent DNA helicase DinG; Provisional 99.33
COG1199654 DinG Rad3-related DNA helicases [Transcription / D 99.31
TIGR00604705 rad3 DNA repair helicase (rad3). All proteins in t 99.28
KOG0921|consensus 1282 99.24
PRK14873665 primosome assembly protein PriA; Provisional 99.23
KOG4439|consensus901 99.19
PTZ00110545 helicase; Provisional 99.19
KOG0388|consensus1185 99.19
PF02399 824 Herpes_ori_bp: Origin of replication binding prote 99.17
KOG0339|consensus731 99.16
KOG0335|consensus482 99.13
KOG0391|consensus 1958 99.12
KOG1002|consensus791 99.05
PF00176299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.04
PF07652148 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR 99.03
COG0553866 HepA Superfamily II DNA/RNA helicases, SNF2 family 98.99
KOG0333|consensus673 98.95
COG0653 822 SecA Preprotein translocase subunit SecA (ATPase, 98.92
smart00489289 DEXDc3 DEAD-like helicases superfamily. 98.92
smart00488289 DEXDc2 DEAD-like helicases superfamily. 98.92
KOG0328|consensus400 98.91
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 98.9
TIGR00614470 recQ_fam ATP-dependent DNA helicase, RecQ family. 98.88
TIGR00580926 mfd transcription-repair coupling factor (mfd). Al 98.86
PRK10590456 ATP-dependent RNA helicase RhlE; Provisional 98.85
PRK04837423 ATP-dependent RNA helicase RhlB; Provisional 98.84
KOG0334|consensus 997 98.82
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 98.81
KOG0341|consensus610 98.79
PRK11776460 ATP-dependent RNA helicase DbpA; Provisional 98.78
PRK10689 1147 transcription-repair coupling factor; Provisional 98.77
KOG0336|consensus629 98.77
KOG1015|consensus1567 98.76
PRK04537572 ATP-dependent RNA helicase RhlB; Provisional 98.76
PF07517266 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 98.71
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 98.69
PRK11192434 ATP-dependent RNA helicase SrmB; Provisional 98.68
COG0610962 Type I site-specific restriction-modification syst 98.67
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 98.64
PRK10917681 ATP-dependent DNA helicase RecG; Provisional 98.64
PLN00206518 DEAD-box ATP-dependent RNA helicase; Provisional 98.62
KOG0952|consensus1230 98.6
KOG0330|consensus476 98.59
PRK01297475 ATP-dependent RNA helicase RhlB; Provisional 98.56
KOG0338|consensus691 98.55
COG0514 590 RecQ Superfamily II DNA helicase [DNA replication, 98.52
TIGR00643630 recG ATP-dependent DNA helicase RecG. 98.46
TIGR00596 814 rad1 DNA repair protein (rad1). This family is bas 98.44
PRK14701 1638 reverse gyrase; Provisional 98.39
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 98.34
PRK15483 986 type III restriction-modification system StyLTI en 98.31
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 98.3
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 98.28
PTZ00424401 helicase 45; Provisional 98.21
KOG0340|consensus442 98.2
PRK09401 1176 reverse gyrase; Reviewed 98.16
KOG0327|consensus397 98.15
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 98.14
PRK13767 876 ATP-dependent helicase; Provisional 98.12
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 98.12
PF13872303 AAA_34: P-loop containing NTP hydrolase pore-1 98.12
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 98.02
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 97.99
PRK05580679 primosome assembly protein PriA; Validated 97.98
TIGR00595505 priA primosomal protein N'. All proteins in this f 97.98
TIGR01587358 cas3_core CRISPR-associated helicase Cas3. This mo 97.94
KOG0326|consensus459 97.86
KOG0332|consensus477 97.82
KOG0342|consensus543 97.79
PRK13766 773 Hef nuclease; Provisional 97.74
KOG1802|consensus935 97.73
PHA02558501 uvsW UvsW helicase; Provisional 97.72
KOG1803|consensus649 97.65
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 97.6
TIGR01447586 recD exodeoxyribonuclease V, alpha subunit. This f 97.59
PRK10536262 hypothetical protein; Provisional 97.59
PRK10875615 recD exonuclease V subunit alpha; Provisional 97.58
COG1200677 RecG RecG-like helicase [DNA replication, recombin 97.56
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 97.56
KOG1016|consensus 1387 97.55
TIGR00376637 DNA helicase, putative. The gene product may repre 97.54
TIGR01448720 recD_rel helicase, putative, RecD/TraA family. Thi 97.48
PRK02362 737 ski2-like helicase; Provisional 97.43
KOG1132|consensus 945 97.38
KOG0351|consensus 941 97.36
KOG0343|consensus 758 97.29
PF13307167 Helicase_C_2: Helicase C-terminal domain; PDB: 4A1 97.24
COG3587 985 Restriction endonuclease [Defense mechanisms] 97.24
COG11971139 Mfd Transcription-repair coupling factor (superfam 97.23
PTZ00146293 fibrillarin; Provisional 97.14
PF1324576 AAA_19: Part of AAA domain 97.1
PHA02653675 RNA helicase NPH-II; Provisional 97.1
PRK00254 720 ski2-like helicase; Provisional 97.1
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 97.09
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 97.07
KOG1805|consensus1100 97.07
PRK13889988 conjugal transfer relaxase TraA; Provisional 97.06
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 97.04
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.03
PRK04296190 thymidine kinase; Provisional 97.02
TIGR00631655 uvrb excinuclease ABC, B subunit. This family is b 97.01
PRK04914 956 ATP-dependent helicase HepA; Validated 97.0
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 96.99
PRK13826 1102 Dtr system oriT relaxase; Provisional 96.97
KOG0347|consensus731 96.92
PRK09694878 helicase Cas3; Provisional 96.9
COG1875436 NYN ribonuclease and ATPase of PhoH family domains 96.86
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 96.85
PRK05298652 excinuclease ABC subunit B; Provisional 96.84
PRK08181269 transposase; Validated 96.82
COG3421 812 Uncharacterized protein conserved in bacteria [Fun 96.8
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 96.79
KOG4284|consensus 980 96.78
PRK01172 674 ski2-like helicase; Provisional 96.74
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 96.73
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 96.72
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility 96.71
KOG0345|consensus567 96.66
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 96.65
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 96.62
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 96.6
TIGR01970 819 DEAH_box_HrpB ATP-dependent helicase HrpB. This mo 96.6
PRK06526254 transposase; Provisional 96.56
PRK14974336 cell division protein FtsY; Provisional 96.55
PF1396686 zf-RVT: zinc-binding in reverse transcriptase 96.51
KOG0346|consensus569 96.5
PRK07952244 DNA replication protein DnaC; Validated 96.35
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 96.34
PF14617252 CMS1: U3-containing 90S pre-ribosomal complex subu 96.3
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 96.27
KOG0337|consensus529 96.24
COG1201 814 Lhr Lhr-like helicases [General function predictio 96.2
PRK06835329 DNA replication protein DnaC; Validated 96.15
smart00382148 AAA ATPases associated with a variety of cellular 96.15
PRK05642234 DNA replication initiation factor; Validated 96.14
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 96.07
KOG0348|consensus708 96.06
KOG0989|consensus346 96.0
PRK06893229 DNA replication initiation factor; Validated 96.0
PRK12898656 secA preprotein translocase subunit SecA; Reviewed 95.98
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 95.95
KOG1001|consensus674 95.94
PRK06921266 hypothetical protein; Provisional 95.94
PRK08084235 DNA replication initiation factor; Provisional 95.93
TIGR03158357 cas3_cyano CRISPR-associated helicase, Cyano-type. 95.87
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 95.85
PRK14723767 flhF flagellar biosynthesis regulator FlhF; Provis 95.84
PF0027178 Helicase_C: Helicase conserved C-terminal domain; 95.78
TIGR00603732 rad25 DNA repair helicase rad25. All proteins in t 95.78
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 95.73
cd01124187 KaiC KaiC is a circadian clock protein primarily f 95.69
PRK08727233 hypothetical protein; Validated 95.68
cd00079131 HELICc Helicase superfamily c-terminal domain; ass 95.64
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 95.6
KOG0383|consensus696 95.56
PRK08116268 hypothetical protein; Validated 95.53
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 95.51
PRK14964491 DNA polymerase III subunits gamma and tau; Provisi 95.51
PF13173128 AAA_14: AAA domain 95.46
PRK12727559 flagellar biosynthesis regulator FlhF; Provisional 95.42
KOG3973|consensus465 95.39
PRK09200 790 preprotein translocase subunit SecA; Reviewed 95.38
KOG1131|consensus 755 95.35
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 95.29
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Valida 95.27
PRK00149450 dnaA chromosomal replication initiation protein; R 95.25
PRK13107 908 preprotein translocase subunit SecA; Reviewed 95.23
PRK08903227 DnaA regulatory inactivator Hda; Validated 95.23
PRK12377248 putative replication protein; Provisional 95.22
PHA02533534 17 large terminase protein; Provisional 95.16
PRK12323700 DNA polymerase III subunits gamma and tau; Provisi 95.12
KOG0349|consensus725 95.11
PRK14712 1623 conjugal transfer nickase/helicase TraI; Provision 95.06
PHA02544316 44 clamp loader, small subunit; Provisional 95.06
COG1444758 Predicted P-loop ATPase fused to an acetyltransfer 95.03
PRK00771437 signal recognition particle protein Srp54; Provisi 94.99
PRK05707328 DNA polymerase III subunit delta'; Validated 94.96
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 94.95
PRK12422445 chromosomal replication initiation protein; Provis 94.91
PRK14087450 dnaA chromosomal replication initiation protein; P 94.84
PRK14958509 DNA polymerase III subunits gamma and tau; Provisi 94.83
smart0049082 HELICc helicase superfamily c-terminal domain. 94.82
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 94.78
COG1484254 DnaC DNA replication protein [DNA replication, rec 94.77
PRK14086617 dnaA chromosomal replication initiation protein; P 94.74
PRK08769319 DNA polymerase III subunit delta'; Validated 94.73
PRK07994647 DNA polymerase III subunits gamma and tau; Validat 94.69
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 94.68
PRK09183259 transposase/IS protein; Provisional 94.67
TIGR00362405 DnaA chromosomal replication initiator protein Dna 94.63
PRK14960702 DNA polymerase III subunits gamma and tau; Provisi 94.63
PHA03333752 putative ATPase subunit of terminase; Provisional 94.6
KOG0344|consensus593 94.58
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 94.56
PRK14088440 dnaA chromosomal replication initiation protein; P 94.54
COG2256436 MGS1 ATPase related to the helicase subunit of the 94.53
PRK11331459 5-methylcytosine-specific restriction enzyme subun 94.47
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 94.47
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 94.42
COG1205 851 Distinct helicase family with a unique C-terminal 94.4
PRK09111598 DNA polymerase III subunits gamma and tau; Validat 94.38
PRK13709 1747 conjugal transfer nickase/helicase TraI; Provision 94.37
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 94.37
PRK04195482 replication factor C large subunit; Provisional 94.32
PRK05563559 DNA polymerase III subunits gamma and tau; Validat 94.28
PRK12900 1025 secA preprotein translocase subunit SecA; Reviewed 94.25
PRK08691709 DNA polymerase III subunits gamma and tau; Validat 94.22
TIGR01547396 phage_term_2 phage terminase, large subunit, PBSX 94.22
KOG0350|consensus620 94.15
PRK14952584 DNA polymerase III subunits gamma and tau; Provisi 94.14
KOG0352|consensus 641 94.13
PRK14961363 DNA polymerase III subunits gamma and tau; Provisi 94.1
PRK14956484 DNA polymerase III subunits gamma and tau; Provisi 94.1
PRK12904 830 preprotein translocase subunit SecA; Reviewed 94.09
PRK14969527 DNA polymerase III subunits gamma and tau; Provisi 94.07
PRK13833323 conjugal transfer protein TrbB; Provisional 94.01
PF03354477 Terminase_1: Phage Terminase ; InterPro: IPR005021 93.98
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 93.94
KOG1596|consensus317 93.91
PRK11773 721 uvrD DNA-dependent helicase II; Provisional 93.91
PRK14721420 flhF flagellar biosynthesis regulator FlhF; Provis 93.89
PF13871278 Helicase_C_4: Helicase_C-like 93.88
PRK06645507 DNA polymerase III subunits gamma and tau; Validat 93.83
PRK14965576 DNA polymerase III subunits gamma and tau; Provisi 93.8
COG1204 766 Superfamily II helicase [General function predicti 93.79
TIGR01075 715 uvrD DNA helicase II. Designed to identify uvrD me 93.73
PRK14873665 primosome assembly protein PriA; Provisional 93.72
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 93.69
KOG0298|consensus 1394 93.67
PHA00729226 NTP-binding motif containing protein 93.67
PRK00411394 cdc6 cell division control protein 6; Reviewed 93.66
TIGR00064272 ftsY signal recognition particle-docking protein F 93.62
PRK14951618 DNA polymerase III subunits gamma and tau; Provisi 93.61
PRK08939306 primosomal protein DnaI; Reviewed 93.59
PRK14962472 DNA polymerase III subunits gamma and tau; Provisi 93.49
PF00004132 AAA: ATPase family associated with various cellula 93.44
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 93.44
PRK14959624 DNA polymerase III subunits gamma and tau; Provisi 93.42
PLN03025319 replication factor C subunit; Provisional 93.39
PRK12402337 replication factor C small subunit 2; Reviewed 93.31
PRK07940394 DNA polymerase III subunit delta'; Validated 93.29
TIGR02760 1960 TraI_TIGR conjugative transfer relaxase protein Tr 93.26
PRK08533230 flagellar accessory protein FlaH; Reviewed 93.24
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 93.19
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 93.17
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 93.13
cd00561159 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B 93.12
PRK13894319 conjugal transfer ATPase TrbB; Provisional 93.09
PRK06995484 flhF flagellar biosynthesis regulator FlhF; Valida 93.0
smart00492141 HELICc3 helicase superfamily c-terminal domain. 92.99
COG1435201 Tdk Thymidine kinase [Nucleotide transport and met 92.97
PRK11054684 helD DNA helicase IV; Provisional 92.96
PRK14957546 DNA polymerase III subunits gamma and tau; Provisi 92.94
COG0593408 DnaA ATPase involved in DNA replication initiation 92.9
PTZ001121164 origin recognition complex 1 protein; Provisional 92.89
PRK14950585 DNA polymerase III subunits gamma and tau; Provisi 92.88
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 92.88
PRK08699325 DNA polymerase III subunit delta'; Validated 92.86
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 92.86
COG3973747 Superfamily I DNA and RNA helicases [General funct 92.86
COG0470325 HolB ATPase involved in DNA replication [DNA repli 92.82
PRK14955397 DNA polymerase III subunits gamma and tau; Provisi 92.81
CHL00181287 cbbX CbbX; Provisional 92.78
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 92.75
cd03115173 SRP The signal recognition particle (SRP) mediates 92.73
PRK06964342 DNA polymerase III subunit delta'; Validated 92.69
TIGR01967 1283 DEAH_box_HrpA ATP-dependent helicase HrpA. This mo 92.67
PRK13342413 recombination factor protein RarA; Reviewed 92.65
TIGR00708173 cobA cob(I)alamin adenosyltransferase. Alternate n 92.64
PRK07471365 DNA polymerase III subunit delta'; Validated 92.58
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 92.57
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 92.5
TIGR01074664 rep ATP-dependent DNA helicase Rep. Designed to id 92.49
PF05876557 Terminase_GpA: Phage terminase large subunit (GpA) 92.45
COG1198730 PriA Primosomal protein N' (replication factor Y) 92.37
PRK06871325 DNA polymerase III subunit delta'; Validated 92.34
TIGR02928365 orc1/cdc6 family replication initiation protein. M 92.32
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 92.31
smart00491142 HELICc2 helicase superfamily c-terminal domain. 92.27
PRK14963504 DNA polymerase III subunits gamma and tau; Provisi 92.26
PTZ00293211 thymidine kinase; Provisional 92.21
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 92.17
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 92.12
PRK05986191 cob(I)alamin adenolsyltransferase/cobinamide ATP-d 92.06
KOG0701|consensus 1606 92.0
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 91.98
PHA03368738 DNA packaging terminase subunit 1; Provisional 91.93
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [P 91.91
PRK14948620 DNA polymerase III subunits gamma and tau; Provisi 91.9
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 91.88
PRK13341 725 recombination factor protein RarA/unknown domain f 91.8
TIGR02785 1232 addA_Gpos recombination helicase AddA, Firmicutes 91.77
PRK06620214 hypothetical protein; Validated 91.73
PRK05896605 DNA polymerase III subunits gamma and tau; Validat 91.73
COG1202 830 Superfamily II helicase, archaea-specific [General 91.67
PRK05973237 replicative DNA helicase; Provisional 91.58
PRK07993334 DNA polymerase III subunit delta'; Validated 91.52
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 91.5
PRK08451535 DNA polymerase III subunits gamma and tau; Validat 91.34
PRK10867433 signal recognition particle protein; Provisional 91.32
PRK10416318 signal recognition particle-docking protein FtsY; 91.31
TIGR00959428 ffh signal recognition particle protein. This mode 91.3
KOG0738|consensus491 91.24
PRK06067234 flagellar accessory protein FlaH; Validated 91.19
KOG2028|consensus554 91.16
KOG0745|consensus564 91.14
KOG0739|consensus439 91.08
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intr 90.84
TIGR02639731 ClpA ATP-dependent Clp protease ATP-binding subuni 90.82
PF03969362 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 90.73
PRK11131 1294 ATP-dependent RNA helicase HrpA; Provisional 90.67
PRK09112351 DNA polymerase III subunit delta'; Validated 90.62
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subuni 90.57
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 90.53
KOG1596|consensus317 90.53
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 90.49
PRK14954620 DNA polymerase III subunits gamma and tau; Provisi 90.38
PRK06090319 DNA polymerase III subunit delta'; Validated 90.24
KOG1133|consensus 821 90.15
PRK00440319 rfc replication factor C small subunit; Reviewed 89.77
PRK13851344 type IV secretion system protein VirB11; Provision 89.72
PRK11823446 DNA repair protein RadA; Provisional 89.66
PRK06647563 DNA polymerase III subunits gamma and tau; Validat 89.6
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 89.41
PRK14971614 DNA polymerase III subunits gamma and tau; Provisi 89.37
PRK06305451 DNA polymerase III subunits gamma and tau; Validat 89.33
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 89.28
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 89.27
PRK10865857 protein disaggregation chaperone; Provisional 89.15
KOG0734|consensus752 89.1
KOG0991|consensus333 89.08
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 89.01
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Membe 88.94
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 88.79
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 88.6
PRK14953486 DNA polymerase III subunits gamma and tau; Provisi 88.6
PRK04328249 hypothetical protein; Provisional 88.51
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 88.47
PF02572172 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase 88.41
PF02534469 T4SS-DNA_transf: Type IV secretory system Conjugat 88.32
CHL00095821 clpC Clp protease ATP binding subunit 88.28
KOG0742|consensus630 88.24
PRK13764602 ATPase; Provisional 88.18
PRK06904472 replicative DNA helicase; Validated 88.15
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 88.15
PF05729166 NACHT: NACHT domain 88.06
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 87.97
>PTZ00110 helicase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=1.7e-68  Score=615.87  Aligned_cols=412  Identities=49%  Similarity=0.783  Sum_probs=377.0

Q ss_pred             CCCCCCCCCCCCcccccccccCCCCCccCCCCChHHHHHhhhcCCeEE-ecccccccccCCCCCCCCCCCCCCcCCCCCH
Q psy17912         59 SNSNLRTPNWNSMSMEQINKNLYTPNHLTVSRSQGEVESYLNHHDVTV-KGRYYLLRLESRPGKCVPRPIQHFEECNFPP  137 (779)
Q Consensus        59 ~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~i~~-~g~~~~~~~~~~~~~~~p~pi~~f~~~~l~~  137 (779)
                      .+..+...+|+....++++++||.+++.+..++.++++.++....+.+ .|..            .|+|+.+|+++++++
T Consensus        72 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~g~~------------~p~p~~~f~~~~l~~  139 (545)
T PTZ00110         72 LGKRLQPIDWKSINLVPFEKNFYKEHPEVSALSSKEVDEIRKEKEITIIAGEN------------VPKPVVSFEYTSFPD  139 (545)
T ss_pred             cccccCCCCCccccccchhhhcccCChhhhcCCHHHHHHHHHhcCcEEecCCC------------CCcccCCHhhcCCCH
Confidence            345677899999999999999999999999999999999999888876 4544            899999999999999


Q ss_pred             HHHHHHHHcCCCCCCHHHHHHHHHHhcCCCEEEEccCCCChhHHHHHHHHHHHhccCCCCCCCCCEEEEEccCHHHHHHH
Q psy17912        138 YIMKKIYEMGFQAPTAIQAQGWPIALSGCDLVAIAKTGSGKTLGYIAPAIVHVNSQRPLRSGEGPIVLVLAPTRELAQQI  217 (779)
Q Consensus       138 ~l~~~l~~~g~~~p~~~Q~~~i~~il~g~dvii~apTGsGKTl~~~lp~l~~l~~~~~~~~~~~~~vLil~Ptr~La~Q~  217 (779)
                      .+++.|.++||.+|||+|.++||.+++|+|+|++||||||||++|++|++.++..++......+|.+|||+||++||.|+
T Consensus       140 ~l~~~l~~~g~~~pt~iQ~~aip~~l~G~dvI~~ApTGSGKTlaylLP~l~~i~~~~~~~~~~gp~~LIL~PTreLa~Qi  219 (545)
T PTZ00110        140 YILKSLKNAGFTEPTPIQVQGWPIALSGRDMIGIAETGSGKTLAFLLPAIVHINAQPLLRYGDGPIVLVLAPTRELAEQI  219 (545)
T ss_pred             HHHHHHHHCCCCCCCHHHHHHHHHHhcCCCEEEEeCCCChHHHHHHHHHHHHHHhcccccCCCCcEEEEECChHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999998876555556689999999999999999


Q ss_pred             HHHHHHhcccCCceEEEEeCCCCChhhHHHhhcCCeEEEeChHHHHHHHHcCCcCCCCeeEEEEccchhhhcCCchHHHH
Q psy17912        218 ETVANDFGSATATRVACVFGGAPKGPQVKALQTGAEIVIATPGRLIDYLEQGTINLHRTSYLVLDEADRMLDMGFEPQIR  297 (779)
Q Consensus       218 ~~~~~~~~~~~~l~v~~~~gg~~~~~~~~~l~~~~~IiV~Tpe~Ll~~l~~~~~~l~~i~~lViDEaH~l~~~~f~~~l~  297 (779)
                      .+.+.+++...++++.+++|+.+...+...+..+++|+|+||++|++++......++++++|||||||+|++++|...+.
T Consensus       220 ~~~~~~~~~~~~i~~~~~~gg~~~~~q~~~l~~~~~IlVaTPgrL~d~l~~~~~~l~~v~~lViDEAd~mld~gf~~~i~  299 (545)
T PTZ00110        220 REQCNKFGASSKIRNTVAYGGVPKRGQIYALRRGVEILIACPGRLIDFLESNVTNLRRVTYLVLDEADRMLDMGFEPQIR  299 (545)
T ss_pred             HHHHHHHhcccCccEEEEeCCCCHHHHHHHHHcCCCEEEECHHHHHHHHHcCCCChhhCcEEEeehHHhhhhcchHHHHH
Confidence            99999999988999999999999888888888899999999999999998888889999999999999999999999999


Q ss_pred             HHHhhcCCCCceEEeeccccHHHHHHHHHhcc-CcEEEecCCCCCCCccceEEEEEeccccchhHHHHHHHHHhccCCCC
Q psy17912        298 KIIGQIRPDRQVLMWSATWPKEVQKLAEDFLV-DYVQLNIGSLNPTANHNIVQIVDVCQEHEKDYKLQGLLSQIGSERTS  376 (779)
Q Consensus       298 ~il~~l~~~~qilllSAT~~~~v~~l~~~~l~-~~~~i~i~~~~~~~~~~i~~~~~~~~~~~k~~~L~~ll~~i~~~~~~  376 (779)
                      +++..+++++|++++|||+|.+++.++..++. +++.+.++........++.+.+..+....|...|..++..+.. ...
T Consensus       300 ~il~~~~~~~q~l~~SAT~p~~v~~l~~~l~~~~~v~i~vg~~~l~~~~~i~q~~~~~~~~~k~~~L~~ll~~~~~-~~~  378 (545)
T PTZ00110        300 KIVSQIRPDRQTLMWSATWPKEVQSLARDLCKEEPVHVNVGSLDLTACHNIKQEVFVVEEHEKRGKLKMLLQRIMR-DGD  378 (545)
T ss_pred             HHHHhCCCCCeEEEEEeCCCHHHHHHHHHHhccCCEEEEECCCccccCCCeeEEEEEEechhHHHHHHHHHHHhcc-cCC
Confidence            99999999999999999999999999998886 5788877766655667788888888888888889888887643 568


Q ss_pred             cEEEEecchhHHHHHHHHHHhCCCeEEEEcCCCCHHHHHHHHHHHhcCCCcEEEEecccccccccCcccccccccceeEE
Q psy17912        377 KTIIFVETKRKADDITRSVRNKGWAAVAIHGNKSQQERDRVLNEFRIGRASILVSQYNKSQQERDRVLNEFRIGRASILV  456 (779)
Q Consensus       377 kvLVF~~s~~~ae~L~~~L~~~g~~v~~ihg~~~~~eR~~il~~F~~G~~~ILVAT~v~~~GIDip~v~~~~~~~~~~~V  456 (779)
                      ++||||++++.|+.|+..|...++.+..+||++++.+|..+++.|++|+.+|||||+++++|||+|+|+         +|
T Consensus       379 k~LIF~~t~~~a~~l~~~L~~~g~~~~~ihg~~~~~eR~~il~~F~~G~~~ILVaTdv~~rGIDi~~v~---------~V  449 (545)
T PTZ00110        379 KILIFVETKKGADFLTKELRLDGWPALCIHGDKKQEERTWVLNEFKTGKSPIMIATDVASRGLDVKDVK---------YV  449 (545)
T ss_pred             eEEEEecChHHHHHHHHHHHHcCCcEEEEECCCcHHHHHHHHHHHhcCCCcEEEEcchhhcCCCcccCC---------EE
Confidence            999999999999999999999999999999999999999999999999999999999999999999999         99


Q ss_pred             EEcCCCCCHHHHHHHhccCCCCCCeEEEEEcChHHH
Q psy17912        457 SQYKESQQKRDRVLNEFRIGRASILVSHYNKSQQER  492 (779)
Q Consensus       457 I~y~~p~s~~~yiQR~GRaGR~g~~~~~~~~~~~e~  492 (779)
                      |+|++|.++++|+||+||+||+|..+.+++...++.
T Consensus       450 I~~d~P~s~~~yvqRiGRtGR~G~~G~ai~~~~~~~  485 (545)
T PTZ00110        450 INFDFPNQIEDYVHRIGRTGRAGAKGASYTFLTPDK  485 (545)
T ss_pred             EEeCCCCCHHHHHHHhcccccCCCCceEEEEECcch
Confidence            999999999999999999999998876665544433

>KOG0331|consensus Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0329|consensus Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>KOG0353|consensus Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>KOG0948|consensus Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>KOG0950|consensus Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0922|consensus Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0920|consensus Back     alignment and domain information
>KOG0923|consensus Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0924|consensus Back     alignment and domain information
>KOG0385|consensus Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0926|consensus Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG0949|consensus Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0925|consensus Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>KOG4150|consensus Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK12903 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>CHL00122 secA preprotein translocase subunit SecA; Validated Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>PRK12902 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0389|consensus Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>KOG0953|consensus Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] Back     alignment and domain information
>TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>KOG2340|consensus Back     alignment and domain information
>PRK12901 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>KOG0921|consensus Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein Back     alignment and domain information
>KOG0339|consensus Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG0333|consensus Back     alignment and domain information
>COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>KOG0328|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>KOG0341|consensus Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>KOG0336|consensus Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>KOG0338|consensus Back     alignment and domain information
>COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>TIGR00596 rad1 DNA repair protein (rad1) Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>KOG0340|consensus Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>KOG0327|consensus Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>KOG0326|consensus Back     alignment and domain information
>KOG0332|consensus Back     alignment and domain information
>KOG0342|consensus Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>KOG1132|consensus Back     alignment and domain information
>KOG0351|consensus Back     alignment and domain information
>KOG0343|consensus Back     alignment and domain information
>PF13307 Helicase_C_2: Helicase C-terminal domain; PDB: 4A15_A 2VSF_A 3CRV_A 3CRW_1 2VL7_A Back     alignment and domain information
>COG3587 Restriction endonuclease [Defense mechanisms] Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>KOG1805|consensus Back     alignment and domain information
>PRK13889 conjugal transfer relaxase TraA; Provisional Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK13826 Dtr system oriT relaxase; Provisional Back     alignment and domain information
>KOG0347|consensus Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>COG3421 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG4284|consensus Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK11664 ATP-dependent RNA helicase HrpB; Provisional Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF13966 zf-RVT: zinc-binding in reverse transcriptase Back     alignment and domain information
>KOG0346|consensus Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>KOG0337|consensus Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF00271 Helicase_C: Helicase conserved C-terminal domain; InterPro: IPR001650 The domain, which defines this group of proteins is found in a wide variety of helicases and helicase related proteins Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>cd00079 HELICc Helicase superfamily c-terminal domain; associated with DEXDc-, DEAD-, and DEAH-box proteins, yeast initiation factor 4A, Ski2p, and Hepatitis C virus NS3 helicases; this domain is found in a wide variety of helicases and helicase related proteins; may not be an autonomously folding unit, but an integral part of the helicase; 4 helicase superfamilies at present according to the organization of their signature motifs; all helicases share the ability to unwind nucleic acid duplexes with a distinct directional polarity; they utilize the free energy from nucleoside triphosphate hydrolysis to fuel their translocation along DNA, unwinding the duplex in the process Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>KOG3973|consensus Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PRK13107 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PHA02533 17 large terminase protein; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0349|consensus Back     alignment and domain information
>PRK14712 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>smart00490 HELICc helicase superfamily c-terminal domain Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PHA03333 putative ATPase subunit of terminase; Provisional Back     alignment and domain information
>KOG0344|consensus Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13709 conjugal transfer nickase/helicase TraI; Provisional Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12900 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>KOG0352|consensus Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1596|consensus Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF13871 Helicase_C_4: Helicase_C-like Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP Back     alignment and domain information
>PRK13894 conjugal transfer ATPase TrbB; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>smart00492 HELICc3 helicase superfamily c-terminal domain Back     alignment and domain information
>COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>PRK08699 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>COG3973 Superfamily I DNA and RNA helicases [General function prediction only] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>TIGR00708 cobA cob(I)alamin adenosyltransferase Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep Back     alignment and domain information
>PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>smart00491 HELICc2 helicase superfamily c-terminal domain Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00293 thymidine kinase; Provisional Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated Back     alignment and domain information
>KOG0701|consensus Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>PHA03368 DNA packaging terminase subunit 1; Provisional Back     alignment and domain information
>COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>KOG0738|consensus Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>KOG2028|consensus Back     alignment and domain information
>KOG0745|consensus Back     alignment and domain information
>KOG0739|consensus Back     alignment and domain information
>COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP Back     alignment and domain information
>PRK11131 ATP-dependent RNA helicase HrpA; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>KOG1596|consensus Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG1133|consensus Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK13851 type IV secretion system protein VirB11; Provisional Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>KOG0991|consensus Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 Back     alignment and domain information
>PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>KOG0742|consensus Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>PRK06904 replicative DNA helicase; Validated Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query779
4a4d_A253 Crystal Structure Of The N-Terminal Domain Of The H 1e-87
3fe2_A242 Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D 5e-87
2i4i_A417 Crystal Structure Of Human Dead-Box Rna Helicase Dd 2e-62
2db3_A434 Structural Basis For Rna Unwinding By The Dead-Box 3e-55
3iuy_A228 Crystal Structure Of Ddx53 Dead-Box Domain Length = 2e-49
1wrb_A253 Crystal Structure Of The N-Terminal Reca-Like Domai 8e-49
1hv8_A367 Crystal Structure Of A Dead Box Protein From The Hy 4e-44
2gxq_A207 Hera N-Terminal Domain In Complex With Amp, Crystal 1e-38
2zu6_A388 Crystal Structure Of The Eif4a-Pdcd4 Complex Length 2e-38
3eiq_A414 Crystal Structure Of Pdcd4-eif4a Length = 414 3e-38
3mwj_A207 Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap 3e-38
2vso_A395 Crystal Structure Of A Translation Initiation Compl 1e-37
2z0m_A337 Crystal Structure Of Hypothetical Atp-Dependent Rna 4e-36
2j0q_A410 The Crystal Structure Of The Exon Junction Complex 6e-36
2j0u_A374 The Crystal Structure Of Eif4aiii-Barentsz Complex 6e-36
2hyi_C413 Structure Of The Human Exon Junction Complex With A 6e-36
2xb2_A411 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 6e-36
2j0u_B374 The Crystal Structure Of Eif4aiii-Barentsz Complex 7e-36
2hxy_A391 Crystal Structure Of Human Apo-Eif4aiii Length = 39 7e-36
1fuu_A394 Yeast Initiation Factor 4a Length = 394 1e-35
1s2m_A400 Crystal Structure Of The Dead Box Protein Dhh1p Len 2e-34
3ber_A249 Human Dead-Box Rna-Helicase Ddx47, Conserved Domain 2e-32
3pey_A395 S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length 1e-31
3pew_A395 S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 2e-31
3ly5_A262 Ddx18 Dead-Domain Length = 262 5e-30
1xtk_A390 Structure Of Decd To Dead Mutation Of Human Uap56 L 8e-28
3fho_B508 Structure Of S. Pombe Dbp5 Length = 508 1e-27
1xti_A391 Structure Of Wildtype Human Uap56 Length = 391 3e-27
1xtj_A386 Structure Of Human Uap56 In Complex With Adp Length 4e-27
1vec_A206 Crystal Structure Of The N-Terminal Domain Of RckP5 2e-26
3bor_A237 Crystal Structure Of The Deadc Domain Of Human Tran 2e-25
2pl3_A236 Human Dead-Box Rna Helicase Ddx10, Dead Domain In C 3e-25
2g9n_A221 Structure Of The Dead Domain Of Human Eukaryotic In 4e-25
1qva_A223 Yeast Initiation Factor 4a N-Terminal Domain Length 8e-24
1qde_A224 Crystal Structure Of The Atpase Domain Of Translati 9e-24
3sqw_A579 Structure Of Mss116p (Nte Deletion) Bound To Ssrna 9e-24
3i5x_A563 Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len 2e-23
1q0u_A219 Crystal Structure Of The Bstdead N-Terminal Domain 2e-23
3sqx_A512 Structure Of Mss116p (Nte And C-Tail Double Deletio 4e-23
3g0h_A424 Human Dead-box Rna Helicase Ddx19, In Complex With 1e-22
3ews_A445 Human Dead-Box Rna-Helicase Ddx19 In Complex With A 1e-22
3fht_A412 Crystal Structure Of Human Dbp5 In Complex With Amp 2e-22
3fmp_B479 Crystal Structure Of The Nucleoporin Nup214 In Comp 2e-22
3dkp_A245 Human Dead-Box Rna-Helicase Ddx52, Conserved Domain 7e-20
2kbe_A226 Solution Structure Of Amino-Terminal Domain Of Dbp5 2e-19
1t6n_A220 Crystal Structure Of The N-Terminal Domain Of Human 4e-19
2oxc_A230 Human Dead-Box Rna Helicase Ddx20, Dead Domain In C 2e-17
3fmo_B300 Crystal Structure Of The Nucleoporin Nup214 In Comp 4e-15
3fhc_B235 Crystal Structure Of Human Dbp5 In Complex With Nup 7e-15
2jgn_A185 Ddx3 Helicase Domain Length = 185 2e-10
1fuk_A165 Crystal Structure Of The Carboxy Terminal Domain Of 8e-09
3gfp_A189 Structure Of The C-Terminal Domain Of The Dead-Box 3e-06
2kbf_A187 Solution Structure Of Carboxyl-Terminal Domain Of D 5e-06
3peu_A188 S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To 6e-06
2p6n_A191 Human Dead-box Rna Helicase Ddx41, Helicase Domain 1e-05
3i32_A300 Dimeric Structure Of A Hera Helicase Fragment Inclu 8e-05
3eaq_A212 Novel Dimerization Motif In The Dead Box Rna Helica 3e-04
>pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 Back     alignment and structure 
Iteration: 1

 Score =  320 bits (821), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 154/264 (58%), Positives = 190/264 (71%), Gaps = 12/264 (4%)
Query: 75  QINKNLYTPNHLTVSRSQGEVESYLNHHDVTVKGRYYLLRLESRPGKCVPRPIQHFEECN 134
           +  KN Y  +     R+  EVE+Y    ++TV+G             C P+P+ +F E N
Sbjct: 2   KFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGH-----------NC-PKPVLNFYEAN 49
Query: 135 FPPYIMKKIYEMGFQAPTAIQAQGWPIALSGCDLVAIAKTGSGKTLGYIAPAIVHVNSQR 194
           FP  +M  I    F  PTAIQAQGWP+ALSG D+V +A+TGSGKTL Y+ PAIVH+N Q 
Sbjct: 50  FPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQP 109
Query: 195 PLRSGEGPIVLVLAPTRELAQQIETVANDFGSATATRVACVFGGAPKGPQVKALQTGAEI 254
            L  G+GPI LVLAPTRELAQQ++ VA ++  A   +  C++GGAPKGPQ++ L+ G EI
Sbjct: 110 FLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEI 169
Query: 255 VIATPGRLIDYLEQGTINLHRTSYLVLDEADRMLDMGFEPQIRKIIGQIRPDRQVLMWSA 314
            IATPGRLID+LE G  NL RT+YLVLDEADRMLDMGFEPQIRKI+ QIRPDRQ LMWSA
Sbjct: 170 CIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSA 229
Query: 315 TWPKEVQKLAEDFLVDYVQLNIGS 338
           TWPKEV++LAEDFL DY+ +NIG+
Sbjct: 230 TWPKEVRQLAEDFLKDYIHINIGA 253
>pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 Back     alignment and structure
>pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 Back     alignment and structure
>pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 Back     alignment and structure
>pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 Back     alignment and structure
>pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 Back     alignment and structure
>pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 Back     alignment and structure
>pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 Back     alignment and structure
>pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 Back     alignment and structure
>pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 Back     alignment and structure
>pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 Back     alignment and structure
>pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 Back     alignment and structure
>pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 Back     alignment and structure
>pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 Back     alignment and structure
>pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 Back     alignment and structure
>pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 Back     alignment and structure
>pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 Back     alignment and structure
>pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 Back     alignment and structure
>pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 Back     alignment and structure
>pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 Back     alignment and structure
>pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 Back     alignment and structure
>pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 Back     alignment and structure
>pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 Back     alignment and structure
>pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 Back     alignment and structure
>pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 Back     alignment and structure
>pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 Back     alignment and structure
>pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 Back     alignment and structure
>pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 Back     alignment and structure
>pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 Back     alignment and structure
>pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 Back     alignment and structure
>pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 Back     alignment and structure
>pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 Back     alignment and structure
>pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 Back     alignment and structure
>pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 Back     alignment and structure
>pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 Back     alignment and structure
>pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 Back     alignment and structure
>pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 Back     alignment and structure
>pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 Back     alignment and structure
>pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 Back     alignment and structure
>pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 Back     alignment and structure
>pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 Back     alignment and structure
>pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 Back     alignment and structure
>pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 Back     alignment and structure
>pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 Back     alignment and structure
>pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 Back     alignment and structure
>pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 Back     alignment and structure
>pdb|2JGN|A Chain A, Ddx3 Helicase Domain Length = 185 Back     alignment and structure
>pdb|1FUK|A Chain A, Crystal Structure Of The Carboxy Terminal Domain Of Yeast Eif4a Length = 165 Back     alignment and structure
>pdb|3GFP|A Chain A, Structure Of The C-Terminal Domain Of The Dead-Box Protein Dbp5 Length = 189 Back     alignment and structure
>pdb|2KBF|A Chain A, Solution Structure Of Carboxyl-Terminal Domain Of Dbp5p Length = 187 Back     alignment and structure
>pdb|3PEU|A Chain A, S. Cerevisiae Dbp5 L327v C-Terminal Domain Bound To Gle1 H337r And Ip6 Length = 188 Back     alignment and structure
>pdb|2P6N|A Chain A, Human Dead-box Rna Helicase Ddx41, Helicase Domain Length = 191 Back     alignment and structure
>pdb|3I32|A Chain A, Dimeric Structure Of A Hera Helicase Fragment Including The C-Terminal Reca Domain, The Dimerization Domain, And The Rna Binding Domain Length = 300 Back     alignment and structure
>pdb|3EAQ|A Chain A, Novel Dimerization Motif In The Dead Box Rna Helicase Hera Form 2, Complete Dimer, Symmetric Length = 212 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query779
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 100.0
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 100.0
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 100.0
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 100.0
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 100.0
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 100.0
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 100.0
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 100.0
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 100.0
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 100.0
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 100.0
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 100.0
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 100.0
2v1x_A591 ATP-dependent DNA helicase Q1; DNA strand annealin 100.0
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 100.0
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 100.0
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 100.0
2va8_A715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 100.0
2zj8_A720 DNA helicase, putative SKI2-type helicase; RECA fo 100.0
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 100.0
2p6r_A702 Afuhel308 helicase; protein-DNA complex, SF2 helic 100.0
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 100.0
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 100.0
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 100.0
1tf5_A844 Preprotein translocase SECA subunit; ATPase, helic 100.0
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 100.0
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 100.0
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 100.0
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 100.0
4gl2_A699 Interferon-induced helicase C domain-containing P; 100.0
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 100.0
2fsf_A853 Preprotein translocase SECA subunit; ATPase, DNA-R 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 100.0
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 100.0
1nkt_A922 Preprotein translocase SECA 1 subunit; preprotein 100.0
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 100.0
2eyq_A1151 TRCF, transcription-repair coupling factor; MFD, S 100.0
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 100.0
2xau_A773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 100.0
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 100.0
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 100.0
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 100.0
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 100.0
1yks_A440 Genome polyprotein [contains: flavivirin protease 100.0
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 100.0
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 100.0
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 100.0
3bor_A237 Human initiation factor 4A-II; translation initiat 100.0
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 100.0
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 100.0
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 100.0
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 100.0
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 100.0
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 100.0
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 100.0
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 100.0
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 100.0
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 100.0
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 100.0
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 99.98
3rc3_A677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 99.98
3h1t_A590 Type I site-specific restriction-modification syst 99.98
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.98
3dmq_A968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.97
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.97
3jux_A822 Protein translocase subunit SECA; protein transloc 99.97
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 99.96
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.96
2w00_A1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 99.95
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 99.93
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 99.92
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 99.9
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 99.88
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 99.88
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.87
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 99.87
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 99.87
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 99.86
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 99.86
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 99.85
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 99.83
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 99.83
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.82
2vl7_A540 XPD; helicase, unknown function; 2.25A {Sulfolobus 99.81
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 99.69
3crv_A551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 99.78
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.71
4a15_A620 XPD helicase, ATP-dependent DNA helicase TA0057; h 99.66
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 99.56
2db3_A434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 98.88
1oyw_A523 RECQ helicase, ATP-dependent DNA helicase; winged 98.83
1w36_D608 RECD, exodeoxyribonuclease V alpha chain; recombin 98.63
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 98.62
1xti_A391 Probable ATP-dependent RNA helicase P47; alpha-bet 98.55
2i4i_A417 ATP-dependent RNA helicase DDX3X; DEAD, structural 98.51
2j0s_A410 ATP-dependent RNA helicase DDX48; mRNA processing, 98.47
1gm5_A780 RECG; helicase, replication restart; HET: DNA ADP; 98.4
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 98.39
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 98.39
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 98.29
3oiy_A414 Reverse gyrase helicase domain; topoisomerase, DNA 98.27
3eiq_A414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 98.23
3i5x_A563 ATP-dependent RNA helicase MSS116; protein-RNA com 98.23
1s2m_A400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 98.2
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 98.19
3fht_A412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 98.13
1fuu_A394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 98.13
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 98.07
1wp9_A494 ATP-dependent RNA helicase, putative; ATPase, DNA 98.05
3fmp_B479 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.03
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 98.01
4a2p_A556 RIG-I, retinoic acid inducible protein I; hydrolas 97.95
2jgn_A185 DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp 97.91
3tbk_A555 RIG-I helicase domain; DECH helicase, ATP binding, 97.91
4b3f_X646 DNA-binding protein smubp-2; hydrolase, helicase; 97.91
4a2q_A797 RIG-I, retinoic acid inducible protein I; hydrolas 97.87
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 97.87
2hjv_A163 ATP-dependent RNA helicase DBPA; parallel alpha-be 97.85
1t5i_A172 C_terminal domain of A probable ATP-dependent RNA 97.84
2gk6_A624 Regulator of nonsense transcripts 1; UPF1, helicas 97.84
2p6n_A191 ATP-dependent RNA helicase DDX41; DEAD, structural 97.84
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 97.83
3upu_A459 ATP-dependent DNA helicase DDA; RECA-like domain, 97.82
1fuk_A165 Eukaryotic initiation factor 4A; helicase, DEAD-bo 97.79
2ykg_A696 Probable ATP-dependent RNA helicase DDX58; hydrola 97.77
4gl2_A699 Interferon-induced helicase C domain-containing P; 97.76
2xzl_A802 ATP-dependent helicase NAM7; hydrolase-RNA complex 97.76
3fho_A508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 97.73
2oca_A510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 97.72
3lfu_A647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 97.71
3eaq_A212 Heat resistant RNA dependent ATPase; DEAD box RNA 97.7
2rb4_A175 ATP-dependent RNA helicase DDX25; rossmann fold, s 97.69
2wjy_A800 Regulator of nonsense transcripts 1; nonsense medi 97.68
4a2w_A936 RIG-I, retinoic acid inducible protein I; hydrolas 97.66
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 97.65
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 97.6
3i32_A300 Heat resistant RNA dependent ATPase; RNA helicase, 97.57
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 97.48
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 97.38
2yjt_D170 ATP-dependent RNA helicase SRMB, regulator of ribo 96.48
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 97.06
2d7d_A661 Uvrabc system protein B; helicase, protein-DNA-ADP 97.05
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 96.98
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 96.96
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 96.88
1c4o_A664 DNA nucleotide excision repair enzyme UVRB; uvrabc 96.87
1z5z_A271 Helicase of the SNF2/RAD54 family; hydrolase, reco 96.85
3h1t_A590 Type I site-specific restriction-modification syst 96.76
3o8b_A666 HCV NS3 protease/helicase; ntpase, RNA, translocat 96.71
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 96.67
2v6i_A431 RNA helicase; membrane, hydrolase, transmembrane, 96.64
2fwr_A472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 96.63
2o0j_A385 Terminase, DNA packaging protein GP17; nucleotide- 96.42
3hgt_A328 HDA1 complex subunit 3; RECA-like domain, SWI2/SNF 96.41
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 96.39
3cpe_A592 Terminase, DNA packaging protein GP17; large termi 96.31
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.22
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 96.22
1z3i_X644 Similar to RAD54-like; recombination ATPase helica 96.17
3jux_A 822 Protein translocase subunit SECA; protein transloc 96.1
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.1
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 96.09
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 95.91
3vkw_A446 Replicase large subunit; alpha/beta domain, helica 95.75
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 95.6
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 95.55
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 95.32
1yks_A440 Genome polyprotein [contains: flavivirin protease 95.25
1z63_A500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 95.24
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 95.16
2kjq_A149 DNAA-related protein; solution structure, NESG, st 95.04
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 94.96
2zpa_A671 Uncharacterized protein YPFI; RNA modification enz 94.9
3bos_A242 Putative DNA replication factor; P-loop containing 94.87
2whx_A618 Serine protease/ntpase/helicase NS3; transcription 94.81
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 94.78
2z4s_A440 Chromosomal replication initiator protein DNAA; AA 94.73
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 94.72
2wv9_A673 Flavivirin protease NS2B regulatory subunit, FLAV 94.72
2v1u_A387 Cell division control protein 6 homolog; DNA repli 94.63
3u61_B324 DNA polymerase accessory protein 44; AAA+, ATP hyd 94.51
2z83_A459 Helicase/nucleoside triphosphatase; hydrolase, mem 94.49
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 94.46
1a5t_A334 Delta prime, HOLB; zinc finger, DNA replication; 2 94.31
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 94.3
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 94.29
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 94.22
2jlq_A451 Serine protease subunit NS3; ribonucleoprotein, nu 94.14
2chg_A226 Replication factor C small subunit; DNA-binding pr 94.11
3mwy_W800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 94.0
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 93.94
2qgz_A308 Helicase loader, putative primosome component; str 93.72
1uaa_A673 REP helicase, protein (ATP-dependent DNA helicase 93.7
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 93.59
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; 93.53
1fnn_A389 CDC6P, cell division control protein 6; ORC1, AAA 93.51
2qby_B384 CDC6 homolog 3, cell division control protein 6 ho 93.47
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 93.42
1pjr_A724 PCRA; DNA repair, DNA replication, SOS response, h 92.95
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 92.79
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 92.77
1jr3_A373 DNA polymerase III subunit gamma; processivity, pr 92.49
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 92.46
2qby_A386 CDC6 homolog 1, cell division control protein 6 ho 92.4
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 92.38
3u4q_A 1232 ATP-dependent helicase/nuclease subunit A; helicas 92.22
1g5t_A196 COB(I)alamin adenosyltransferase; P-loop protein, 92.08
1sxj_A516 Activator 1 95 kDa subunit; clamp loader, processi 91.81
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 91.47
1hqc_A324 RUVB; extended AAA-ATPase domain, complex with nuc 90.92
1iqp_A327 RFCS; clamp loader, extended AAA-ATPase domain, co 90.89
2gno_A305 DNA polymerase III, gamma subunit-related protein; 90.77
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 90.51
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 90.07
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 90.02
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 89.57
1sxj_C340 Activator 1 40 kDa subunit; clamp loader, processi 89.25
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 89.08
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 89.04
2chq_A319 Replication factor C small subunit; DNA-binding pr 88.42
2l82_A162 Designed protein OR32; structural genomics, northe 88.35
1sxj_D353 Activator 1 41 kDa subunit; clamp loader, processi 87.37
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 86.8
3pvs_A447 Replication-associated recombination protein A; ma 86.63
2r6a_A454 DNAB helicase, replicative helicase; replication, 86.46
1w5s_A412 Origin recognition complex subunit 2 ORC2; replica 86.45
1sxj_B323 Activator 1 37 kDa subunit; clamp loader, processi 86.41
2fna_A357 Conserved hypothetical protein; structural genomic 86.35
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 86.03
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 85.45
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 85.03
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 83.69
1vma_A306 Cell division protein FTSY; TM0570, structural gen 83.36
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 83.19
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 83.14
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 82.68
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 82.31
3cmu_A2050 Protein RECA, recombinase A; homologous recombinat 82.22
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 81.83
4a74_A231 DNA repair and recombination protein RADA; hydrola 81.73
3co5_A143 Putative two-component system transcriptional RES 81.17
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 80.94
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 80.72
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 80.22
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 80.16
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=1.8e-58  Score=521.86  Aligned_cols=352  Identities=35%  Similarity=0.558  Sum_probs=323.4

Q ss_pred             CCCCCCCCcCCCCCHHHHHHHHHcCCCCCCHHHHHHHHHHhcCCCEEEEccCCCChhHHHHHHHHHHHhccCCCCCCCCC
Q psy17912        123 VPRPIQHFEECNFPPYIMKKIYEMGFQAPTAIQAQGWPIALSGCDLVAIAKTGSGKTLGYIAPAIVHVNSQRPLRSGEGP  202 (779)
Q Consensus       123 ~p~pi~~f~~~~l~~~l~~~l~~~g~~~p~~~Q~~~i~~il~g~dvii~apTGsGKTl~~~lp~l~~l~~~~~~~~~~~~  202 (779)
                      .|.|+.+|++++|++.+++.+.++||.+|+|+|+++||.+++|+|++++||||||||++|++|++.++...+......++
T Consensus        51 ~p~~~~~f~~~~l~~~l~~~l~~~g~~~pt~iQ~~ai~~i~~g~d~i~~a~TGsGKT~a~~lpil~~l~~~~~~~~~~~~  130 (434)
T 2db3_A           51 VPQPIQHFTSADLRDIIIDNVNKSGYKIPTPIQKCSIPVISSGRDLMACAQTGSGKTAAFLLPILSKLLEDPHELELGRP  130 (434)
T ss_dssp             CCCCCCCGGGSCCCHHHHHHHHHTTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHHHHHSCCCCCTTCC
T ss_pred             CCCCcCChhhcCCCHHHHHHHHHcCCCCCCHHHHHHHHHHhcCCCEEEECCCCCCchHHHHHHHHHHHHhcccccccCCc
Confidence            88999999999999999999999999999999999999999999999999999999999999999998876543445578


Q ss_pred             EEEEEccCHHHHHHHHHHHHHhcccCCceEEEEeCCCCChhhHHHhhcCCeEEEeChHHHHHHHHcCCcCCCCeeEEEEc
Q psy17912        203 IVLVLAPTRELAQQIETVANDFGSATATRVACVFGGAPKGPQVKALQTGAEIVIATPGRLIDYLEQGTINLHRTSYLVLD  282 (779)
Q Consensus       203 ~vLil~Ptr~La~Q~~~~~~~~~~~~~l~v~~~~gg~~~~~~~~~l~~~~~IiV~Tpe~Ll~~l~~~~~~l~~i~~lViD  282 (779)
                      ++||++||++||.|+++.+++++...++++.+++|+.....+...+..+++|+|+||++|++++......+.++++||||
T Consensus       131 ~~lil~PtreLa~Q~~~~~~~~~~~~~~~~~~~~gg~~~~~~~~~l~~~~~Ivv~Tp~~l~~~l~~~~~~l~~~~~lVlD  210 (434)
T 2db3_A          131 QVVIVSPTRELAIQIFNEARKFAFESYLKIGIVYGGTSFRHQNECITRGCHVVIATPGRLLDFVDRTFITFEDTRFVVLD  210 (434)
T ss_dssp             SEEEECSSHHHHHHHHHHHHHHTTTSSCCCCEECTTSCHHHHHHHHTTCCSEEEECHHHHHHHHHTTSCCCTTCCEEEEE
T ss_pred             cEEEEecCHHHHHHHHHHHHHHhccCCcEEEEEECCCCHHHHHHHhhcCCCEEEEChHHHHHHHHhCCcccccCCeEEEc
Confidence            99999999999999999999999888999999999999888888888889999999999999998888889999999999


Q ss_pred             cchhhhcCCchHHHHHHHhhc--CCCCceEEeeccccHHHHHHHHHhccCcEEEecCCCCCCCccceEEEEEeccccchh
Q psy17912        283 EADRMLDMGFEPQIRKIIGQI--RPDRQVLMWSATWPKEVQKLAEDFLVDYVQLNIGSLNPTANHNIVQIVDVCQEHEKD  360 (779)
Q Consensus       283 EaH~l~~~~f~~~l~~il~~l--~~~~qilllSAT~~~~v~~l~~~~l~~~~~i~i~~~~~~~~~~i~~~~~~~~~~~k~  360 (779)
                      |||+|++++|...+..++..+  +++.|+++||||+|+.++.++..++.++..+.++... .....+.+.+..+....|.
T Consensus       211 Eah~~~~~gf~~~~~~i~~~~~~~~~~q~l~~SAT~~~~~~~~~~~~l~~~~~i~~~~~~-~~~~~i~~~~~~~~~~~k~  289 (434)
T 2db3_A          211 EADRMLDMGFSEDMRRIMTHVTMRPEHQTLMFSATFPEEIQRMAGEFLKNYVFVAIGIVG-GACSDVKQTIYEVNKYAKR  289 (434)
T ss_dssp             THHHHTSTTTHHHHHHHHHCTTSCSSCEEEEEESCCCHHHHHHHHTTCSSCEEEEESSTT-CCCTTEEEEEEECCGGGHH
T ss_pred             cHhhhhccCcHHHHHHHHHhcCCCCCceEEEEeccCCHHHHHHHHHhccCCEEEEecccc-ccccccceEEEEeCcHHHH
Confidence            999999999999999999875  6789999999999999999999999999988887655 3455677777778777888


Q ss_pred             HHHHHHHHHhccCCCCcEEEEecchhHHHHHHHHHHhCCCeEEEEcCCCCHHHHHHHHHHHhcCCCcEEEEecccccccc
Q psy17912        361 YKLQGLLSQIGSERTSKTIIFVETKRKADDITRSVRNKGWAAVAIHGNKSQQERDRVLNEFRIGRASILVSQYNKSQQER  440 (779)
Q Consensus       361 ~~L~~ll~~i~~~~~~kvLVF~~s~~~ae~L~~~L~~~g~~v~~ihg~~~~~eR~~il~~F~~G~~~ILVAT~v~~~GID  440 (779)
                      ..|.+++...    ..++||||++++.|+.+++.|...++.+..+||++++.+|..+++.|++|+.+|||||+++++|||
T Consensus       290 ~~l~~~l~~~----~~~~lVF~~t~~~a~~l~~~L~~~~~~~~~lhg~~~~~~R~~~l~~F~~g~~~vLvaT~v~~rGlD  365 (434)
T 2db3_A          290 SKLIEILSEQ----ADGTIVFVETKRGADFLASFLSEKEFPTTSIHGDRLQSQREQALRDFKNGSMKVLIATSVASRGLD  365 (434)
T ss_dssp             HHHHHHHHHC----CTTEEEECSSHHHHHHHHHHHHHTTCCEEEESTTSCHHHHHHHHHHHHTSSCSEEEECGGGTSSCC
T ss_pred             HHHHHHHHhC----CCCEEEEEeCcHHHHHHHHHHHhCCCCEEEEeCCCCHHHHHHHHHHHHcCCCcEEEEchhhhCCCC
Confidence            8888877753    345999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCcccccccccceeEEEEcCCCCCHHHHHHHhccCCCCCCeEEEEEcC
Q psy17912        441 DRVLNEFRIGRASILVSQYKESQQKRDRVLNEFRIGRASILVSHYNKS  488 (779)
Q Consensus       441 ip~v~~~~~~~~~~~VI~y~~p~s~~~yiQR~GRaGR~g~~~~~~~~~  488 (779)
                      +|+++         +||+|++|.++.+|+||+||+||.|..+.++...
T Consensus       366 i~~v~---------~VI~~d~p~~~~~y~qriGR~gR~g~~G~a~~~~  404 (434)
T 2db3_A          366 IKNIK---------HVINYDMPSKIDDYVHRIGRTGRVGNNGRATSFF  404 (434)
T ss_dssp             CTTCC---------EEEESSCCSSHHHHHHHHTTSSCTTCCEEEEEEE
T ss_pred             cccCC---------EEEEECCCCCHHHHHHHhcccccCCCCCEEEEEE
Confidence            99998         9999999999999999999999999888666543
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} Back     alignment and structure
>1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A Back     alignment and structure
>2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* Back     alignment and structure
>3hgt_A HDA1 complex subunit 3; RECA-like domain, SWI2/SNF2 helical domain, chromatin regulator, coiled coil, nucleus, repressor, transcription; 2.20A {Saccharomyces cerevisiae} PDB: 3hgq_A Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* Back     alignment and structure
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>2l82_A Designed protein OR32; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, de novo protein; NMR {Artificial gene} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 779
d1hv8a1208 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase 3e-55
d1wrba1238 c.37.1.19 (A:164-401) putative ATP-dependent RNA h 1e-50
d2g9na1218 c.37.1.19 (A:21-238) Initiation factor 4a {Human ( 2e-49
d1qdea_212 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 5e-47
d2j0sa1222 c.37.1.19 (A:22-243) Probable ATP-dependent RNA he 7e-47
d1t6na_207 c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 9e-43
d1veca_206 c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma 5e-40
d1s2ma1206 c.37.1.19 (A:46-251) Putative ATP-dependent RNA he 3e-39
d1q0ua_209 c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR 9e-36
d1gkub1237 c.37.1.16 (B:1-250) Helicase-like "domain" of reve 3e-34
d1oywa2206 c.37.1.19 (A:1-206) RecQ helicase domain {Escheric 1e-25
d2bmfa2305 c.37.1.14 (A:178-482) Dengue virus helicase {Dengu 3e-25
d2p6ra3202 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus 9e-24
d1gkub2248 c.37.1.16 (B:251-498) Helicase-like "domain" of re 9e-15
d1wp9a1200 c.37.1.19 (A:1-200) putative ATP-dependent RNA hel 4e-13
d1a1va2299 c.37.1.14 (A:326-624) HCV helicase domain {Human h 2e-12
d1wp9a2286 c.37.1.19 (A:201-486) putative ATP-dependent RNA h 4e-08
d1fuka_162 c.37.1.19 (A:) Initiation factor 4a {Baker's yeast 2e-06
d1hv8a2155 c.37.1.19 (A:211-365) Putative DEAD box RNA helica 3e-05
d1oywa3200 c.37.1.19 (A:207-406) RecQ helicase domain {Escher 3e-05
d2rb4a1168 c.37.1.19 (A:307-474) ATP-dependent RNA helicase D 3e-05
d1jr6a_138 c.37.1.14 (A:) HCV helicase domain {Human hepatiti 0.001
d1a1va1136 c.37.1.14 (A:190-325) HCV helicase domain {Human h 0.003
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Putative DEAD box RNA helicase
species: Archaeon Methanococcus jannaschii [TaxId: 2190]

 Score =  187 bits (475), Expect = 3e-55
 Identities = 79/208 (37%), Positives = 119/208 (57%), Gaps = 8/208 (3%)

Query: 130 FEECNFPPYIMKKIYEMGFQAPTAIQAQGWPIALSG-CDLVAIAKTGSGKTLGYIAPAIV 188
           F E N    I+  I   GF+ PT IQ +  P+ L+   ++VA A+TGSGKT  +  P I 
Sbjct: 6   FNELNLSDNILNAIRNKGFEKPTDIQMKVIPLFLNDEYNIVAQARTGSGKTASFAIPLIE 65

Query: 189 HVNSQRPLRSGEGPIVLVLAPTRELAQQIETVANDFGSATATRVACVFGGAPKGPQVKAL 248
            VN         G   ++L PTRELA Q+             ++A ++GG    PQ+KAL
Sbjct: 66  LVNENN------GIEAIILTPTRELAIQVADEIESLKGNKNLKIAKIYGGKAIYPQIKAL 119

Query: 249 QTGAEIVIATPGRLIDYLEQGTINLHRTSYLVLDEADRMLDMGFEPQIRKIIGQIRPDRQ 308
           +  A IV+ TPGR++D++ +GT+NL    Y +LDEAD ML+MGF   + KI+     D++
Sbjct: 120 K-NANIVVGTPGRILDHINRGTLNLKNVKYFILDEADEMLNMGFIKDVEKILNACNKDKR 178

Query: 309 VLMWSATWPKEVQKLAEDFLVDYVQLNI 336
           +L++SAT P+E+  LA+ ++ DY  +  
Sbjct: 179 ILLFSATMPREILNLAKKYMGDYSFIKA 206
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 248 Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 299 Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 286 Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 162 Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 155 Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 200 Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 138 Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query779
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 100.0
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 100.0
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 100.0
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 100.0
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 100.0
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 100.0
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 100.0
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 100.0
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 100.0
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 100.0
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 99.91
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.91
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 99.91
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 99.9
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 99.9
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 99.9
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 99.9
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 99.9
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 99.89
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 99.88
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.88
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 99.87
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 99.86
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 99.78
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.73
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.72
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 99.71
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.69
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 99.66
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.65
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 99.64
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 99.61
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 99.57
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.55
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 99.55
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 99.53
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 99.48
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.25
d1yksa2299 YFV helicase domain {Yellow fever virus [TaxId: 11 99.23
d1z3ix2298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.16
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.11
d1z63a1230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.0
d1tf5a4175 Translocation ATPase SecA, nucleotide-binding doma 98.93
d1tf5a3273 Translocation ATPase SecA, nucleotide-binding doma 98.74
d1c4oa2174 Nucleotide excision repair enzyme UvrB {Thermus th 98.69
d1nkta3288 Translocation ATPase SecA, nucleotide-binding doma 98.67
d1t5la2181 Nucleotide excision repair enzyme UvrB {Bacillus c 98.55
d1t5ia_168 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 98.14
d1nkta4219 Translocation ATPase SecA, nucleotide-binding doma 98.13
d2rb4a1168 ATP-dependent RNA helicase DDX25 {Human (Homo sapi 98.04
d1oywa3200 RecQ helicase domain {Escherichia coli [TaxId: 562 98.01
d1hv8a2155 Putative DEAD box RNA helicase {Archaeon Methanoco 97.99
d1fuka_162 Initiation factor 4a {Baker's yeast (Saccharomyces 97.97
d1s2ma2171 Putative ATP-dependent RNA helicase DHH1 {Baker's 97.96
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 97.82
d2j0sa2168 Probable ATP-dependent RNA helicase DDX48 {Human ( 97.78
d1jr6a_138 HCV helicase domain {Human hepatitis C virus (HCV) 97.35
d1a1va2299 HCV helicase domain {Human hepatitis C virus (HCV) 97.12
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 96.89
d1gm5a4206 RecG helicase domain {Thermotoga maritima [TaxId: 96.71
d1gkub2248 Helicase-like "domain" of reverse gyrase {Archaeon 96.7
d1wp9a2286 putative ATP-dependent RNA helicase PF2015 {Pyroco 96.54
d2eyqa5211 Transcription-repair coupling factor, TRCF {Escher 96.39
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.3
d1ls1a2207 GTPase domain of the signal sequence recognition p 96.29
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 96.22
d2fwra1200 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 96.17
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 96.1
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 95.94
d2qy9a2211 GTPase domain of the signal recognition particle r 95.63
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 95.21
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 95.15
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 95.14
d1vmaa2213 GTPase domain of the signal recognition particle r 95.12
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 95.0
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 94.96
d1z3ix1346 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 94.93
d1j8yf2211 GTPase domain of the signal sequence recognition p 94.74
d2p6ra4201 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 94.63
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 94.61
d1okkd2207 GTPase domain of the signal recognition particle r 94.45
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus 94.32
d1z5za1244 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 94.19
d2b8ta1139 Thymidine kinase, TK1, N-terminal domain {Ureaplas 94.02
d1t5la1413 Nucleotide excision repair enzyme UvrB {Bacillus c 93.61
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 93.29
d1xx6a1141 Thymidine kinase, TK1, N-terminal domain {Clostrid 92.92
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 92.69
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 92.43
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 92.17
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 92.17
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 91.31
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 91.24
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 91.21
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 91.18
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 90.53
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 89.74
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 89.4
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 88.75
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 88.66
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 88.66
d1qvra2387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 88.37
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 88.27
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 88.08
d1c4oa1408 Nucleotide excision repair enzyme UvrB {Thermus th 86.18
d1g5ta_157 ATP:corrinoid adenosyltransferase CobA {Salmonella 85.25
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 85.13
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 84.27
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 82.48
d1g41a_443 HslU {Haemophilus influenzae [TaxId: 727]} 81.73
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 80.9
d1e9ra_433 Bacterial conjugative coupling protein TrwB {Esche 80.57
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Probable ATP-dependent RNA helicase DDX48
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.3e-38  Score=321.12  Aligned_cols=209  Identities=30%  Similarity=0.527  Sum_probs=196.9

Q ss_pred             CCCCCCCcCCCCCHHHHHHHHHcCCCCCCHHHHHHHHHHhcCCCEEEEccCCCChhHHHHHHHHHHHhccCCCCCCCCCE
Q psy17912        124 PRPIQHFEECNFPPYIMKKIYEMGFQAPTAIQAQGWPIALSGCDLVAIAKTGSGKTLGYIAPAIVHVNSQRPLRSGEGPI  203 (779)
Q Consensus       124 p~pi~~f~~~~l~~~l~~~l~~~g~~~p~~~Q~~~i~~il~g~dvii~apTGsGKTl~~~lp~l~~l~~~~~~~~~~~~~  203 (779)
                      ..+..+|++++|++.++++|.+.||..|||+|+++||.+++|+|+++.||||||||++|++|+++++...     ...++
T Consensus        13 ~~~~~sF~~l~L~~~l~~~L~~~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~~-----~~~~~   87 (222)
T d2j0sa1          13 VDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQ-----VRETQ   87 (222)
T ss_dssp             CCCCCSGGGGCCCHHHHHHHHHHTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTT-----SCSCC
T ss_pred             CCCCCCHHHCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCeEEEcCcchhhhhhhccccccccccc-----ccCce
Confidence            3456689999999999999999999999999999999999999999999999999999999999887653     34678


Q ss_pred             EEEEccCHHHHHHHHHHHHHhcccCCceEEEEeCCCCChhhHHHhhcCCeEEEeChHHHHHHHHcCCcCCCCeeEEEEcc
Q psy17912        204 VLVLAPTRELAQQIETVANDFGSATATRVACVFGGAPKGPQVKALQTGAEIVIATPGRLIDYLEQGTINLHRTSYLVLDE  283 (779)
Q Consensus       204 vLil~Ptr~La~Q~~~~~~~~~~~~~l~v~~~~gg~~~~~~~~~l~~~~~IiV~Tpe~Ll~~l~~~~~~l~~i~~lViDE  283 (779)
                      ++|++||++||.|+++.+.+++...++++..++|+.....+...+..+++|+|+||++|.+++......++++.++|+||
T Consensus        88 ~lil~PtreLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~~~~~~~l~~~~~Ilv~TPgrl~~~~~~~~~~~~~l~~lVlDE  167 (222)
T d2j0sa1          88 ALILAPTRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRRRSLRTRAIKMLVLDE  167 (222)
T ss_dssp             EEEECSSHHHHHHHHHHHHHHTTTTTCCEEEECTTSCHHHHHHHHHHCCSEEEECHHHHHHHHHTTSSCCTTCCEEEEET
T ss_pred             eEEecchHHHHHHHHHHHHHHhCccceeEEEEeecccchhhHHHhccCCeEEeCCCCcHHhcccccccccccceeeeecc
Confidence            99999999999999999999999999999999999998888888888999999999999999998889999999999999


Q ss_pred             chhhhcCCchHHHHHHHhhcCCCCceEEeeccccHHHHHHHHHhccCcEEEecC
Q psy17912        284 ADRMLDMGFEPQIRKIIGQIRPDRQVLMWSATWPKEVQKLAEDFLVDYVQLNIG  337 (779)
Q Consensus       284 aH~l~~~~f~~~l~~il~~l~~~~qilllSAT~~~~v~~l~~~~l~~~~~i~i~  337 (779)
                      ||+|++.+|...+..|+..+++++|++++|||+|++++++++.++.+|+.+.++
T Consensus       168 aD~ll~~~f~~~i~~I~~~l~~~~Q~ilfSAT~~~~v~~l~~~~l~~Pv~I~V~  221 (222)
T d2j0sa1         168 ADEMLNKGFKEQIYDVYRYLPPATQVVLISATLPHEILEMTNKFMTDPIRILVK  221 (222)
T ss_dssp             HHHHTSTTTHHHHHHHHTTSCTTCEEEEEESCCCHHHHTTGGGTCSSCEEECCC
T ss_pred             hhHhhhcCcHHHHHHHHHhCCCCCEEEEEEEeCCHHHHHHHHHHCCCCEEEEEe
Confidence            999999999999999999999999999999999999999999999999988764
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tf5a4 c.37.1.19 (A:396-570) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nkta4 c.37.1.19 (A:397-615) Translocation ATPase SecA, nucleotide-binding domains {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d2fwra1 c.37.1.19 (A:257-456) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z3ix1 c.37.1.19 (X:390-735) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure