Psyllid ID: psy18065
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 149 | ||||||
| 242022297 | 938 | glutamate receptor, ionotropic kainate 2 | 0.959 | 0.152 | 0.699 | 8e-57 | |
| 332020480 | 982 | Glutamate receptor, ionotropic kainate 2 | 0.959 | 0.145 | 0.678 | 2e-56 | |
| 383865939 | 1008 | PREDICTED: glutamate receptor, ionotropi | 0.959 | 0.141 | 0.678 | 4e-56 | |
| 307214191 | 218 | Glutamate receptor, ionotropic kainate 1 | 0.953 | 0.651 | 0.683 | 4e-56 | |
| 350422773 | 383 | PREDICTED: glutamate receptor, ionotropi | 0.959 | 0.373 | 0.671 | 6e-56 | |
| 328777632 | 1000 | PREDICTED: glutamate receptor, ionotropi | 0.959 | 0.143 | 0.671 | 9e-56 | |
| 340713406 | 998 | PREDICTED: glutamate receptor, ionotropi | 0.959 | 0.143 | 0.671 | 9e-56 | |
| 380015482 | 987 | PREDICTED: glutamate receptor, ionotropi | 0.959 | 0.144 | 0.671 | 1e-55 | |
| 307176862 | 345 | Glutamate receptor, ionotropic kainate 1 | 0.959 | 0.414 | 0.671 | 3e-55 | |
| 345488319 | 1023 | PREDICTED: glutamate receptor, ionotropi | 0.959 | 0.139 | 0.678 | 5e-55 |
| >gi|242022297|ref|XP_002431577.1| glutamate receptor, ionotropic kainate 2 precursor, putative [Pediculus humanus corporis] gi|212516880|gb|EEB18839.1| glutamate receptor, ionotropic kainate 2 precursor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 224 bits (571), Expect = 8e-57, Method: Compositional matrix adjust.
Identities = 100/143 (69%), Positives = 124/143 (86%)
Query: 7 CRQLQNGVQALFGPSDALLGPHVQSICEALDVPHMESRLDLELNSKEFSVNLYPSQKLLN 66
CRQL+NG+QA+FGP+D LLG H+QSICEALDVPHME+RLD E KEFS+NL+PSQ+ LN
Sbjct: 86 CRQLENGIQAIFGPTDPLLGAHIQSICEALDVPHMEARLDFEPFLKEFSINLHPSQQHLN 145
Query: 67 AAFKDVIRFLNWTKVAIVYEEDNGLFKLQELVKTPPTLKTEMYIRHANPSTYRNVLREIR 126
AF+D++ FLNWTKVAI+YEED GLFKLQ+LVK+PP K EMYIR ANP+TYR+VL+EIR
Sbjct: 146 KAFQDLMIFLNWTKVAIIYEEDYGLFKLQDLVKSPPNSKMEMYIRQANPTTYRHVLKEIR 205
Query: 127 QKEIFNLIIDTSTTHISQFFRAV 149
QKEI+ L++DT+ H + FFRA+
Sbjct: 206 QKEIYKLLVDTNPVHTNVFFRAI 228
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|332020480|gb|EGI60895.1| Glutamate receptor, ionotropic kainate 2 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|383865939|ref|XP_003708429.1| PREDICTED: glutamate receptor, ionotropic kainate 2-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|307214191|gb|EFN89308.1| Glutamate receptor, ionotropic kainate 1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|350422773|ref|XP_003493278.1| PREDICTED: glutamate receptor, ionotropic kainate 1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|328777632|ref|XP_003249376.1| PREDICTED: glutamate receptor, ionotropic kainate 2-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|340713406|ref|XP_003395234.1| PREDICTED: glutamate receptor, ionotropic kainate 2-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|380015482|ref|XP_003691730.1| PREDICTED: glutamate receptor, ionotropic kainate 2-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|307176862|gb|EFN66206.1| Glutamate receptor, ionotropic kainate 1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|345488319|ref|XP_001605775.2| PREDICTED: glutamate receptor, ionotropic kainate 2-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 149 | ||||||
| FB|FBgn0039927 | 910 | CG11155 [Drosophila melanogast | 0.946 | 0.154 | 0.618 | 1e-44 | |
| FB|FBgn0039916 | 899 | CG9935 [Drosophila melanogaste | 0.865 | 0.143 | 0.405 | 3.7e-25 | |
| FB|FBgn0038837 | 853 | CG3822 [Drosophila melanogaste | 0.953 | 0.166 | 0.342 | 1.1e-20 | |
| UNIPROTKB|F1M526 | 832 | Grik1 "Glutamate receptor iono | 0.993 | 0.177 | 0.355 | 4.5e-20 | |
| UNIPROTKB|D4ACE2 | 834 | Grik1 "Glutamate receptor iono | 0.993 | 0.177 | 0.355 | 4.5e-20 | |
| UNIPROTKB|F1LTY2 | 834 | Grik1 "Glutamate receptor iono | 0.993 | 0.177 | 0.355 | 4.5e-20 | |
| UNIPROTKB|F1M4T4 | 883 | Grik1 "Glutamate receptor iono | 0.993 | 0.167 | 0.355 | 5e-20 | |
| UNIPROTKB|F1M4B0 | 895 | Grik1 "Glutamate receptor iono | 0.993 | 0.165 | 0.355 | 5.1e-20 | |
| UNIPROTKB|F1M5R4 | 912 | Grik1 "Glutamate receptor iono | 0.993 | 0.162 | 0.355 | 5.2e-20 | |
| RGD|2732 | 949 | Grik1 "glutamate receptor, ion | 0.993 | 0.155 | 0.355 | 5.6e-20 |
| FB|FBgn0039927 CG11155 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 479 (173.7 bits), Expect = 1.0e-44, P = 1.0e-44
Identities = 89/144 (61%), Positives = 113/144 (78%)
Query: 6 MCRQLQNGVQALFGPSDALLGPHVQSICEALDVPHMESRLDLELNSKEFSVNLYPSQKLL 65
+C QL+ GVQA+FGP+DALL HVQSICEA D+PH+E R+DLE NSKEFS+NLYPS LL
Sbjct: 100 VCSQLEAGVQAIFGPTDALLASHVQSICEAYDIPHIEGRIDLEYNSKEFSINLYPSHTLL 159
Query: 66 NAAFKDVIRFLNWTKVAIVYEEDNGLFKLQELVKTPPTLKTEMYIRHANPSTYRNVLREI 125
A++D++ +LNWTKVAI+YEED GLF L + T K EMYIR A+P +YR VLR I
Sbjct: 160 TLAYRDIMVYLNWTKVAIIYEEDYGLFNLMH--SSTET-KAEMYIRQASPDSYRQVLRAI 216
Query: 126 RQKEIFNLIIDTSTTHISQFFRAV 149
RQKEI+ +I+DT+ +HI FFR++
Sbjct: 217 RQKEIYKIIVDTNPSHIKSFFRSI 240
|
|
| FB|FBgn0039916 CG9935 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0038837 CG3822 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M526 Grik1 "Glutamate receptor ionotropic, kainate 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4ACE2 Grik1 "Glutamate receptor ionotropic, kainate 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LTY2 Grik1 "Glutamate receptor ionotropic, kainate 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M4T4 Grik1 "Glutamate receptor ionotropic, kainate 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M4B0 Grik1 "Glutamate receptor ionotropic, kainate 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M5R4 Grik1 "Glutamate receptor ionotropic, kainate 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| RGD|2732 Grik1 "glutamate receptor, ionotropic, kainate 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 149 | |||
| cd06382 | 327 | cd06382, PBP1_iGluR_Kainate, N-terminal leucine/is | 2e-49 | |
| cd06368 | 324 | cd06368, PBP1_iGluR_non_NMDA_like, N-terminal leuc | 6e-42 | |
| cd06393 | 384 | cd06393, PBP1_iGluR_Kainate_GluR5_7, N-terminal le | 4e-26 | |
| cd06351 | 328 | cd06351, PBP1_iGluR_N_LIVBP_like, N-terminal leuci | 1e-25 | |
| cd06269 | 298 | cd06269, PBP1_glutamate_receptors_like, Family C G | 9e-15 | |
| pfam01094 | 343 | pfam01094, ANF_receptor, Receptor family ligand bi | 1e-14 | |
| cd06394 | 333 | cd06394, PBP1_iGluR_Kainate_KA1_2, N-terminal leuc | 5e-11 | |
| cd04509 | 299 | cd04509, PBP1_ABC_transporter_GCPR_C_like, Family | 2e-10 | |
| cd06380 | 382 | cd06380, PBP1_iGluR_AMPA, N-terminal leucine/isole | 3e-09 | |
| cd06389 | 370 | cd06389, PBP1_iGluR_AMPA_GluR2, N-terminal leucine | 4e-07 | |
| cd06390 | 364 | cd06390, PBP1_iGluR_AMPA_GluR1, N-terminal leucine | 4e-07 | |
| cd01391 | 269 | cd01391, Periplasmic_Binding_Protein_Type_1, Type | 3e-06 | |
| cd06383 | 368 | cd06383, PBP1_iGluR_AMPA_Like, N-terminal leucine/ | 2e-05 | |
| cd06388 | 371 | cd06388, PBP1_iGluR_AMPA_GluR4, N-terminal leucine | 1e-04 | |
| cd06381 | 363 | cd06381, PBP1_iGluR_delta_like, N-terminal leucine | 1e-04 | |
| cd06387 | 372 | cd06387, PBP1_iGluR_AMPA_GluR3, N-terminal leucine | 1e-04 | |
| cd06374 | 472 | cd06374, PBP1_mGluR_groupI, Ligand binding domain | 4e-04 |
| >gnl|CDD|107377 cd06382, PBP1_iGluR_Kainate, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors | Back alignment and domain information |
|---|
Score = 160 bits (408), Expect = 2e-49
Identities = 52/149 (34%), Positives = 82/149 (55%), Gaps = 2/149 (1%)
Query: 2 AEATMCRQLQNGVQALFGPSDALLGPHVQSICEALDVPHMESRLDLELNSKE-FSVNLYP 60
+C LQ GV A+FGPS + VQSIC+A ++PH+++R D E S F++NLYP
Sbjct: 52 TTKKVCDLLQQGVAAIFGPSSSEASSIVQSICDAKEIPHIQTRWDPEPKSNRQFTINLYP 111
Query: 61 SQKLLNAAFKDVIRFLNWTKVAIVYEEDNGLFKLQELVKTPPTLKTEMYIR-HANPSTYR 119
S L+ A+ D+++ NW I+YE GL +LQEL++ + +R + YR
Sbjct: 112 SNADLSRAYADIVKSFNWKSFTIIYESAEGLLRLQELLQAFGISGITITVRQLDDDLDYR 171
Query: 120 NVLREIRQKEIFNLIIDTSTTHISQFFRA 148
+L+EI+ +IID S + + +
Sbjct: 172 PLLKEIKNSGDNRIIIDCSADILIELLKQ 200
|
N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors, non-NMDA ionotropic receptors which respond to the neurotransmitter glutamate. While this N-terminal domain belongs to the periplasmic-binding fold type I superfamily, the glutamate-binding domain of the iGluR is structurally homologous to the periplasmic-binding fold type II. The LIVBP-like domain of iGluRs is thought to play a role in the initial assembly of iGluR subunits, but it is not well understood how this domain is arranged and functions in intact iGluR. Kainate receptors have five subunits, GluR5, GluR6, GluR7, KA1, and KA2, which are structurally similar to AMPA and NMDA subunits of ionotropic glutamate receptors. KA1 and KA2 subunits can only form functional receptors with one of the GluR5-7 subunits. Moreover, GluR5-7 can also form functional homomeric receptor channels activated by kainate and glutamate when expressed in heterologous systems. Kainate receptors are involved in excitatory neurotransmission by activating postsynaptic receptors and in inhibitory neurotransmission by modulating release of the inhibitory neurotransmitter GABA through a presynaptic mechanism. Kainate receptors are closely related to AMAP receptors. In contrast of AMPA receptors, kainate receptors play only a minor role in signaling at synapses and their function is not well defined. Length = 327 |
| >gnl|CDD|107363 cd06368, PBP1_iGluR_non_NMDA_like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors | Back alignment and domain information |
|---|
| >gnl|CDD|107388 cd06393, PBP1_iGluR_Kainate_GluR5_7, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor | Back alignment and domain information |
|---|
| >gnl|CDD|107346 cd06351, PBP1_iGluR_N_LIVBP_like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) | Back alignment and domain information |
|---|
| >gnl|CDD|153137 cd06269, PBP1_glutamate_receptors_like, Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors | Back alignment and domain information |
|---|
| >gnl|CDD|216296 pfam01094, ANF_receptor, Receptor family ligand binding region | Back alignment and domain information |
|---|
| >gnl|CDD|107389 cd06394, PBP1_iGluR_Kainate_KA1_2, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the KA1 and KA2 subunits of Kainate receptor | Back alignment and domain information |
|---|
| >gnl|CDD|107261 cd04509, PBP1_ABC_transporter_GCPR_C_like, Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems | Back alignment and domain information |
|---|
| >gnl|CDD|107375 cd06380, PBP1_iGluR_AMPA, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor | Back alignment and domain information |
|---|
| >gnl|CDD|107384 cd06389, PBP1_iGluR_AMPA_GluR2, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR2 subunit of the AMPA receptor | Back alignment and domain information |
|---|
| >gnl|CDD|107385 cd06390, PBP1_iGluR_AMPA_GluR1, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR1 subunit of the AMPA receptor | Back alignment and domain information |
|---|
| >gnl|CDD|107248 cd01391, Periplasmic_Binding_Protein_Type_1, Type 1 periplasmic binding fold superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|107378 cd06383, PBP1_iGluR_AMPA_Like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors | Back alignment and domain information |
|---|
| >gnl|CDD|107383 cd06388, PBP1_iGluR_AMPA_GluR4, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor | Back alignment and domain information |
|---|
| >gnl|CDD|107376 cd06381, PBP1_iGluR_delta_like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of an orphan family of delta receptors, GluRdelta1 and GluRdelta2 | Back alignment and domain information |
|---|
| >gnl|CDD|107382 cd06387, PBP1_iGluR_AMPA_GluR3, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA receptor | Back alignment and domain information |
|---|
| >gnl|CDD|107369 cd06374, PBP1_mGluR_groupI, Ligand binding domain of the group I metabotropic glutamate receptor | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| cd06387 | 372 | PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucin | 99.97 | |
| cd06390 | 364 | PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucin | 99.97 | |
| cd06394 | 333 | PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleu | 99.97 | |
| cd06392 | 400 | PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/v | 99.97 | |
| cd06383 | 368 | PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine | 99.96 | |
| cd06389 | 370 | PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucin | 99.96 | |
| cd06388 | 371 | PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucin | 99.96 | |
| cd06393 | 384 | PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isol | 99.95 | |
| cd06380 | 382 | PBP1_iGluR_AMPA N-terminal leucine/isoleucine/vali | 99.95 | |
| cd06377 | 382 | PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/ | 99.94 | |
| cd06391 | 400 | PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/v | 99.93 | |
| cd06375 | 458 | PBP1_mGluR_groupII Ligand binding domain of the gr | 99.93 | |
| cd06351 | 328 | PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleuc | 99.93 | |
| cd06361 | 403 | PBP1_GPC6A_like Ligand-binding domain of the promi | 99.93 | |
| cd06365 | 469 | PBP1_Pheromone_receptor Ligand-binding domain of t | 99.93 | |
| cd06368 | 324 | PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleu | 99.93 | |
| cd06381 | 363 | PBP1_iGluR_delta_like N-terminal leucine/isoleucin | 99.93 | |
| cd06386 | 387 | PBP1_NPR_C_like Ligand-binding domain of type C na | 99.93 | |
| cd06382 | 327 | PBP1_iGluR_Kainate N-terminal leucine/isoleucine/v | 99.93 | |
| cd06367 | 362 | PBP1_iGluR_NMDA N-terminal leucine/isoleucine/vali | 99.93 | |
| cd06378 | 362 | PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/ | 99.92 | |
| cd06364 | 510 | PBP1_CaSR Ligand-binding domain of the CaSR calciu | 99.92 | |
| cd06376 | 463 | PBP1_mGluR_groupIII Ligand-binding domain of the g | 99.92 | |
| cd06379 | 377 | PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/ | 99.91 | |
| cd06374 | 472 | PBP1_mGluR_groupI Ligand binding domain of the gro | 99.91 | |
| cd06362 | 452 | PBP1_mGluR Ligand binding domain of the metabotrop | 99.91 | |
| cd06350 | 348 | PBP1_GPCR_family_C_like Ligand-binding domain of m | 99.9 | |
| cd06373 | 396 | PBP1_NPR_like Ligand binding domain of natriuretic | 99.9 | |
| cd06269 | 298 | PBP1_glutamate_receptors_like Family C G-protein c | 99.9 | |
| cd06363 | 410 | PBP1_Taste_receptor Ligand-binding domain of the T | 99.9 | |
| cd06371 | 382 | PBP1_sensory_GC_DEF_like Ligand-binding domain of | 99.89 | |
| cd06385 | 405 | PBP1_NPR_A Ligand-binding domain of type A natriur | 99.89 | |
| cd06366 | 350 | PBP1_GABAb_receptor Ligand-binding domain of GABAb | 99.88 | |
| PF01094 | 348 | ANF_receptor: Receptor family ligand binding regio | 99.88 | |
| cd06370 | 404 | PBP1_Speract_GC_like Ligand-binding domain of memb | 99.88 | |
| cd06372 | 391 | PBP1_GC_G_like Ligand-binding domain of membrane g | 99.87 | |
| cd06384 | 399 | PBP1_NPR_B Ligand-binding domain of type B natriur | 99.86 | |
| KOG1056|consensus | 878 | 99.85 | ||
| cd06352 | 389 | PBP1_NPR_GC_like Ligand-binding domain of membrane | 99.85 | |
| KOG1054|consensus | 897 | 99.81 | ||
| cd06346 | 312 | PBP1_ABC_ligand_binding_like_11 Type I periplasmic | 99.8 | |
| cd06338 | 345 | PBP1_ABC_ligand_binding_like_5 Type I periplasmic | 99.8 | |
| cd06345 | 344 | PBP1_ABC_ligand_binding_like_10 Type I periplasmic | 99.8 | |
| cd06342 | 334 | PBP1_ABC_LIVBP_like Type I periplasmic ligand-bind | 99.79 | |
| cd06340 | 347 | PBP1_ABC_ligand_binding_like_6 Type I periplasmic | 99.79 | |
| cd06347 | 334 | PBP1_ABC_ligand_binding_like_12 Type I periplasmic | 99.76 | |
| cd06348 | 344 | PBP1_ABC_ligand_binding_like_13 Type I periplasmic | 99.74 | |
| cd06335 | 347 | PBP1_ABC_ligand_binding_like_2 Type I periplasmic | 99.72 | |
| cd06330 | 346 | PBP1_Arsenic_SBP_like Periplasmic solute-binding d | 99.71 | |
| cd06331 | 333 | PBP1_AmiC_like Type I periplasmic components of am | 99.71 | |
| cd06329 | 342 | PBP1_SBP_like_3 Periplasmic solute-binding domain | 99.71 | |
| cd04509 | 299 | PBP1_ABC_transporter_GCPR_C_like Family C of G-pro | 99.71 | |
| cd06343 | 362 | PBP1_ABC_ligand_binding_like_8 Type I periplasmic | 99.71 | |
| cd06349 | 340 | PBP1_ABC_ligand_binding_like_14 Type I periplasmic | 99.7 | |
| cd06336 | 347 | PBP1_ABC_ligand_binding_like_3 Type I periplasmic | 99.69 | |
| cd06344 | 332 | PBP1_ABC_ligand_binding_like_9 Type I periplasmic | 99.69 | |
| PRK15404 | 369 | leucine ABC transporter subunit substrate-binding | 99.68 | |
| cd06327 | 334 | PBP1_SBP_like_1 Periplasmic solute-binding domain | 99.65 | |
| cd06359 | 333 | PBP1_Nba_like Type I periplasmic binding component | 99.63 | |
| cd06360 | 336 | PBP1_alkylbenzenes_like Type I periplasmic binding | 99.62 | |
| cd06268 | 298 | PBP1_ABC_transporter_LIVBP_like Periplasmic bindin | 99.62 | |
| cd06355 | 348 | PBP1_FmdD_like Periplasmic component (FmdD) of an | 99.6 | |
| cd06358 | 333 | PBP1_NHase Type I periplasmic-binding protein of t | 99.6 | |
| cd06339 | 336 | PBP1_YraM_LppC_lipoprotein_like Periplasmic bindin | 99.59 | |
| cd06328 | 333 | PBP1_SBP_like_2 Periplasmic solute-binding domain | 99.57 | |
| cd06326 | 336 | PBP1_STKc_like Type I periplasmic binding domain o | 99.57 | |
| cd06334 | 351 | PBP1_ABC_ligand_binding_like_1 Type I periplasmic | 99.57 | |
| COG0683 | 366 | LivK ABC-type branched-chain amino acid transport | 99.56 | |
| cd06337 | 357 | PBP1_ABC_ligand_binding_like_4 Type I periplasmic | 99.55 | |
| cd06332 | 333 | PBP1_aromatic_compounds_like Type I periplasmic bi | 99.53 | |
| cd06333 | 312 | PBP1_ABC-type_HAAT_like Type I periplasmic binding | 99.53 | |
| TIGR03669 | 374 | urea_ABC_arch urea ABC transporter, substrate-bind | 99.52 | |
| PF13458 | 343 | Peripla_BP_6: Periplasmic binding protein; PDB: 4E | 99.52 | |
| cd06356 | 334 | PBP1_Amide_Urea_BP_like Periplasmic component (Fmd | 99.51 | |
| cd06369 | 380 | PBP1_GC_C_enterotoxin_receptor Ligand-binding doma | 99.51 | |
| TIGR03407 | 359 | urea_ABC_UrtA urea ABC transporter, urea binding p | 99.49 | |
| cd06357 | 360 | PBP1_AmiC Periplasmic binding domain of amidase (A | 99.38 | |
| TIGR03863 | 347 | PQQ_ABC_bind ABC transporter, substrate binding pr | 99.33 | |
| cd06341 | 341 | PBP1_ABC_ligand_binding_like_7 Type I periplasmic | 99.28 | |
| KOG4440|consensus | 993 | 99.21 | ||
| cd01391 | 269 | Periplasmic_Binding_Protein_Type_1 Type 1 periplas | 99.19 | |
| KOG1055|consensus | 865 | 99.12 | ||
| KOG1053|consensus | 1258 | 98.71 | ||
| PF13433 | 363 | Peripla_BP_5: Periplasmic binding protein domain; | 98.2 | |
| PF04348 | 536 | LppC: LppC putative lipoprotein; InterPro: IPR0074 | 97.66 | |
| cd01537 | 264 | PBP1_Repressors_Sugar_Binding_like Ligand-binding | 97.58 | |
| cd06320 | 275 | PBP1_allose_binding Periplasmic allose-binding dom | 97.47 | |
| cd06300 | 272 | PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-bi | 97.45 | |
| cd06267 | 264 | PBP1_LacI_sugar_binding_like Ligand binding domain | 97.37 | |
| cd01536 | 267 | PBP1_ABC_sugar_binding_like Periplasmic sugar-bind | 97.28 | |
| cd06282 | 266 | PBP1_GntR_like_2 Ligand-binding domain of putative | 96.92 | |
| cd06273 | 268 | PBP1_GntR_like_1 This group includes the ligand-bi | 96.41 | |
| cd06325 | 281 | PBP1_ABC_uncharacterized_transporter Type I peripl | 96.3 | |
| cd06319 | 277 | PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-b | 96.25 | |
| cd01545 | 270 | PBP1_SalR Ligand-binding domain of DNA transcripti | 96.22 | |
| cd06323 | 268 | PBP1_ribose_binding Periplasmic sugar-binding doma | 95.87 | |
| cd06278 | 266 | PBP1_LacI_like_2 Ligand-binding domain of uncharac | 95.64 | |
| cd06309 | 273 | PBP1_YtfQ_like Periplasmic binding domain of ABC-t | 95.63 | |
| cd06317 | 275 | PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-bi | 95.6 | |
| cd06298 | 268 | PBP1_CcpA_like Ligand-binding domain of the catabo | 95.01 | |
| cd06312 | 271 | PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-bi | 94.98 | |
| cd06301 | 272 | PBP1_rhizopine_binding_like Periplasmic binding pr | 94.95 | |
| cd06305 | 273 | PBP1_methylthioribose_binding_like Methylthioribos | 94.89 | |
| cd06284 | 267 | PBP1_LacI_like_6 Ligand-binding domain of an uncha | 94.54 | |
| PRK10014 | 342 | DNA-binding transcriptional repressor MalI; Provis | 94.5 | |
| PRK10653 | 295 | D-ribose transporter subunit RbsB; Provisional | 94.23 | |
| TIGR01481 | 329 | ccpA catabolite control protein A. Catabolite cont | 94.16 | |
| cd06275 | 269 | PBP1_PurR Ligand-binding domain of purine represso | 94.01 | |
| cd06289 | 268 | PBP1_MalI_like Ligand-binding domain of MalI, a tr | 93.95 | |
| cd06310 | 273 | PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-bi | 93.9 | |
| cd06313 | 272 | PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-bi | 93.74 | |
| PF13407 | 257 | Peripla_BP_4: Periplasmic binding protein domain; | 93.56 | |
| PF00532 | 279 | Peripla_BP_1: Periplasmic binding proteins and sug | 93.05 | |
| cd06322 | 267 | PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-b | 92.97 | |
| cd06296 | 270 | PBP1_CatR_like Ligand-binding domain of a LacI-lik | 92.62 | |
| TIGR02990 | 239 | ectoine_eutA ectoine utilization protein EutA. Mem | 92.56 | |
| cd06271 | 268 | PBP1_AglR_RafR_like Ligand-binding domain of DNA t | 92.15 | |
| cd06311 | 274 | PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-bi | 91.95 | |
| COG2984 | 322 | ABC-type uncharacterized transport system, peripla | 91.89 | |
| PRK11303 | 328 | DNA-binding transcriptional regulator FruR; Provis | 91.71 | |
| COG1609 | 333 | PurR Transcriptional regulators [Transcription] | 91.42 | |
| cd01574 | 264 | PBP1_LacI Ligand-binding domain of DNA transcripti | 91.35 | |
| cd01542 | 259 | PBP1_TreR_like Ligand-binding domain of DNA transc | 91.31 | |
| cd06281 | 269 | PBP1_LacI_like_5 Ligand-binding domain of uncharac | 91.23 | |
| TIGR02417 | 327 | fruct_sucro_rep D-fructose-responsive transcriptio | 91.2 | |
| PRK09756 | 158 | PTS system N-acetylgalactosamine-specific transpor | 90.37 | |
| cd06295 | 275 | PBP1_CelR Ligand binding domain of a transcription | 90.15 | |
| cd06277 | 268 | PBP1_LacI_like_1 Ligand-binding domain of uncharac | 90.07 | |
| cd06270 | 268 | PBP1_GalS_like Ligand binding domain of DNA transc | 90.05 | |
| cd06308 | 270 | PBP1_sensor_kinase_like Periplasmic binding domain | 90.03 | |
| cd06299 | 265 | PBP1_LacI_like_13 Ligand-binding domain of DNA-bin | 89.88 | |
| cd06280 | 263 | PBP1_LacI_like_4 Ligand-binding domain of uncharac | 89.21 | |
| PRK11425 | 157 | PTS system N-acetylgalactosamine-specific transpor | 89.05 | |
| cd06288 | 269 | PBP1_sucrose_transcription_regulator Ligand-bindin | 88.91 | |
| cd06291 | 265 | PBP1_Qymf_like Ligand binding domain of the lacI-l | 88.07 | |
| TIGR00854 | 151 | pts-sorbose PTS system, mannose/fructose/sorbose f | 88.04 | |
| cd06290 | 265 | PBP1_LacI_like_9 Ligand-binding domain of uncharac | 87.74 | |
| cd06294 | 270 | PBP1_ycjW_transcription_regulator_like Ligand-bind | 87.6 | |
| cd00001 | 151 | PTS_IIB_man PTS_IIB, PTS system, Mannose/sorbose s | 87.31 | |
| cd06293 | 269 | PBP1_LacI_like_11 Ligand-binding domain of unchara | 86.82 | |
| cd06279 | 283 | PBP1_LacI_like_3 Ligand-binding domain of uncharac | 86.68 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 85.91 | |
| cd06274 | 264 | PBP1_FruR Ligand binding domain of DNA transcripti | 85.71 | |
| PRK10703 | 341 | DNA-binding transcriptional repressor PurR; Provis | 85.0 | |
| cd06272 | 261 | PBP1_hexuronate_repressor_like Ligand-binding doma | 84.63 | |
| PRK10423 | 327 | transcriptional repressor RbsR; Provisional | 84.6 | |
| PF03830 | 151 | PTSIIB_sorb: PTS system sorbose subfamily IIB comp | 84.19 | |
| cd01575 | 268 | PBP1_GntR Ligand-binding domain of DNA transcripti | 84.08 | |
| PRK10727 | 343 | DNA-binding transcriptional regulator GalR; Provis | 84.07 | |
| cd06286 | 260 | PBP1_CcpB_like Ligand-binding domain of a novel tr | 83.97 | |
| PRK09526 | 342 | lacI lac repressor; Reviewed | 83.47 | |
| cd06283 | 267 | PBP1_RegR_EndR_KdgR_like Ligand-binding domain of | 83.32 | |
| cd01538 | 288 | PBP1_ABC_xylose_binding Periplasmic xylose-binding | 83.1 | |
| PF04392 | 294 | ABC_sub_bind: ABC transporter substrate binding pr | 82.83 | |
| PLN02674 | 244 | adenylate kinase | 82.56 | |
| cd01543 | 265 | PBP1_XylR Ligand-binding domain of DNA transcripti | 81.99 | |
| COG0426 | 388 | FpaA Uncharacterized flavoproteins [Energy product | 81.17 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 80.87 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 80.72 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 80.62 | |
| cd01541 | 273 | PBP1_AraR Ligand-binding domain of DNA transcripti | 80.48 | |
| cd06285 | 265 | PBP1_LacI_like_7 Ligand-binding domain of uncharac | 80.13 |
| >cd06387 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA receptor | Back alignment and domain information |
|---|
Probab=99.97 E-value=5.9e-31 Score=198.00 Aligned_cols=144 Identities=20% Similarity=0.427 Sum_probs=130.0
Q ss_pred hHHHHHHHhhCCcEEEEcCCCCCcHHHHHHhhcccCCCceeeccCCCCCCcccEEEecCChhHHHHHHHHHHHhcCCcEE
Q psy18065 2 AEATMCRQLQNGVQALFGPSDALLGPHVQSICEALDVPHMESRLDLELNSKEFSVNLYPSQKLLNAAFKDVIRFLNWTKV 81 (149)
Q Consensus 2 ~~~~~c~~~~~~v~aiiGp~~s~~~~~v~~~~~~~~iP~is~~~~~~~~~~~~~~~~~p~~~~~~~ai~~ll~~~~W~~v 81 (149)
+++++|+++++||.||+||+++.++.+++++|+.++||+|++.++. ....+|.++++|+ ++.|+++++++|||++|
T Consensus 52 ~~~~~C~l~~~GV~AIfGp~~~~s~~~v~s~c~~~~iP~i~~~~~~-~~~~~~~l~l~P~---l~~Ai~diI~~~~Wr~~ 127 (372)
T cd06387 52 VTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGALHTSFITPSFPT-DADVQFVIQMRPA---LKGAILSLLAHYKWEKF 127 (372)
T ss_pred HHHHHHHHhhcccEEEEecCCHhHHHHHHHhhccccCCeeeeCCCC-CCCCceEEEEChh---HHHHHHHHHHhcCCCEE
Confidence 6789999999999999999999999999999999999999987653 2455889999998 89999999999999999
Q ss_pred EEEeecCcchhhHHHHHhCCCCCCceEEEEecC----CCchHHHHHHHHhCCCceEEEecCchhHHHHHhhC
Q psy18065 82 AIVYEEDNGLFKLQELVKTPPTLKTEMYIRHAN----PSTYRNVLREIRQKEIFNLIIDTSTTHISQFFRAV 149 (149)
Q Consensus 82 ~vi~~~~~~~~~l~~l~~~~~~~~~~v~~~~~~----~~d~~~~l~~i~~~~~~~iil~~~~~~~~~il~qA 149 (149)
+++|++++|+.++|++.+.....+..+..+.+. ..+++.+|++|++++.++|||+|+++.+..+|+||
T Consensus 128 ~~iYd~d~gl~~Lq~L~~~~~~~~~~V~~~~v~~~~~~~~~~~~l~el~~~~~r~iIld~s~~~~~~il~~a 199 (372)
T cd06387 128 VYLYDTERGFSILQAIMEAAVQNNWQVTARSVGNIKDVQEFRRIIEEMDRRQEKRYLIDCEVERINTILEQV 199 (372)
T ss_pred EEEecCchhHHHHHHHHHhhccCCceEEEEEeccCCchHHHHHHHHHhccccceEEEEECCHHHHHHHHHHH
Confidence 999998999999999999988888777655542 25789999999999999999999999999999986
|
N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid) receptor. The AMPA receptor is a member of the glutamate-receptor ion channels (iGluRs) which are the major mediators of excitatory synaptic transmission in the central nervous system. AMPA receptors are composed of four types of subunits (GluR1, GluR2, GluR3, and GluR4) which combine to form a tetramer and play an important role in mediating the rapid excitatory synaptic current. Furthermore, this N-terminal domain of the iGluRs has homology with LIVBP, a bacterial periplasmic binding protein, as well as with the structurally related glutamate-binding domain of the G-protein-coupled metabotropic receptors (mGluRs). |
| >cd06390 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR1 subunit of the AMPA receptor | Back alignment and domain information |
|---|
| >cd06394 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the KA1 and KA2 subunits of Kainate receptor | Back alignment and domain information |
|---|
| >cd06392 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta1 receptor of an orphan glutamate receptor family | Back alignment and domain information |
|---|
| >cd06383 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors | Back alignment and domain information |
|---|
| >cd06389 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR2 subunit of the AMPA receptor | Back alignment and domain information |
|---|
| >cd06388 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor | Back alignment and domain information |
|---|
| >cd06393 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor | Back alignment and domain information |
|---|
| >cd06380 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor | Back alignment and domain information |
|---|
| >cd06377 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR3 subunit of NMDA receptor family | Back alignment and domain information |
|---|
| >cd06391 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta2 receptor of an orphan glutamate receptor family | Back alignment and domain information |
|---|
| >cd06375 PBP1_mGluR_groupII Ligand binding domain of the group II metabotropic glutamate receptor | Back alignment and domain information |
|---|
| >cd06351 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) | Back alignment and domain information |
|---|
| >cd06361 PBP1_GPC6A_like Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor | Back alignment and domain information |
|---|
| >cd06365 PBP1_Pheromone_receptor Ligand-binding domain of the V2R phermone receptor, a member of the family C receptors within the G-protein coupled receptor superfamily | Back alignment and domain information |
|---|
| >cd06368 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors | Back alignment and domain information |
|---|
| >cd06381 PBP1_iGluR_delta_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of an orphan family of delta receptors, GluRdelta1 and GluRdelta2 | Back alignment and domain information |
|---|
| >cd06386 PBP1_NPR_C_like Ligand-binding domain of type C natriuretic peptide receptor | Back alignment and domain information |
|---|
| >cd06382 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors | Back alignment and domain information |
|---|
| >cd06367 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors | Back alignment and domain information |
|---|
| >cd06378 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR2 subunit of NMDA receptor family | Back alignment and domain information |
|---|
| >cd06364 PBP1_CaSR Ligand-binding domain of the CaSR calcium-sensing receptor, which is a member of the family C receptors within the G-protein coupled receptor superfamily | Back alignment and domain information |
|---|
| >cd06376 PBP1_mGluR_groupIII Ligand-binding domain of the group III metabotropic glutamate receptor | Back alignment and domain information |
|---|
| >cd06379 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor | Back alignment and domain information |
|---|
| >cd06374 PBP1_mGluR_groupI Ligand binding domain of the group I metabotropic glutamate receptor | Back alignment and domain information |
|---|
| >cd06362 PBP1_mGluR Ligand binding domain of the metabotropic glutamate receptors (mGluR) | Back alignment and domain information |
|---|
| >cd06350 PBP1_GPCR_family_C_like Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs) | Back alignment and domain information |
|---|
| >cd06373 PBP1_NPR_like Ligand binding domain of natriuretic peptide receptor (NPR) family | Back alignment and domain information |
|---|
| >cd06269 PBP1_glutamate_receptors_like Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors | Back alignment and domain information |
|---|
| >cd06363 PBP1_Taste_receptor Ligand-binding domain of the T1R taste receptor | Back alignment and domain information |
|---|
| >cd06371 PBP1_sensory_GC_DEF_like Ligand-binding domain of membrane guanylyl cyclases (GC-D, GC-E, and GC-F) that are specifically expressed in sensory tissues | Back alignment and domain information |
|---|
| >cd06385 PBP1_NPR_A Ligand-binding domain of type A natriuretic peptide receptor | Back alignment and domain information |
|---|
| >cd06366 PBP1_GABAb_receptor Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) | Back alignment and domain information |
|---|
| >PF01094 ANF_receptor: Receptor family ligand binding region The Prosite family is a sub-family of the Pfam family; InterPro: IPR001828 This describes a ligand binding domain and includes extracellular ligand binding domains of a wide range of receptors, as well as the bacterial amino acid binding proteins of known structure [] | Back alignment and domain information |
|---|
| >cd06370 PBP1_Speract_GC_like Ligand-binding domain of membrane bound guanylyl cyclases | Back alignment and domain information |
|---|
| >cd06372 PBP1_GC_G_like Ligand-binding domain of membrane guanylyl cyclase G | Back alignment and domain information |
|---|
| >cd06384 PBP1_NPR_B Ligand-binding domain of type B natriuretic peptide receptor | Back alignment and domain information |
|---|
| >KOG1056|consensus | Back alignment and domain information |
|---|
| >cd06352 PBP1_NPR_GC_like Ligand-binding domain of membrane guanylyl-cyclase receptors | Back alignment and domain information |
|---|
| >KOG1054|consensus | Back alignment and domain information |
|---|
| >cd06346 PBP1_ABC_ligand_binding_like_11 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06338 PBP1_ABC_ligand_binding_like_5 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06345 PBP1_ABC_ligand_binding_like_10 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06342 PBP1_ABC_LIVBP_like Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine) | Back alignment and domain information |
|---|
| >cd06340 PBP1_ABC_ligand_binding_like_6 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06347 PBP1_ABC_ligand_binding_like_12 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06348 PBP1_ABC_ligand_binding_like_13 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06335 PBP1_ABC_ligand_binding_like_2 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06330 PBP1_Arsenic_SBP_like Periplasmic solute-binding domain of active transport proteins | Back alignment and domain information |
|---|
| >cd06331 PBP1_AmiC_like Type I periplasmic components of amide-binding protein (AmiC) and the active transport system for short-chain and urea (FmdDEF) | Back alignment and domain information |
|---|
| >cd06329 PBP1_SBP_like_3 Periplasmic solute-binding domain of active transport proteins | Back alignment and domain information |
|---|
| >cd04509 PBP1_ABC_transporter_GCPR_C_like Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems | Back alignment and domain information |
|---|
| >cd06343 PBP1_ABC_ligand_binding_like_8 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06349 PBP1_ABC_ligand_binding_like_14 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems | Back alignment and domain information |
|---|
| >cd06336 PBP1_ABC_ligand_binding_like_3 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06344 PBP1_ABC_ligand_binding_like_9 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >PRK15404 leucine ABC transporter subunit substrate-binding protein LivK; Provisional | Back alignment and domain information |
|---|
| >cd06327 PBP1_SBP_like_1 Periplasmic solute-binding domain of active transport proteins that belong to the type I periplasmic binding fold protein family | Back alignment and domain information |
|---|
| >cd06359 PBP1_Nba_like Type I periplasmic binding component of active transport systems that are predicted to be involved in 2-nitrobenzoic acid degradation pathway | Back alignment and domain information |
|---|
| >cd06360 PBP1_alkylbenzenes_like Type I periplasmic binding component of active transport systems that are predicted be involved in anaerobic biodegradation of alkylbenzenes such as toluene and ethylbenzene | Back alignment and domain information |
|---|
| >cd06268 PBP1_ABC_transporter_LIVBP_like Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily | Back alignment and domain information |
|---|
| >cd06355 PBP1_FmdD_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) | Back alignment and domain information |
|---|
| >cd06358 PBP1_NHase Type I periplasmic-binding protein of the nitrile hydratase (NHase) system that selectively converts nitriles to corresponding amides | Back alignment and domain information |
|---|
| >cd06339 PBP1_YraM_LppC_lipoprotein_like Periplasmic binding component of lipoprotein LppC, an immunodominant antigen | Back alignment and domain information |
|---|
| >cd06328 PBP1_SBP_like_2 Periplasmic solute-binding domain of active transport proteins found in gram-negative and gram-positive bacteria | Back alignment and domain information |
|---|
| >cd06326 PBP1_STKc_like Type I periplasmic binding domain of uncharacterized extracellular ligand-binding proteins | Back alignment and domain information |
|---|
| >cd06334 PBP1_ABC_ligand_binding_like_1 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >COG0683 LivK ABC-type branched-chain amino acid transport systems, periplasmic component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd06337 PBP1_ABC_ligand_binding_like_4 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06332 PBP1_aromatic_compounds_like Type I periplasmic binding proteins of active transport systems that are predicted to be involved in transport of aromatic compounds such as 2-nitrobenzoic acid and alkylbenzenes | Back alignment and domain information |
|---|
| >cd06333 PBP1_ABC-type_HAAT_like Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids | Back alignment and domain information |
|---|
| >TIGR03669 urea_ABC_arch urea ABC transporter, substrate-binding protein, archaeal type | Back alignment and domain information |
|---|
| >PF13458 Peripla_BP_6: Periplasmic binding protein; PDB: 4EVS_A 4EY3_A 4EYG_B 4EYK_A 3H5L_B 3TD9_A 3EAF_A 1Z18_A 1Z17_A 2LIV_A | Back alignment and domain information |
|---|
| >cd06356 PBP1_Amide_Urea_BP_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) | Back alignment and domain information |
|---|
| >cd06369 PBP1_GC_C_enterotoxin_receptor Ligand-binding domain of the membrane guanylyl cyclase C | Back alignment and domain information |
|---|
| >TIGR03407 urea_ABC_UrtA urea ABC transporter, urea binding protein | Back alignment and domain information |
|---|
| >cd06357 PBP1_AmiC Periplasmic binding domain of amidase (AmiC) that belongs to the type I periplasmic binding fold protein family | Back alignment and domain information |
|---|
| >TIGR03863 PQQ_ABC_bind ABC transporter, substrate binding protein, PQQ-dependent alcohol dehydrogenase system | Back alignment and domain information |
|---|
| >cd06341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >KOG4440|consensus | Back alignment and domain information |
|---|
| >cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily | Back alignment and domain information |
|---|
| >KOG1055|consensus | Back alignment and domain information |
|---|
| >KOG1053|consensus | Back alignment and domain information |
|---|
| >PF13433 Peripla_BP_5: Periplasmic binding protein domain; PDB: 1QNL_A 1QO0_A 1PEA_A | Back alignment and domain information |
|---|
| >PF04348 LppC: LppC putative lipoprotein; InterPro: IPR007443 This entry includes several bacterial outer membrane antigens, whose molecular function is unknown | Back alignment and domain information |
|---|
| >cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems | Back alignment and domain information |
|---|
| >cd06320 PBP1_allose_binding Periplasmic allose-binding domain of bacterial transport systems that function as a primary receptor of active transport and chemotaxis | Back alignment and domain information |
|---|
| >cd06300 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-binding component of uncharacterized ABC-type transport systems that are members of the pentose/hexose sugar-binding protein family of the type I periplasmic binding protein superfamily | Back alignment and domain information |
|---|
| >cd06267 PBP1_LacI_sugar_binding_like Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily | Back alignment and domain information |
|---|
| >cd01536 PBP1_ABC_sugar_binding_like Periplasmic sugar-binding domain of active transport systems that are members of the type I periplasmic binding protein (PBP1) superfamily | Back alignment and domain information |
|---|
| >cd06282 PBP1_GntR_like_2 Ligand-binding domain of putative DNA transcription repressors highly similar to that of the repressor specific for gluconate (GntR) which is a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >cd06325 PBP1_ABC_uncharacterized_transporter Type I periplasmic ligand-binding domain of uncharacterized ABC-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions | Back alignment and domain information |
|---|
| >cd06319 PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >cd01545 PBP1_SalR Ligand-binding domain of DNA transcription repressor SalR, a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >cd06323 PBP1_ribose_binding Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs | Back alignment and domain information |
|---|
| >cd06278 PBP1_LacI_like_2 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >cd06309 PBP1_YtfQ_like Periplasmic binding domain of ABC-type YtfQ-like transport systems | Back alignment and domain information |
|---|
| >cd06317 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >cd06298 PBP1_CcpA_like Ligand-binding domain of the catabolite control protein A (CcpA), which functions as the major transcriptional regulator of carbon catabolite repression/regulation | Back alignment and domain information |
|---|
| >cd06312 PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >cd06301 PBP1_rhizopine_binding_like Periplasmic binding proteins specific to rhizopines | Back alignment and domain information |
|---|
| >cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily | Back alignment and domain information |
|---|
| >cd06284 PBP1_LacI_like_6 Ligand-binding domain of an uncharacterized transcription regulator from Actinobacillus succinogenes and its close homologs from other bacteria | Back alignment and domain information |
|---|
| >PRK10014 DNA-binding transcriptional repressor MalI; Provisional | Back alignment and domain information |
|---|
| >PRK10653 D-ribose transporter subunit RbsB; Provisional | Back alignment and domain information |
|---|
| >TIGR01481 ccpA catabolite control protein A | Back alignment and domain information |
|---|
| >cd06275 PBP1_PurR Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli | Back alignment and domain information |
|---|
| >cd06289 PBP1_MalI_like Ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria | Back alignment and domain information |
|---|
| >cd06310 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >cd06313 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A | Back alignment and domain information |
|---|
| >PF00532 Peripla_BP_1: Periplasmic binding proteins and sugar binding domain of LacI family; InterPro: IPR001761 This family includes the periplasmic binding proteins, and the LacI family transcriptional regulators | Back alignment and domain information |
|---|
| >cd06322 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >cd06296 PBP1_CatR_like Ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation | Back alignment and domain information |
|---|
| >TIGR02990 ectoine_eutA ectoine utilization protein EutA | Back alignment and domain information |
|---|
| >cd06271 PBP1_AglR_RafR_like Ligand-binding domain of DNA transcription repressors specific for raffinose (RafR) and alpha-glucosides (AglR) which are members of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >cd06311 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems | Back alignment and domain information |
|---|
| >COG2984 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] | Back alignment and domain information |
|---|
| >PRK11303 DNA-binding transcriptional regulator FruR; Provisional | Back alignment and domain information |
|---|
| >COG1609 PurR Transcriptional regulators [Transcription] | Back alignment and domain information |
|---|
| >cd01574 PBP1_LacI Ligand-binding domain of DNA transcription repressor LacI specific for lactose, a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >cd01542 PBP1_TreR_like Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >cd06281 PBP1_LacI_like_5 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor | Back alignment and domain information |
|---|
| >PRK09756 PTS system N-acetylgalactosamine-specific transporter subunit IIB; Provisional | Back alignment and domain information |
|---|
| >cd06295 PBP1_CelR Ligand binding domain of a transcription regulator of cellulose genes, CelR, which is highly homologous to the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >cd06277 PBP1_LacI_like_1 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >cd06270 PBP1_GalS_like Ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism | Back alignment and domain information |
|---|
| >cd06308 PBP1_sensor_kinase_like Periplasmic binding domain of two-component sensor kinase signaling systems | Back alignment and domain information |
|---|
| >cd06299 PBP1_LacI_like_13 Ligand-binding domain of DNA-binding regulatory protein from Corynebacterium glutamicum which has a unique ability to produce significant amounts of L-glutamate directly from cheap sugar and ammonia | Back alignment and domain information |
|---|
| >cd06280 PBP1_LacI_like_4 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >PRK11425 PTS system N-acetylgalactosamine-specific transporter subunit IIB; Provisional | Back alignment and domain information |
|---|
| >cd06288 PBP1_sucrose_transcription_regulator Ligand-binding domain of DNA-binding regulatory proteins specific to sucrose that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >cd06291 PBP1_Qymf_like Ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs | Back alignment and domain information |
|---|
| >TIGR00854 pts-sorbose PTS system, mannose/fructose/sorbose family, IIB component | Back alignment and domain information |
|---|
| >cd06290 PBP1_LacI_like_9 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >cd06294 PBP1_ycjW_transcription_regulator_like Ligand-binding domain of uncharacterized transcription regulator ycjW which is a member of the LacI-GalR family repressors | Back alignment and domain information |
|---|
| >cd00001 PTS_IIB_man PTS_IIB, PTS system, Mannose/sorbose specific IIB subunit | Back alignment and domain information |
|---|
| >cd06293 PBP1_LacI_like_11 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >cd06279 PBP1_LacI_like_3 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd06274 PBP1_FruR Ligand binding domain of DNA transcription repressor specific for fructose (FruR) and its close homologs | Back alignment and domain information |
|---|
| >PRK10703 DNA-binding transcriptional repressor PurR; Provisional | Back alignment and domain information |
|---|
| >cd06272 PBP1_hexuronate_repressor_like Ligand-binding domain of DNA transcription repressor for the hexuronate utilization operon from Bacillus species and its close homologs from other bacteria, all of which are a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >PRK10423 transcriptional repressor RbsR; Provisional | Back alignment and domain information |
|---|
| >PF03830 PTSIIB_sorb: PTS system sorbose subfamily IIB component; InterPro: IPR004720 Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains | Back alignment and domain information |
|---|
| >cd01575 PBP1_GntR Ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >PRK10727 DNA-binding transcriptional regulator GalR; Provisional | Back alignment and domain information |
|---|
| >cd06286 PBP1_CcpB_like Ligand-binding domain of a novel transcription factor implicated in catabolite repression in Bacillus and Clostridium species | Back alignment and domain information |
|---|
| >PRK09526 lacI lac repressor; Reviewed | Back alignment and domain information |
|---|
| >cd06283 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of DNA transcription repressor RegR and other putative regulators such as KdgR and EndR | Back alignment and domain information |
|---|
| >cd01538 PBP1_ABC_xylose_binding Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily | Back alignment and domain information |
|---|
| >PF04392 ABC_sub_bind: ABC transporter substrate binding protein; InterPro: IPR007487 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems | Back alignment and domain information |
|---|
| >PLN02674 adenylate kinase | Back alignment and domain information |
|---|
| >cd01543 PBP1_XylR Ligand-binding domain of DNA transcription repressor specific for xylose (XylR) | Back alignment and domain information |
|---|
| >COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion] | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >cd01541 PBP1_AraR Ligand-binding domain of DNA transcription repressor specific for arabinose (AraR) which is a member of the LacI-GalR family of bacterial transcription regulators | Back alignment and domain information |
|---|
| >cd06285 PBP1_LacI_like_7 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 149 | ||||
| 3h6g_A | 395 | Crystal Structure Of The Glur6 Amino Terminal Domai | 1e-22 | ||
| 3qlt_A | 395 | Crystal Structure Of A Gluk2 (Glur6) Glycan Wedge H | 1e-22 | ||
| 3olz_A | 398 | Crystal Structure Of The Gluk3 (Glur7) Atd Dimer At | 5e-21 | ||
| 3o2j_A | 388 | Structure Of The Glua2 Ntd-Dimer Interface Mutant, | 2e-06 | ||
| 3om0_A | 393 | Crystal Structure Of The Gluk5 (Ka2) Atd Crystallog | 2e-06 | ||
| 3kg2_A | 823 | Ampa Subtype Ionotropic Glutamate Receptor In Compl | 5e-06 | ||
| 3n6v_A | 374 | Structure Of The Glua2 Ntd-Dimer Interface Mutant, | 5e-06 | ||
| 3hsy_A | 376 | High Resolution Structure Of A Dimeric Glur2 N-Term | 5e-06 | ||
| 3h5v_A | 394 | Crystal Structure Of The Glur2-atd Length = 394 | 6e-06 | ||
| 2wjw_A | 388 | Crystal Structure Of The Human Ionotropic Glutamate | 3e-05 | ||
| 4gpa_A | 389 | High Resolution Structure Of The Glua4 N-Terminal D | 2e-04 | ||
| 3saj_A | 384 | Crystal Structure Of Glutamate Receptor Glua1 Amino | 2e-04 | ||
| 1ewk_A | 490 | Crystal Structure Of Metabotropic Glutamate Recepto | 6e-04 | ||
| 3ks9_A | 496 | Metabotropic Glutamate Receptor Mglur1 Complexed Wi | 6e-04 |
| >pdb|3H6G|A Chain A, Crystal Structure Of The Glur6 Amino Terminal Domain Dimer Assembly Length = 395 | Back alignment and structure |
|
| >pdb|3QLT|A Chain A, Crystal Structure Of A Gluk2 (Glur6) Glycan Wedge Homodimer Assembly Length = 395 | Back alignment and structure |
| >pdb|3OLZ|A Chain A, Crystal Structure Of The Gluk3 (Glur7) Atd Dimer At 2.75 Angstrom Resolution Length = 398 | Back alignment and structure |
| >pdb|3O2J|A Chain A, Structure Of The Glua2 Ntd-Dimer Interface Mutant, N54a Length = 388 | Back alignment and structure |
| >pdb|3OM0|A Chain A, Crystal Structure Of The Gluk5 (Ka2) Atd Crystallographic Dimer At 1.4 Angstrom Resolution Length = 393 | Back alignment and structure |
| >pdb|3KG2|A Chain A, Ampa Subtype Ionotropic Glutamate Receptor In Complex With Competitive Antagonist Zk 200775 Length = 823 | Back alignment and structure |
| >pdb|3N6V|A Chain A, Structure Of The Glua2 Ntd-Dimer Interface Mutant, T78a Length = 374 | Back alignment and structure |
| >pdb|3HSY|A Chain A, High Resolution Structure Of A Dimeric Glur2 N-Terminal Domain (Ntd) Length = 376 | Back alignment and structure |
| >pdb|3H5V|A Chain A, Crystal Structure Of The Glur2-atd Length = 394 | Back alignment and structure |
| >pdb|2WJW|A Chain A, Crystal Structure Of The Human Ionotropic Glutamate Receptor Glur2 Atd Region At 1.8 A Resolution Length = 388 | Back alignment and structure |
| >pdb|4GPA|A Chain A, High Resolution Structure Of The Glua4 N-Terminal Domain (Ntd) Length = 389 | Back alignment and structure |
| >pdb|3SAJ|A Chain A, Crystal Structure Of Glutamate Receptor Glua1 Amino Terminal Domain Length = 384 | Back alignment and structure |
| >pdb|1EWK|A Chain A, Crystal Structure Of Metabotropic Glutamate Receptor Subtype 1 Complexed With Glutamate Length = 490 | Back alignment and structure |
| >pdb|3KS9|A Chain A, Metabotropic Glutamate Receptor Mglur1 Complexed With Ly341495 Antagonist Length = 496 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 149 | |||
| 3kg2_A | 823 | Glutamate receptor 2; ION channel, membrane protei | 9e-31 | |
| 3h6g_A | 395 | Glutamate receptor, ionotropic kainate 2; membrane | 7e-30 | |
| 3om0_A | 393 | Glutamate receptor, ionotropic kainate 5; membrane | 1e-26 | |
| 3o21_A | 389 | Glutamate receptor 3; periplasmatic binding protei | 6e-26 | |
| 3hsy_A | 376 | Glutamate receptor 2; ligand-gated ION channel, sy | 6e-26 | |
| 3saj_A | 384 | Glutamate receptor 1; rossman fold, ION channel, m | 5e-25 | |
| 3qel_B | 364 | Glutamate [NMDA] receptor subunit epsilon-2; ION c | 1e-16 | |
| 3qek_A | 384 | NMDA glutamate receptor subunit; amino terminal do | 3e-16 | |
| 1jdp_A | 441 | NPR-C, atrial natriuretic peptide clearance recept | 1e-06 | |
| 4f11_A | 433 | Gamma-aminobutyric acid type B receptor subunit 2; | 4e-06 | |
| 1dp4_A | 435 | Atrial natriuretic peptide receptor A; periplasmic | 2e-05 |
| >3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Length = 823 | Back alignment and structure |
|---|
Score = 115 bits (288), Expect = 9e-31
Identities = 34/155 (21%), Positives = 60/155 (38%), Gaps = 11/155 (7%)
Query: 2 AEATMCRQLQNGVQALFGPSDALLGPHVQSICEALDVPHMESRLDLELNSKEFSVNLYPS 61
C Q GV A+FG D + S C L V + + F + + P
Sbjct: 49 VTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFP-TDGTHPFVIQMRPD 107
Query: 62 QKLLNAAFKDVIRFLNWTKVAIVYEEDNGLFKLQELVKTPPTLKTEMYIRH-------AN 114
L A +I + W K A +Y+ D GL LQ ++ + K ++ +
Sbjct: 108 ---LKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKK 164
Query: 115 PSTYRNVLREIRQKEIFNLIIDTSTTHISQFFRAV 149
TYR++ +++ K+ +I+D ++ V
Sbjct: 165 DETYRSLFQDLELKKERRVILDCERDKVNDIVDQV 199
|
| >3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Length = 395 | Back alignment and structure |
|---|
| >3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Length = 393 | Back alignment and structure |
|---|
| >3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Length = 389 | Back alignment and structure |
|---|
| >3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Length = 376 | Back alignment and structure |
|---|
| >3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Length = 384 | Back alignment and structure |
|---|
| >3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* Length = 364 | Back alignment and structure |
|---|
| >3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* Length = 384 | Back alignment and structure |
|---|
| >1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Length = 441 | Back alignment and structure |
|---|
| >4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Length = 433 | Back alignment and structure |
|---|
| >1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Length = 435 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| 3h6g_A | 395 | Glutamate receptor, ionotropic kainate 2; membrane | 99.94 | |
| 4gpa_A | 389 | Glutamate receptor 4; PBP fold, ligand-gated ION c | 99.94 | |
| 3o21_A | 389 | Glutamate receptor 3; periplasmatic binding protei | 99.94 | |
| 3qel_B | 364 | Glutamate [NMDA] receptor subunit epsilon-2; ION c | 99.93 | |
| 3hsy_A | 376 | Glutamate receptor 2; ligand-gated ION channel, sy | 99.93 | |
| 3om0_A | 393 | Glutamate receptor, ionotropic kainate 5; membrane | 99.92 | |
| 3sm9_A | 479 | Mglur3, metabotropic glutamate receptor 3; structu | 99.92 | |
| 3qek_A | 384 | NMDA glutamate receptor subunit; amino terminal do | 99.92 | |
| 1jdp_A | 441 | NPR-C, atrial natriuretic peptide clearance recept | 99.92 | |
| 3ks9_A | 496 | Mglur1, metabotropic glutamate receptor 1; glutama | 99.91 | |
| 2e4u_A | 555 | Metabotropic glutamate receptor 3; G-protein-coupl | 99.91 | |
| 3saj_A | 384 | Glutamate receptor 1; rossman fold, ION channel, m | 99.91 | |
| 3kg2_A | 823 | Glutamate receptor 2; ION channel, membrane protei | 99.91 | |
| 4f11_A | 433 | Gamma-aminobutyric acid type B receptor subunit 2; | 99.91 | |
| 3mq4_A | 481 | Mglur7, metabotropic glutamate receptor 7; glutama | 99.9 | |
| 1dp4_A | 435 | Atrial natriuretic peptide receptor A; periplasmic | 99.89 | |
| 3h5l_A | 419 | Putative branched-chain amino acid ABC transporter | 99.81 | |
| 3i45_A | 387 | Twin-arginine translocation pathway signal protei; | 99.8 | |
| 3i09_A | 375 | Periplasmic branched-chain amino acid-binding Pro; | 99.78 | |
| 3n0w_A | 379 | ABC branched chain amino acid family transporter, | 99.77 | |
| 4eyg_A | 368 | Twin-arginine translocation pathway signal; PSI-bi | 99.76 | |
| 3td9_A | 366 | Branched chain amino acid ABC transporter, peripl | 99.76 | |
| 3ipc_A | 356 | ABC transporter, substrate binding protein (amino; | 99.74 | |
| 4f06_A | 371 | Extracellular ligand-binding receptor; PSI-biology | 99.74 | |
| 3lop_A | 364 | Substrate binding periplasmic protein; protein str | 99.73 | |
| 3eaf_A | 391 | ABC transporter, substrate binding protein; PSI2, | 99.72 | |
| 3sg0_A | 386 | Extracellular ligand-binding receptor; structural | 99.7 | |
| 3snr_A | 362 | Extracellular ligand-binding receptor; structural | 99.7 | |
| 3hut_A | 358 | Putative branched-chain amino acid ABC transporter | 99.7 | |
| 4evq_A | 375 | Putative ABC transporter subunit, substrate-bindi | 99.7 | |
| 1usg_A | 346 | Leucine-specific binding protein; leucine-binding | 99.69 | |
| 3lkb_A | 392 | Probable branched-chain amino acid ABC transporter | 99.68 | |
| 3n0x_A | 374 | Possible substrate binding protein of ABC transpo | 99.68 | |
| 4gnr_A | 353 | ABC transporter substrate-binding protein-branche | 99.58 | |
| 1pea_A | 385 | Amidase operon; gene regulator, receptor, binding | 99.57 | |
| 2h4a_A | 325 | YRAM (HI1655); perplasmic binding protein, lipopro | 99.44 | |
| 3ckm_A | 327 | YRAM (HI1655), LPOA; periplasmic-binding protein, | 99.37 | |
| 2h3h_A | 313 | Sugar ABC transporter, periplasmic sugar-binding p | 97.0 | |
| 3rot_A | 297 | ABC sugar transporter, periplasmic sugar binding; | 96.68 | |
| 3o74_A | 272 | Fructose transport system repressor FRUR; dual tra | 96.63 | |
| 3ksm_A | 276 | ABC-type sugar transport system, periplasmic COMP; | 96.01 | |
| 2fn9_A | 290 | Ribose ABC transporter, periplasmic ribose-bindin; | 95.93 | |
| 1dbq_A | 289 | Purine repressor; transcription regulation, DNA-bi | 95.81 | |
| 3c3k_A | 285 | Alanine racemase; structural genomics, protein str | 95.61 | |
| 3brq_A | 296 | HTH-type transcriptional regulator ASCG; transcrip | 95.6 | |
| 3g1w_A | 305 | Sugar ABC transporter; sugar-binding protein, baci | 95.44 | |
| 2iks_A | 293 | DNA-binding transcriptional dual regulator; escher | 95.35 | |
| 3dbi_A | 338 | Sugar-binding transcriptional regulator, LACI FAM; | 95.31 | |
| 3gbv_A | 304 | Putative LACI-family transcriptional regulator; NY | 95.28 | |
| 2x7x_A | 325 | Sensor protein; transferase, sensor histidine kina | 95.2 | |
| 3hcw_A | 295 | Maltose operon transcriptional repressor; RNA-bind | 95.1 | |
| 1tjy_A | 316 | Sugar transport protein; protein-ligand complex, s | 95.03 | |
| 3l6u_A | 293 | ABC-type sugar transport system periplasmic compo; | 94.93 | |
| 3e61_A | 277 | Putative transcriptional repressor of ribose OPER; | 94.77 | |
| 2qu7_A | 288 | Putative transcriptional regulator; structural gen | 94.77 | |
| 3brs_A | 289 | Periplasmic binding protein/LACI transcriptional; | 94.68 | |
| 3jy6_A | 276 | Transcriptional regulator, LACI family; NYSGXRC, P | 94.57 | |
| 2qh8_A | 302 | Uncharacterized protein; conserved domain protein, | 94.4 | |
| 3qk7_A | 294 | Transcriptional regulators; structural genomics, N | 94.36 | |
| 3k9c_A | 289 | Transcriptional regulator, LACI family protein; PS | 94.36 | |
| 2h0a_A | 276 | TTHA0807, transcriptional regulator; repressor, st | 94.34 | |
| 3l49_A | 291 | ABC sugar (ribose) transporter, periplasmic substr | 94.33 | |
| 3tb6_A | 298 | Arabinose metabolism transcriptional repressor; tr | 94.29 | |
| 2fep_A | 289 | Catabolite control protein A; CCPA, transcriptiona | 94.28 | |
| 2o20_A | 332 | Catabolite control protein A; CCPA, transcriptiona | 94.24 | |
| 3gyb_A | 280 | Transcriptional regulators (LACI-family transcript | 94.1 | |
| 2rjo_A | 332 | Twin-arginine translocation pathway signal protei; | 94.0 | |
| 2rgy_A | 290 | Transcriptional regulator, LACI family; 11011J, NY | 93.94 | |
| 3o1i_D | 304 | Periplasmic protein TORT; ligand free, two compone | 93.88 | |
| 3egc_A | 291 | Putative ribose operon repressor; structural genom | 93.85 | |
| 3d8u_A | 275 | PURR transcriptional regulator; APC91343.1, vibrio | 93.8 | |
| 3bbl_A | 287 | Regulatory protein of LACI family; protein structu | 93.77 | |
| 3kke_A | 303 | LACI family transcriptional regulator; structural | 93.65 | |
| 1qpz_A | 340 | PURA, protein (purine nucleotide synthesis repress | 93.6 | |
| 2hsg_A | 332 | Glucose-resistance amylase regulator; CCPA, transc | 93.52 | |
| 3lft_A | 295 | Uncharacterized protein; ABC, ATPase, cassette, L- | 93.49 | |
| 3gv0_A | 288 | Transcriptional regulator, LACI family; transcript | 93.38 | |
| 3clk_A | 290 | Transcription regulator; 11017J, PSI-II, NYSGXRC, | 93.16 | |
| 4fe7_A | 412 | Xylose operon regulatory protein; HTH_ARAC, helix- | 93.15 | |
| 3d02_A | 303 | Putative LACI-type transcriptional regulator; peri | 93.03 | |
| 2fvy_A | 309 | D-galactose-binding periplasmic protein; periplasm | 92.89 | |
| 3k4h_A | 292 | Putative transcriptional regulator; structural gen | 92.54 | |
| 2ioy_A | 283 | Periplasmic sugar-binding protein; ribose binding | 92.53 | |
| 3cs3_A | 277 | Sugar-binding transcriptional regulator, LACI FAM; | 92.48 | |
| 3bil_A | 348 | Probable LACI-family transcriptional regulator; st | 92.11 | |
| 2vk2_A | 306 | YTFQ, ABC transporter periplasmic-binding protein | 92.06 | |
| 2rbg_A | 126 | Putative uncharacterized protein ST0493; hypotheti | 91.6 | |
| 3h5o_A | 339 | Transcriptional regulator GNTR; transcription regu | 91.08 | |
| 3m9w_A | 313 | D-xylose-binding periplasmic protein; xylose bindi | 90.9 | |
| 3g85_A | 289 | Transcriptional regulator (LACI family); transcrip | 90.58 | |
| 3h75_A | 350 | Periplasmic sugar-binding domain protein; protein | 90.03 | |
| 3hs3_A | 277 | Ribose operon repressor; PSI-II, NYSGXRC, periplas | 89.36 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 88.52 | |
| 3jvd_A | 333 | Transcriptional regulators; structural genomics, P | 88.36 | |
| 3kjx_A | 344 | Transcriptional regulator, LACI family; LACL famil | 87.79 | |
| 3huu_A | 305 | Transcription regulator like protein; PSI-II, NYSG | 87.66 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 87.52 | |
| 1byk_A | 255 | Protein (trehalose operon repressor); LACI family, | 86.9 | |
| 3ctp_A | 330 | Periplasmic binding protein/LACI transcriptional; | 86.57 | |
| 1jye_A | 349 | Lactose operon repressor; gene regulation, protein | 86.28 | |
| 3h5t_A | 366 | Transcriptional regulator, LACI family; DNA-depend | 85.53 | |
| 1jx6_A | 342 | LUXP protein; protein-ligand complex, signaling pr | 85.37 | |
| 3e3m_A | 355 | Transcriptional regulator, LACI family; structural | 85.22 | |
| 3ixl_A | 240 | Amdase, arylmalonate decarboxylase; enantioselecti | 84.08 | |
| 2fqx_A | 318 | Membrane lipoprotein TMPC; ABC transport system, l | 80.58 |
| >3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* | Back alignment and structure |
|---|
Probab=99.94 E-value=2.1e-26 Score=172.97 Aligned_cols=148 Identities=35% Similarity=0.652 Sum_probs=132.4
Q ss_pred hHHHHHHHhhCCcEEEEcCCCCCcHHHHHHhhcccCCCceeeccC-CC-CCCcccEEEecCChhHHHHHHHHHHHhcCCc
Q psy18065 2 AEATMCRQLQNGVQALFGPSDALLGPHVQSICEALDVPHMESRLD-LE-LNSKEFSVNLYPSQKLLNAAFKDVIRFLNWT 79 (149)
Q Consensus 2 ~~~~~c~~~~~~v~aiiGp~~s~~~~~v~~~~~~~~iP~is~~~~-~~-~~~~~~~~~~~p~~~~~~~ai~~ll~~~~W~ 79 (149)
+.+..|++++++|.+||||.+|..+.+++++++.+++|+|++++. +. .+..+|+||+.|++..++.++++++++|||+
T Consensus 60 ~~~~a~~l~~~~V~aiiG~~~S~~~~a~~~~~~~~~ip~is~~~~~~~l~~~~~~~~r~~~~~~~~~~~~~~~~~~~g~~ 139 (395)
T 3h6g_A 60 ASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWK 139 (395)
T ss_dssp HHHHHHHHHHHCCSCEECCSSHHHHHHHHHHHHHTTCCEEECSCCCCCTTCCCCSEEEEEECHHHHHHHHHHHHHHTTCS
T ss_pred HHHHHHHhhhcCcEEEECCCChhHHHHHHHHHhcCCCCeEeeccCcccccccCceEEEecCCHHHHHHHHHHHHHHCCCe
Confidence 356789999989999999999999999999999999999998753 22 3456889999999999999999999999999
Q ss_pred EEEEEeecCcchhhHHHHHhCCCCCCceEEEEecCC--CchHHHHHHHHhCCCceEEEecCchhHHHHHhhC
Q psy18065 80 KVAIVYEEDNGLFKLQELVKTPPTLKTEMYIRHANP--STYRNVLREIRQKEIFNLIIDTSTTHISQFFRAV 149 (149)
Q Consensus 80 ~v~vi~~~~~~~~~l~~l~~~~~~~~~~v~~~~~~~--~d~~~~l~~i~~~~~~~iil~~~~~~~~~il~qA 149 (149)
||+++|++++|...++.+.+.+++.|+++...+++. .|+..++++|+++++++|++.+....+..+++||
T Consensus 140 ~v~ii~d~~~g~~~~~~~~~~~~~~g~~v~~~~~~~~~~d~~~~l~~i~~~~~~vi~~~~~~~~~~~~~~qa 211 (395)
T 3h6g_A 140 TVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQA 211 (395)
T ss_dssp EEEEEESSTHHHHHTHHHHTGGGTSSCEEEEEECCSSGGGGHHHHHHHHHTTCCEEEEESCHHHHHHHHHHH
T ss_pred EEEEEEEChhHHHHHHHHHHhhhcCCceEEEEEeCCCchhHHHHHHHHhhcCCeEEEEECCHHHHHHHHHHH
Confidence 999999888899889999988888899987766653 5899999999999999999999999999999885
|
| >4gpa_A Glutamate receptor 4; PBP fold, ligand-gated ION channel, ION transport, transmembrane AMPA receptor regulating proteins, cornichons, ckamp44; HET: NAG; 2.25A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A | Back alignment and structure |
|---|
| >3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* | Back alignment and structure |
|---|
| >3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A | Back alignment and structure |
|---|
| >3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A | Back alignment and structure |
|---|
| >3sm9_A Mglur3, metabotropic glutamate receptor 3; structural genomics, structural genomics consortium, SGC, CE membrane, G-protein coupled receptor; HET: Z99; 2.26A {Homo sapiens} | Back alignment and structure |
|---|
| >3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* | Back alignment and structure |
|---|
| >1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* | Back alignment and structure |
|---|
| >3ks9_A Mglur1, metabotropic glutamate receptor 1; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99 NAG; 1.90A {Homo sapiens} SCOP: c.93.1.1 PDB: 1ewk_A* 1ewt_A* 1ewv_A 1isr_A* 1iss_A* 3lmk_A* | Back alignment and structure |
|---|
| >2e4u_A Metabotropic glutamate receptor 3; G-protein-coupled receptor, neuron, central nerve system, SI protein; HET: NAG GLU; 2.35A {Rattus norvegicus} PDB: 2e4v_A* 2e4w_A* 2e4x_A* 2e4y_A* | Back alignment and structure |
|---|
| >3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* | Back alignment and structure |
|---|
| >3mq4_A Mglur7, metabotropic glutamate receptor 7; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99; 2.80A {Homo sapiens} SCOP: c.93.1.0 PDB: 2e4z_A* | Back alignment and structure |
|---|
| >1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* | Back alignment and structure |
|---|
| >3h5l_A Putative branched-chain amino acid ABC transporter; structural genomics, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} | Back alignment and structure |
|---|
| >3i45_A Twin-arginine translocation pathway signal protei; structural genomics; 1.36A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >3i09_A Periplasmic branched-chain amino acid-binding Pro; type I periplasmic binding protein, structural genomics, JOI for structural genomics; HET: MSE CIT; 1.80A {Burkholderia mallei} | Back alignment and structure |
|---|
| >3n0w_A ABC branched chain amino acid family transporter, periplasmic ligand binding protein...; receptor family ligand binding region; HET: MSE; 1.88A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >4eyg_A Twin-arginine translocation pathway signal; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: VNL; 1.86A {Rhodopseudomonas palustris} PDB: 4ey3_A* 3t0n_A* 4eyk_A* | Back alignment and structure |
|---|
| >3td9_A Branched chain amino acid ABC transporter, peripl amino acid-binding protein; leucine binding, structural genomics; HET: MSE PHE; 1.90A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3ipc_A ABC transporter, substrate binding protein (amino; venus flytrap domain, transport protein; 1.30A {Agrobacterium tumefaciens} PDB: 3ip5_A 3ip6_A 3ip7_A 3ip9_A 3ipa_A | Back alignment and structure |
|---|
| >4f06_A Extracellular ligand-binding receptor; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: MSE PHB; 1.30A {Rhodopseudomonas palustris} PDB: 4evs_A* | Back alignment and structure |
|---|
| >3lop_A Substrate binding periplasmic protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.55A {Ralstonia solanacearum} | Back alignment and structure |
|---|
| >3eaf_A ABC transporter, substrate binding protein; PSI2, NYSGXRC, substrate binding P structural genomics, protein structure initiative; 2.00A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3sg0_A Extracellular ligand-binding receptor; structural genomics, PSI-biology; HET: 173; 1.20A {Rhodopseudomonas palustris} PDB: 4dqd_A* | Back alignment and structure |
|---|
| >3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170} | Back alignment and structure |
|---|
| >4evq_A Putative ABC transporter subunit, substrate-bindi component; structural genomics, PSI-biology, midwest center for structu genomics; HET: MSE PHB; 1.40A {Rhodopseudomonas palustris} PDB: 4evr_A | Back alignment and structure |
|---|
| >1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} SCOP: c.93.1.1 PDB: 1usi_A* 1usk_A 2lbp_A 1z15_A 1z16_A 1z17_A 1z18_A 2liv_A | Back alignment and structure |
|---|
| >3lkb_A Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3n0x_A Possible substrate binding protein of ABC transpo system; receptor family ligand binding region, structural genomics; HET: MSE; 1.50A {Rhodopseudomonas palustris} PDB: 3nnd_B | Back alignment and structure |
|---|
| >4gnr_A ABC transporter substrate-binding protein-branche amino acid transport; amino acid-binding protein, surface-exposed protein; HET: MLY; 1.00A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1pea_A Amidase operon; gene regulator, receptor, binding protein; 2.10A {Pseudomonas aeruginosa} SCOP: c.93.1.1 PDB: 1qo0_A 1qnl_A | Back alignment and structure |
|---|
| >3ckm_A YRAM (HI1655), LPOA; periplasmic-binding protein, lipoprotein, unliganded, biosynthetic protein; 1.35A {Haemophilus influenzae} SCOP: c.93.1.1 | Back alignment and structure |
|---|
| >2h3h_A Sugar ABC transporter, periplasmic sugar-binding protein; glucose binding protein, periplasmic binding protein, GBP; HET: BGC; 1.70A {Thermotoga maritima} PDB: 2qvc_A* 3c6q_B* | Back alignment and structure |
|---|
| >3rot_A ABC sugar transporter, periplasmic sugar binding; nysgrc, PSI-biology, structural genomics; 1.91A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3o74_A Fructose transport system repressor FRUR; dual transcriptional regulator, DNA, transcription; 2.00A {Pseudomonas putida} PDB: 3o75_A* | Back alignment and structure |
|---|
| >3ksm_A ABC-type sugar transport system, periplasmic COMP; periplasmic component, PSI- 11023L, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis} | Back alignment and structure |
|---|
| >2fn9_A Ribose ABC transporter, periplasmic ribose-bindin; RBP, ribose binding protein, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima} PDB: 2fn8_A* | Back alignment and structure |
|---|
| >1dbq_A Purine repressor; transcription regulation, DNA-binding regulatory protein; 2.20A {Escherichia coli} SCOP: c.93.1.1 PDB: 1jhz_A | Back alignment and structure |
|---|
| >3c3k_A Alanine racemase; structural genomics, protein structure initiative, NEW YORK research center for structural genomics, nysgxrc; 1.99A {Actinobacillus succinogenes} | Back alignment and structure |
|---|
| >3brq_A HTH-type transcriptional regulator ASCG; transcriptional repressor structure escherichia coli, struct genomics, PSI-2; HET: FRU; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3g1w_A Sugar ABC transporter; sugar-binding protein, bacillus halod target 11229F, transport protein, structural genomics; 2.02A {Bacillus halodurans c-125} | Back alignment and structure |
|---|
| >2iks_A DNA-binding transcriptional dual regulator; escherichia coli structural genomics, PSI-2, protein structure initiative; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >3dbi_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} | Back alignment and structure |
|---|
| >3gbv_A Putative LACI-family transcriptional regulator; NYSGXRC, PSI-II, 11231J, structur genomics, protein structure initiative; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2x7x_A Sensor protein; transferase, sensor histidine kinase; HET: FRU; 2.64A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3hcw_A Maltose operon transcriptional repressor; RNA-binding, PSI-2, NYSGXRC, STRU genomics, protein structure initiative; 2.20A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1tjy_A Sugar transport protein; protein-ligand complex, signaling protein; HET: PAV; 1.30A {Salmonella typhimurium} SCOP: c.93.1.1 PDB: 1tm2_A 3t95_A* 3ejw_A* | Back alignment and structure |
|---|
| >3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} | Back alignment and structure |
|---|
| >3e61_A Putative transcriptional repressor of ribose OPER; structural genomics, DNA-binding, transcripti regulation, PSI-2; 2.00A {Staphylococcus saprophyticus subsp} | Back alignment and structure |
|---|
| >2qu7_A Putative transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 2.30A {Staphylococcus saprophyticus subsp} | Back alignment and structure |
|---|
| >3brs_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; 2.00A {Clostridium phytofermentans} | Back alignment and structure |
|---|
| >3jy6_A Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein S initiative, structural genomics; 1.97A {Lactobacillus brevis} | Back alignment and structure |
|---|
| >3qk7_A Transcriptional regulators; structural genomics, NEW YORK structural genomix research CO NYSGXRC, PSI-2, protein structur initiative; 2.70A {Yersinia pestis} | Back alignment and structure |
|---|
| >3k9c_A Transcriptional regulator, LACI family protein; PSI-II, 11026W, structural genomics, PR structure initiative; 2.14A {Rhodococcus jostii} | Back alignment and structure |
|---|
| >2h0a_A TTHA0807, transcriptional regulator; repressor, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3tb6_A Arabinose metabolism transcriptional repressor; transcription regulation, arabinose binding, DNA binding Pro; HET: ARB; 2.21A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2fep_A Catabolite control protein A; CCPA, transcriptional regulator; HET: SEP; 2.45A {Bacillus subtilis} PDB: 2nzu_G* 1sxh_A 1sxi_A 1sxg_A* 2nzv_G* 2oen_G* | Back alignment and structure |
|---|
| >2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix, transcrip; 1.90A {Lactococcus lactis} | Back alignment and structure |
|---|
| >3gyb_A Transcriptional regulators (LACI-family transcriptional regulatory protein); protein structure initiative II(PSI II), nysgxrc; 1.60A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2rjo_A Twin-arginine translocation pathway signal protei; PSI-2, NYSGXRC, twin arginine translocation pathway signal P structural genomics; HET: GAL; 2.05A {Burkholderia phytofirmans} | Back alignment and structure |
|---|
| >2rgy_A Transcriptional regulator, LACI family; 11011J, NYSGXRC, transctiptional regulator, SUG binding protein, structural genomics, PSI-2; 2.05A {Burkholderia phymatum} | Back alignment and structure |
|---|
| >3o1i_D Periplasmic protein TORT; ligand free, two component sensor, periplasmic binding prote signaling protein; HET: PE4; 2.80A {Vibrio parahaemolyticus} PDB: 3o1h_B* 3o1j_C | Back alignment and structure |
|---|
| >3egc_A Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcri transcription regulation, PSI-2; 2.35A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3d8u_A PURR transcriptional regulator; APC91343.1, vibrio parahaem RIMD 2210633, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.88A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >3bbl_A Regulatory protein of LACI family; protein structure initiative II, PSI-II, NYSGXRC, transcript regulator, periplasmic binding protein; 2.35A {Chloroflexus aggregans} | Back alignment and structure |
|---|
| >3kke_A LACI family transcriptional regulator; structural genomics, DNA-binding, transcription regulation, PSI-2; 2.20A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >1qpz_A PURA, protein (purine nucleotide synthesis repressor); transcription regulation, DNA-binding, purine biosynthesis; HET: DNA HPA; 2.50A {Escherichia coli} SCOP: a.35.1.5 c.93.1.1 PDB: 1bdi_A* 1qp0_A* 1qp4_A* 1pnr_A* 1wet_A* 1zay_A* 1vpw_A* 2pue_A* 2puf_A* 2pug_A* 1bdh_A* 1qp7_A* 1qqa_A* 1qqb_A* 2puc_A* 2pua_A* 2pub_A* 2pud_A* 1jfs_A* 1jh9_A* ... | Back alignment and structure |
|---|
| >2hsg_A Glucose-resistance amylase regulator; CCPA, transcriptional regulator, transcription regulator; 2.50A {Bacillus megaterium} SCOP: a.35.1.5 c.93.1.1 PDB: 1rzr_G 2jcg_A 1zvv_A 3oqo_A* 3oqm_A* 3oqn_A* | Back alignment and structure |
|---|
| >3lft_A Uncharacterized protein; ABC, ATPase, cassette, L-Trp, PSI, MCSG, structural genomics center for structural genomics; HET: MSE TRP; 1.35A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3gv0_A Transcriptional regulator, LACI family; transcription regulator, PSI-II, structural genomics structure initiative; 2.35A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3clk_A Transcription regulator; 11017J, PSI-II, NYSGXRC, dimer, structural genomics, protein structure initiative; 2.08A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >4fe7_A Xylose operon regulatory protein; HTH_ARAC, helix-turn-helix, PBP, periplasmic binding protein binding transcription regulator, DNA xylose; HET: XYS; 2.90A {Escherichia coli} PDB: 4fe4_A | Back alignment and structure |
|---|
| >3d02_A Putative LACI-type transcriptional regulator; periplasmic sugar-binding protein, structura genomics; HET: MSE GOL; 1.30A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2fvy_A D-galactose-binding periplasmic protein; periplasmic binding protien, hinge, chemotaxis, transport,; HET: BGC; 0.92A {Escherichia coli} SCOP: c.93.1.1 PDB: 1glg_A* 2fw0_A* 2gbp_A* 2qw1_A* 2hph_A* 2ipn_A* 2ipm_A* 2ipl_A* 1gca_A* 1gcg_A 3ga5_A* 3gbp_A* | Back alignment and structure |
|---|
| >3k4h_A Putative transcriptional regulator; structural genomics, protein structure INI NEW YORK structural genomix research consortium; HET: MAL; 2.80A {Bacillus cytotoxicus nvh 391-98} | Back alignment and structure |
|---|
| >2ioy_A Periplasmic sugar-binding protein; ribose binding protein, thermophilic proteins; HET: RIP; 1.90A {Thermoanaerobacter tengcongensis} | Back alignment and structure |
|---|
| >3cs3_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative; 2.40A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3bil_A Probable LACI-family transcriptional regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >2vk2_A YTFQ, ABC transporter periplasmic-binding protein YTFQ; transport protein, galactofuranose; HET: GZL; 1.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2rbg_A Putative uncharacterized protein ST0493; hypothetical protein, structural genomics, unknown function, NPPSFA; 1.75A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3h5o_A Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum} | Back alignment and structure |
|---|
| >3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* | Back alignment and structure |
|---|
| >3g85_A Transcriptional regulator (LACI family); transcription regulator, PSI-II, structural genomics structure initiative; 1.84A {Clostridium acetobutylicum atcc 824} | Back alignment and structure |
|---|
| >3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} | Back alignment and structure |
|---|
| >3hs3_A Ribose operon repressor; PSI-II, NYSGXRC, periplasmic binding protein, structural genomics, protein structure initiative; 1.60A {Lactobacillus acidophilus} | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >3jvd_A Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcrip regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3huu_A Transcription regulator like protein; PSI-II, NYSGXRC, LAC I, STR genomics, protein structure initiative; 1.95A {Staphylococcus haemolyticus} | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >1byk_A Protein (trehalose operon repressor); LACI family, phosphate binding, protein structure, trehalose repressor, gene regulation; HET: T6P; 2.50A {Escherichia coli} SCOP: c.93.1.1 | Back alignment and structure |
|---|
| >3ctp_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; HET: XLF; 1.41A {Alkaliphilus metalliredigens} | Back alignment and structure |
|---|
| >1jye_A Lactose operon repressor; gene regulation, protein stability, protein DNA-binding, transcription; 1.70A {Escherichia coli} SCOP: c.93.1.1 PDB: 1lbi_A 1lbg_A* 1lbh_A 1jyf_A 3edc_A 1efa_A* 1jwl_A* 2pe5_A* 1tlf_A* 2p9h_A* 2paf_A* 1cjg_A* 1l1m_A 1osl_A 2kei_A* 2kej_A* 2kek_A* 2bjc_A 1lqc_A 1lcc_A* ... | Back alignment and structure |
|---|
| >3h5t_A Transcriptional regulator, LACI family; DNA-dependent, protein structure initiative II(PSI II), NYSGXRC, 11232D), structural genomics; 2.53A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1jx6_A LUXP protein; protein-ligand complex, signaling protein; HET: AI2; 1.50A {Vibrio harveyi} SCOP: c.93.1.1 PDB: 1zhh_A* 2hj9_A* | Back alignment and structure |
|---|
| >3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >3ixl_A Amdase, arylmalonate decarboxylase; enantioselective decarboxylation, lyase; HET: CME PAC; 1.45A {Bordetella bronchiseptica} PDB: 3ixm_A 2vlb_A 3dg9_A 3ip8_A* 3dtv_A* 3eis_A* | Back alignment and structure |
|---|
| >2fqx_A Membrane lipoprotein TMPC; ABC transport system, ligand-binding protein, guanosine, TP0319, transport protein; HET: GMP; 1.70A {Treponema pallidum} PDB: 2fqw_A* 2fqy_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 149 | |||
| d1ewka_ | 477 | Metabotropic glutamate receptor subtype 1 {Rat (Ra | 99.93 | |
| d1jdpa_ | 401 | Hormone binding domain of the atrial natriuretic p | 99.78 | |
| d1dp4a_ | 425 | Hormone binding domain of the atrial natriuretic p | 99.78 | |
| d1usga_ | 346 | Leucine-binding protein {Escherichia coli [TaxId: | 99.65 | |
| d1qo0a_ | 373 | Amide receptor/negative regulator of the amidase o | 99.59 | |
| d3ckma1 | 317 | YraM C-terminal domain {Haemophilus influenzae [Ta | 99.38 | |
| d1jyea_ | 271 | Lac-repressor (lacR) core (C-terminal domain) {Esc | 96.18 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 93.98 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 91.35 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 91.23 | |
| d1byka_ | 255 | Trehalose repressor, C-terminal domain {Escherichi | 89.43 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 89.24 | |
| d1jx6a_ | 338 | Quorum-sensing signal (autoinducer-2) binding prot | 88.86 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 88.23 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 86.86 | |
| d1dbqa_ | 282 | Purine repressor (PurR), C-terminal domain {Escher | 86.3 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 86.06 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 85.42 | |
| d1nrza_ | 163 | Sorbose permease subunit IIb , EIIb-sor {Klebsiell | 84.45 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 83.55 | |
| d1e5da1 | 152 | Rubredoxin oxygen:oxidoreductase (ROO), C-terminal | 82.5 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 82.15 | |
| d1blea_ | 161 | Fructose permease, subunit IIb {Bacillus subtilis | 81.95 |
| >d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Periplasmic binding protein-like I superfamily: Periplasmic binding protein-like I family: L-arabinose binding protein-like domain: Metabotropic glutamate receptor subtype 1 species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.93 E-value=5.3e-26 Score=173.13 Aligned_cols=139 Identities=16% Similarity=0.311 Sum_probs=119.2
Q ss_pred hCCcEEEEcCCCCCcHHHHHHhhcccCCCceeeccC-C--C-CCCcccEEEecCChhHHHHHHHHHHHhcCCcEEEEEee
Q psy18065 11 QNGVQALFGPSDALLGPHVQSICEALDVPHMESRLD-L--E-LNSKEFSVNLYPSQKLLNAAFKDVIRFLNWTKVAIVYE 86 (149)
Q Consensus 11 ~~~v~aiiGp~~s~~~~~v~~~~~~~~iP~is~~~~-~--~-~~~~~~~~~~~p~~~~~~~ai~~ll~~~~W~~v~vi~~ 86 (149)
.++|.|||||.+|..+.+++.+++.++||+|++++. + + ...+|+++|+.|++..+++++++++++|||++|++||+
T Consensus 118 ~~~v~aviGp~~s~~s~~va~~~~~~~iP~IS~~ats~~lsd~~~yp~f~Rt~psd~~~~~ai~~ll~~f~W~~V~vi~~ 197 (477)
T d1ewka_ 118 KKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHT 197 (477)
T ss_dssp -CCEEEEECCSSHHHHHHHHHHHGGGTCCEEESSCCCGGGGCTTTCTTEEESSCCHHHHHHHHHHHHHHTTCCEEEEEEE
T ss_pred ccceEEEECCCcchhHHHHHHHhhhccCceeccccCCccccccccCCceEEecccchhhHHHHHHHHHHcCCcEEEEEEe
Confidence 346999999999999999999999999999999863 2 2 35679999999999999999999999999999999998
Q ss_pred c-CcchhhHHHHHhCCCCCCceEEEE-ecC--C--CchHHHHHHHHhC--CCceEEEecCchhHHHHHhhC
Q psy18065 87 E-DNGLFKLQELVKTPPTLKTEMYIR-HAN--P--STYRNVLREIRQK--EIFNLIIDTSTTHISQFFRAV 149 (149)
Q Consensus 87 ~-~~~~~~l~~l~~~~~~~~~~v~~~-~~~--~--~d~~~~l~~i~~~--~~~~iil~~~~~~~~~il~qA 149 (149)
+ ++|....+.+.+.+.+.|+|+... .++ . .++..++++|+++ .+++||+++....+..++++|
T Consensus 198 ~d~~g~~~~~~l~~~~~~~~i~v~~~~~i~~~~~~~~~~~~l~~l~~~~~~~rVIv~~~~~~~~~~ll~~a 268 (477)
T d1ewka_ 198 EGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAM 268 (477)
T ss_dssp SSHHHHHHHHHHHHHHHHHTCEEEEEEEECTTCCHHHHHHHHHHHHTTTTTCCEEEEECCHHHHHHHHHHH
T ss_pred cchhHHHHHHHHHHHHHHcCcEEEEEeeccCCCchhhHHHHHHHHhhhccCceEEEEecCHHHHHHHHHHH
Confidence 7 478888888888888889998653 343 2 4688999999876 678899999999999999875
|
| >d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1usga_ c.93.1.1 (A:) Leucine-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d3ckma1 c.93.1.1 (A:257-573) YraM C-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1jyea_ c.93.1.1 (A:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jx6a_ c.93.1.1 (A:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nrza_ c.38.1.1 (A:) Sorbose permease subunit IIb , EIIb-sor {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1blea_ c.38.1.1 (A:) Fructose permease, subunit IIb {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|