Psyllid ID: psy18065


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MAEATMCRQLQNGVQALFGPSDALLGPHVQSICEALDVPHMESRLDLELNSKEFSVNLYPSQKLLNAAFKDVIRFLNWTKVAIVYEEDNGLFKLQELVKTPPTLKTEMYIRHANPSTYRNVLREIRQKEIFNLIIDTSTTHISQFFRAV
cHHHHHHHHHHcccEEEEcccccccHHHHHHHHHHccccEEEEEccccccccccEEEEEccHHHHHHHHHHHHHHccccEEEEEEEEcccHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHHccccEEEEEcccHHHHHHHHcc
ccHHHHHHHHHcccEEEEccccHHHHHHHHHHHHcccccEEEEccccccccccEEEEEcccHHHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHHccccEEEEEccHHHHHHHHHcc
MAEATMCRQLQNgvqalfgpsdallgphvQSICealdvphmesrldlelnskefsvnlypsqkLLNAAFKDVIRFLNWTKVAIVYEEDNGLFKLQelvktpptlktemyirhanpstYRNVLREIRQKEIFNLIIDTSTTHISQFFRAV
MAEATMCRQLQNGVQALFGPSDALLGPHVQSICEALDVPHMESRLDLELNSKEFSVNLYPSQKLLNAAFKDVIRFLNWTKVAIVYEEDNGLFKLQELVKtpptlktemyirhanpstyrNVLREIRQKEIFNLiidtstthisqffrav
MAEATMCRQLQNGVQALFGPSDALLGPHVQSICEALDVPHMESRLDLELNSKEFSVNLYPSQKLLNAAFKDVIRFLNWTKVAIVYEEDNGLFKLQELVKTPPTLKTEMYIRHANPSTYRNVLREIRQKEIFNLIIDTSTTHISQFFRAV
**********QNGVQALFGPSDALLGPHVQSICEALDVPHMESRLDLELNSKEFSVNLYPSQKLLNAAFKDVIRFLNWTKVAIVYEEDNGLFKLQELVKTPPTLKTEMYIRHANPSTYRNVLREIRQKEIFNLIIDTSTTHISQFF***
*AEATMCRQLQNGVQALFGPSDALLGPHVQSICEALDVPHMESRLDLELNSKEFSVNLYPSQKLLNAAFKDVIRFLNWTKVAIVYEEDNGLFKLQELVKTPPTLKTEMYIRHANPSTYRNVLREIRQKEIFNLIIDTSTTHISQFFRAV
MAEATMCRQLQNGVQALFGPSDALLGPHVQSICEALDVPHMESRLDLELNSKEFSVNLYPSQKLLNAAFKDVIRFLNWTKVAIVYEEDNGLFKLQELVKTPPTLKTEMYIRHANPSTYRNVLREIRQKEIFNLIIDTSTTHISQFFRAV
MAEATMCRQLQNGVQALFGPSDALLGPHVQSICEALDVPHMESRLDLELNSKEFSVNLYPSQKLLNAAFKDVIRFLNWTKVAIVYEEDNGLFKLQELVKTPPTLKTEMYIRHANPSTYRNVLREIRQKEIFNLIIDTSTTHISQFFRAV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEATMCRQLQNGVQALFGPSDALLGPHVQSICEALDVPHMESRLDLELNSKEFSVNLYPSQKLLNAAFKDVIRFLNWTKVAIVYEEDNGLFKLQELVKTPPTLKTEMYIRHANPSTYRNVLREIRQKEIFNLIIDTSTTHISQFFRAV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query149 2.2.26 [Sep-21-2011]
P42260 908 Glutamate receptor ionotr yes N/A 0.919 0.150 0.375 1e-21
P39087 908 Glutamate receptor ionotr yes N/A 0.919 0.150 0.375 1e-21
Q38PU3 908 Glutamate receptor ionotr N/A N/A 0.919 0.150 0.375 1e-21
Q13002 908 Glutamate receptor ionotr yes N/A 0.919 0.150 0.375 1e-21
P22756 949 Glutamate receptor ionotr no N/A 0.993 0.155 0.355 2e-21
Q38PU2 919 Glutamate receptor ionotr N/A N/A 0.959 0.155 0.366 9e-21
Q38PU4 918 Glutamate receptor ionotr N/A N/A 0.986 0.160 0.359 1e-20
P39086 918 Glutamate receptor ionotr no N/A 0.986 0.160 0.359 1e-20
Q13003 919 Glutamate receptor ionotr no N/A 0.959 0.155 0.366 1e-20
Q60934 836 Glutamate receptor ionotr no N/A 0.986 0.175 0.359 2e-20
>sp|P42260|GRIK2_RAT Glutamate receptor ionotropic, kainate 2 OS=Rattus norvegicus GN=Grik2 PE=1 SV=2 Back     alignment and function desciption
 Score =  101 bits (252), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 53/141 (37%), Positives = 81/141 (57%), Gaps = 4/141 (2%)

Query: 2   AEATMCRQLQNGVQALFGPSDALLGPHVQSICEALDVPHMESRLDLEL--NSKEFSVNLY 59
           A    C QL  GV A+FGPS +     VQSIC AL VPH+++R   ++  N   F V+LY
Sbjct: 91  ASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLY 150

Query: 60  PSQKLLNAAFKDVIRFLNWTKVAIVYEEDNGLFKLQELVKTPPTLKTEMYIRH--ANPST 117
           P    L+ A  D+++F  W  V +VY++  GL +LQEL+K P      + IR   A+   
Sbjct: 151 PDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKD 210

Query: 118 YRNVLREIRQKEIFNLIIDTS 138
            + +L+E+++ + F++I D S
Sbjct: 211 AKPLLKEMKRGKEFHVIFDCS 231




Ionotropic glutamate receptor. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. Binding of the excitatory neurotransmitter L-glutamate induces a conformation change, leading to the opening of the cation channel, and thereby converts the chemical signal to an electrical impulse. The receptor then desensitizes rapidly and enters a transient inactive state, characterized by the presence of bound agonist. May be involved in the transmission of light information from the retina to the hypothalamus. Modulates cell surface expression of NETO2.
Rattus norvegicus (taxid: 10116)
>sp|P39087|GRIK2_MOUSE Glutamate receptor ionotropic, kainate 2 OS=Mus musculus GN=Grik2 PE=1 SV=4 Back     alignment and function description
>sp|Q38PU3|GRIK2_MACFA Glutamate receptor ionotropic, kainate 2 OS=Macaca fascicularis GN=GRIK2 PE=2 SV=1 Back     alignment and function description
>sp|Q13002|GRIK2_HUMAN Glutamate receptor ionotropic, kainate 2 OS=Homo sapiens GN=GRIK2 PE=1 SV=1 Back     alignment and function description
>sp|P22756|GRIK1_RAT Glutamate receptor ionotropic, kainate 1 OS=Rattus norvegicus GN=Grik1 PE=1 SV=3 Back     alignment and function description
>sp|Q38PU2|GRIK3_MACFA Glutamate receptor ionotropic, kainate 3 OS=Macaca fascicularis GN=GRIK3 PE=2 SV=1 Back     alignment and function description
>sp|Q38PU4|GRIK1_MACFA Glutamate receptor ionotropic, kainate 1 OS=Macaca fascicularis GN=GRIK1 PE=2 SV=1 Back     alignment and function description
>sp|P39086|GRIK1_HUMAN Glutamate receptor ionotropic, kainate 1 OS=Homo sapiens GN=GRIK1 PE=1 SV=1 Back     alignment and function description
>sp|Q13003|GRIK3_HUMAN Glutamate receptor ionotropic, kainate 3 OS=Homo sapiens GN=GRIK3 PE=2 SV=3 Back     alignment and function description
>sp|Q60934|GRIK1_MOUSE Glutamate receptor ionotropic, kainate 1 OS=Mus musculus GN=Grik1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
242022297 938 glutamate receptor, ionotropic kainate 2 0.959 0.152 0.699 8e-57
332020480 982 Glutamate receptor, ionotropic kainate 2 0.959 0.145 0.678 2e-56
383865939 1008 PREDICTED: glutamate receptor, ionotropi 0.959 0.141 0.678 4e-56
307214191218 Glutamate receptor, ionotropic kainate 1 0.953 0.651 0.683 4e-56
350422773 383 PREDICTED: glutamate receptor, ionotropi 0.959 0.373 0.671 6e-56
328777632 1000 PREDICTED: glutamate receptor, ionotropi 0.959 0.143 0.671 9e-56
340713406 998 PREDICTED: glutamate receptor, ionotropi 0.959 0.143 0.671 9e-56
380015482 987 PREDICTED: glutamate receptor, ionotropi 0.959 0.144 0.671 1e-55
307176862 345 Glutamate receptor, ionotropic kainate 1 0.959 0.414 0.671 3e-55
345488319 1023 PREDICTED: glutamate receptor, ionotropi 0.959 0.139 0.678 5e-55
>gi|242022297|ref|XP_002431577.1| glutamate receptor, ionotropic kainate 2 precursor, putative [Pediculus humanus corporis] gi|212516880|gb|EEB18839.1| glutamate receptor, ionotropic kainate 2 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  224 bits (571), Expect = 8e-57,   Method: Compositional matrix adjust.
 Identities = 100/143 (69%), Positives = 124/143 (86%)

Query: 7   CRQLQNGVQALFGPSDALLGPHVQSICEALDVPHMESRLDLELNSKEFSVNLYPSQKLLN 66
           CRQL+NG+QA+FGP+D LLG H+QSICEALDVPHME+RLD E   KEFS+NL+PSQ+ LN
Sbjct: 86  CRQLENGIQAIFGPTDPLLGAHIQSICEALDVPHMEARLDFEPFLKEFSINLHPSQQHLN 145

Query: 67  AAFKDVIRFLNWTKVAIVYEEDNGLFKLQELVKTPPTLKTEMYIRHANPSTYRNVLREIR 126
            AF+D++ FLNWTKVAI+YEED GLFKLQ+LVK+PP  K EMYIR ANP+TYR+VL+EIR
Sbjct: 146 KAFQDLMIFLNWTKVAIIYEEDYGLFKLQDLVKSPPNSKMEMYIRQANPTTYRHVLKEIR 205

Query: 127 QKEIFNLIIDTSTTHISQFFRAV 149
           QKEI+ L++DT+  H + FFRA+
Sbjct: 206 QKEIYKLLVDTNPVHTNVFFRAI 228




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332020480|gb|EGI60895.1| Glutamate receptor, ionotropic kainate 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383865939|ref|XP_003708429.1| PREDICTED: glutamate receptor, ionotropic kainate 2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307214191|gb|EFN89308.1| Glutamate receptor, ionotropic kainate 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|350422773|ref|XP_003493278.1| PREDICTED: glutamate receptor, ionotropic kainate 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328777632|ref|XP_003249376.1| PREDICTED: glutamate receptor, ionotropic kainate 2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|340713406|ref|XP_003395234.1| PREDICTED: glutamate receptor, ionotropic kainate 2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380015482|ref|XP_003691730.1| PREDICTED: glutamate receptor, ionotropic kainate 2-like [Apis florea] Back     alignment and taxonomy information
>gi|307176862|gb|EFN66206.1| Glutamate receptor, ionotropic kainate 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|345488319|ref|XP_001605775.2| PREDICTED: glutamate receptor, ionotropic kainate 2-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
FB|FBgn0039927 910 CG11155 [Drosophila melanogast 0.946 0.154 0.618 1e-44
FB|FBgn0039916 899 CG9935 [Drosophila melanogaste 0.865 0.143 0.405 3.7e-25
FB|FBgn0038837 853 CG3822 [Drosophila melanogaste 0.953 0.166 0.342 1.1e-20
UNIPROTKB|F1M526 832 Grik1 "Glutamate receptor iono 0.993 0.177 0.355 4.5e-20
UNIPROTKB|D4ACE2 834 Grik1 "Glutamate receptor iono 0.993 0.177 0.355 4.5e-20
UNIPROTKB|F1LTY2 834 Grik1 "Glutamate receptor iono 0.993 0.177 0.355 4.5e-20
UNIPROTKB|F1M4T4 883 Grik1 "Glutamate receptor iono 0.993 0.167 0.355 5e-20
UNIPROTKB|F1M4B0 895 Grik1 "Glutamate receptor iono 0.993 0.165 0.355 5.1e-20
UNIPROTKB|F1M5R4 912 Grik1 "Glutamate receptor iono 0.993 0.162 0.355 5.2e-20
RGD|2732 949 Grik1 "glutamate receptor, ion 0.993 0.155 0.355 5.6e-20
FB|FBgn0039927 CG11155 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 479 (173.7 bits), Expect = 1.0e-44, P = 1.0e-44
 Identities = 89/144 (61%), Positives = 113/144 (78%)

Query:     6 MCRQLQNGVQALFGPSDALLGPHVQSICEALDVPHMESRLDLELNSKEFSVNLYPSQKLL 65
             +C QL+ GVQA+FGP+DALL  HVQSICEA D+PH+E R+DLE NSKEFS+NLYPS  LL
Sbjct:   100 VCSQLEAGVQAIFGPTDALLASHVQSICEAYDIPHIEGRIDLEYNSKEFSINLYPSHTLL 159

Query:    66 NAAFKDVIRFLNWTKVAIVYEEDNGLFKLQELVKTPPTLKTEMYIRHANPSTYRNVLREI 125
               A++D++ +LNWTKVAI+YEED GLF L     +  T K EMYIR A+P +YR VLR I
Sbjct:   160 TLAYRDIMVYLNWTKVAIIYEEDYGLFNLMH--SSTET-KAEMYIRQASPDSYRQVLRAI 216

Query:   126 RQKEIFNLIIDTSTTHISQFFRAV 149
             RQKEI+ +I+DT+ +HI  FFR++
Sbjct:   217 RQKEIYKIIVDTNPSHIKSFFRSI 240




GO:0015277 "kainate selective glutamate receptor activity" evidence=ISS
GO:0006811 "ion transport" evidence=IEA
GO:0005234 "extracellular-glutamate-gated ion channel activity" evidence=IEA
GO:0030288 "outer membrane-bounded periplasmic space" evidence=IEA
GO:0060025 "regulation of synaptic activity" evidence=ISS
GO:0005886 "plasma membrane" evidence=ISS
GO:0048812 "neuron projection morphogenesis" evidence=IMP
FB|FBgn0039916 CG9935 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038837 CG3822 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1M526 Grik1 "Glutamate receptor ionotropic, kainate 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4ACE2 Grik1 "Glutamate receptor ionotropic, kainate 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LTY2 Grik1 "Glutamate receptor ionotropic, kainate 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1M4T4 Grik1 "Glutamate receptor ionotropic, kainate 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1M4B0 Grik1 "Glutamate receptor ionotropic, kainate 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1M5R4 Grik1 "Glutamate receptor ionotropic, kainate 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|2732 Grik1 "glutamate receptor, ionotropic, kainate 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
cd06382 327 cd06382, PBP1_iGluR_Kainate, N-terminal leucine/is 2e-49
cd06368 324 cd06368, PBP1_iGluR_non_NMDA_like, N-terminal leuc 6e-42
cd06393 384 cd06393, PBP1_iGluR_Kainate_GluR5_7, N-terminal le 4e-26
cd06351 328 cd06351, PBP1_iGluR_N_LIVBP_like, N-terminal leuci 1e-25
cd06269298 cd06269, PBP1_glutamate_receptors_like, Family C G 9e-15
pfam01094 343 pfam01094, ANF_receptor, Receptor family ligand bi 1e-14
cd06394 333 cd06394, PBP1_iGluR_Kainate_KA1_2, N-terminal leuc 5e-11
cd04509299 cd04509, PBP1_ABC_transporter_GCPR_C_like, Family 2e-10
cd06380 382 cd06380, PBP1_iGluR_AMPA, N-terminal leucine/isole 3e-09
cd06389 370 cd06389, PBP1_iGluR_AMPA_GluR2, N-terminal leucine 4e-07
cd06390 364 cd06390, PBP1_iGluR_AMPA_GluR1, N-terminal leucine 4e-07
cd01391269 cd01391, Periplasmic_Binding_Protein_Type_1, Type 3e-06
cd06383 368 cd06383, PBP1_iGluR_AMPA_Like, N-terminal leucine/ 2e-05
cd06388 371 cd06388, PBP1_iGluR_AMPA_GluR4, N-terminal leucine 1e-04
cd06381 363 cd06381, PBP1_iGluR_delta_like, N-terminal leucine 1e-04
cd06387 372 cd06387, PBP1_iGluR_AMPA_GluR3, N-terminal leucine 1e-04
cd06374 472 cd06374, PBP1_mGluR_groupI, Ligand binding domain 4e-04
>gnl|CDD|107377 cd06382, PBP1_iGluR_Kainate, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors Back     alignment and domain information
 Score =  160 bits (408), Expect = 2e-49
 Identities = 52/149 (34%), Positives = 82/149 (55%), Gaps = 2/149 (1%)

Query: 2   AEATMCRQLQNGVQALFGPSDALLGPHVQSICEALDVPHMESRLDLELNSKE-FSVNLYP 60
               +C  LQ GV A+FGPS +     VQSIC+A ++PH+++R D E  S   F++NLYP
Sbjct: 52  TTKKVCDLLQQGVAAIFGPSSSEASSIVQSICDAKEIPHIQTRWDPEPKSNRQFTINLYP 111

Query: 61  SQKLLNAAFKDVIRFLNWTKVAIVYEEDNGLFKLQELVKTPPTLKTEMYIR-HANPSTYR 119
           S   L+ A+ D+++  NW    I+YE   GL +LQEL++        + +R   +   YR
Sbjct: 112 SNADLSRAYADIVKSFNWKSFTIIYESAEGLLRLQELLQAFGISGITITVRQLDDDLDYR 171

Query: 120 NVLREIRQKEIFNLIIDTSTTHISQFFRA 148
            +L+EI+      +IID S   + +  + 
Sbjct: 172 PLLKEIKNSGDNRIIIDCSADILIELLKQ 200


N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors, non-NMDA ionotropic receptors which respond to the neurotransmitter glutamate. While this N-terminal domain belongs to the periplasmic-binding fold type I superfamily, the glutamate-binding domain of the iGluR is structurally homologous to the periplasmic-binding fold type II. The LIVBP-like domain of iGluRs is thought to play a role in the initial assembly of iGluR subunits, but it is not well understood how this domain is arranged and functions in intact iGluR. Kainate receptors have five subunits, GluR5, GluR6, GluR7, KA1, and KA2, which are structurally similar to AMPA and NMDA subunits of ionotropic glutamate receptors. KA1 and KA2 subunits can only form functional receptors with one of the GluR5-7 subunits. Moreover, GluR5-7 can also form functional homomeric receptor channels activated by kainate and glutamate when expressed in heterologous systems. Kainate receptors are involved in excitatory neurotransmission by activating postsynaptic receptors and in inhibitory neurotransmission by modulating release of the inhibitory neurotransmitter GABA through a presynaptic mechanism. Kainate receptors are closely related to AMAP receptors. In contrast of AMPA receptors, kainate receptors play only a minor role in signaling at synapses and their function is not well defined. Length = 327

>gnl|CDD|107363 cd06368, PBP1_iGluR_non_NMDA_like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors Back     alignment and domain information
>gnl|CDD|107388 cd06393, PBP1_iGluR_Kainate_GluR5_7, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor Back     alignment and domain information
>gnl|CDD|107346 cd06351, PBP1_iGluR_N_LIVBP_like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) Back     alignment and domain information
>gnl|CDD|153137 cd06269, PBP1_glutamate_receptors_like, Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors Back     alignment and domain information
>gnl|CDD|216296 pfam01094, ANF_receptor, Receptor family ligand binding region Back     alignment and domain information
>gnl|CDD|107389 cd06394, PBP1_iGluR_Kainate_KA1_2, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the KA1 and KA2 subunits of Kainate receptor Back     alignment and domain information
>gnl|CDD|107261 cd04509, PBP1_ABC_transporter_GCPR_C_like, Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems Back     alignment and domain information
>gnl|CDD|107375 cd06380, PBP1_iGluR_AMPA, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor Back     alignment and domain information
>gnl|CDD|107384 cd06389, PBP1_iGluR_AMPA_GluR2, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR2 subunit of the AMPA receptor Back     alignment and domain information
>gnl|CDD|107385 cd06390, PBP1_iGluR_AMPA_GluR1, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR1 subunit of the AMPA receptor Back     alignment and domain information
>gnl|CDD|107248 cd01391, Periplasmic_Binding_Protein_Type_1, Type 1 periplasmic binding fold superfamily Back     alignment and domain information
>gnl|CDD|107378 cd06383, PBP1_iGluR_AMPA_Like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors Back     alignment and domain information
>gnl|CDD|107383 cd06388, PBP1_iGluR_AMPA_GluR4, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor Back     alignment and domain information
>gnl|CDD|107376 cd06381, PBP1_iGluR_delta_like, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of an orphan family of delta receptors, GluRdelta1 and GluRdelta2 Back     alignment and domain information
>gnl|CDD|107382 cd06387, PBP1_iGluR_AMPA_GluR3, N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA receptor Back     alignment and domain information
>gnl|CDD|107369 cd06374, PBP1_mGluR_groupI, Ligand binding domain of the group I metabotropic glutamate receptor Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 149
cd06387 372 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucin 99.97
cd06390 364 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucin 99.97
cd06394 333 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleu 99.97
cd06392 400 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/v 99.97
cd06383 368 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine 99.96
cd06389 370 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucin 99.96
cd06388 371 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucin 99.96
cd06393 384 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isol 99.95
cd06380 382 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/vali 99.95
cd06377 382 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/ 99.94
cd06391 400 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/v 99.93
cd06375 458 PBP1_mGluR_groupII Ligand binding domain of the gr 99.93
cd06351 328 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleuc 99.93
cd06361 403 PBP1_GPC6A_like Ligand-binding domain of the promi 99.93
cd06365 469 PBP1_Pheromone_receptor Ligand-binding domain of t 99.93
cd06368 324 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleu 99.93
cd06381 363 PBP1_iGluR_delta_like N-terminal leucine/isoleucin 99.93
cd06386 387 PBP1_NPR_C_like Ligand-binding domain of type C na 99.93
cd06382 327 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/v 99.93
cd06367 362 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/vali 99.93
cd06378 362 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/ 99.92
cd06364 510 PBP1_CaSR Ligand-binding domain of the CaSR calciu 99.92
cd06376 463 PBP1_mGluR_groupIII Ligand-binding domain of the g 99.92
cd06379 377 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/ 99.91
cd06374 472 PBP1_mGluR_groupI Ligand binding domain of the gro 99.91
cd06362 452 PBP1_mGluR Ligand binding domain of the metabotrop 99.91
cd06350 348 PBP1_GPCR_family_C_like Ligand-binding domain of m 99.9
cd06373 396 PBP1_NPR_like Ligand binding domain of natriuretic 99.9
cd06269298 PBP1_glutamate_receptors_like Family C G-protein c 99.9
cd06363 410 PBP1_Taste_receptor Ligand-binding domain of the T 99.9
cd06371 382 PBP1_sensory_GC_DEF_like Ligand-binding domain of 99.89
cd06385 405 PBP1_NPR_A Ligand-binding domain of type A natriur 99.89
cd06366 350 PBP1_GABAb_receptor Ligand-binding domain of GABAb 99.88
PF01094 348 ANF_receptor: Receptor family ligand binding regio 99.88
cd06370 404 PBP1_Speract_GC_like Ligand-binding domain of memb 99.88
cd06372 391 PBP1_GC_G_like Ligand-binding domain of membrane g 99.87
cd06384 399 PBP1_NPR_B Ligand-binding domain of type B natriur 99.86
KOG1056|consensus 878 99.85
cd06352 389 PBP1_NPR_GC_like Ligand-binding domain of membrane 99.85
KOG1054|consensus 897 99.81
cd06346312 PBP1_ABC_ligand_binding_like_11 Type I periplasmic 99.8
cd06338 345 PBP1_ABC_ligand_binding_like_5 Type I periplasmic 99.8
cd06345 344 PBP1_ABC_ligand_binding_like_10 Type I periplasmic 99.8
cd06342 334 PBP1_ABC_LIVBP_like Type I periplasmic ligand-bind 99.79
cd06340 347 PBP1_ABC_ligand_binding_like_6 Type I periplasmic 99.79
cd06347 334 PBP1_ABC_ligand_binding_like_12 Type I periplasmic 99.76
cd06348 344 PBP1_ABC_ligand_binding_like_13 Type I periplasmic 99.74
cd06335 347 PBP1_ABC_ligand_binding_like_2 Type I periplasmic 99.72
cd06330 346 PBP1_Arsenic_SBP_like Periplasmic solute-binding d 99.71
cd06331 333 PBP1_AmiC_like Type I periplasmic components of am 99.71
cd06329 342 PBP1_SBP_like_3 Periplasmic solute-binding domain 99.71
cd04509299 PBP1_ABC_transporter_GCPR_C_like Family C of G-pro 99.71
cd06343 362 PBP1_ABC_ligand_binding_like_8 Type I periplasmic 99.71
cd06349 340 PBP1_ABC_ligand_binding_like_14 Type I periplasmic 99.7
cd06336 347 PBP1_ABC_ligand_binding_like_3 Type I periplasmic 99.69
cd06344 332 PBP1_ABC_ligand_binding_like_9 Type I periplasmic 99.69
PRK15404 369 leucine ABC transporter subunit substrate-binding 99.68
cd06327 334 PBP1_SBP_like_1 Periplasmic solute-binding domain 99.65
cd06359 333 PBP1_Nba_like Type I periplasmic binding component 99.63
cd06360 336 PBP1_alkylbenzenes_like Type I periplasmic binding 99.62
cd06268298 PBP1_ABC_transporter_LIVBP_like Periplasmic bindin 99.62
cd06355 348 PBP1_FmdD_like Periplasmic component (FmdD) of an 99.6
cd06358 333 PBP1_NHase Type I periplasmic-binding protein of t 99.6
cd06339 336 PBP1_YraM_LppC_lipoprotein_like Periplasmic bindin 99.59
cd06328 333 PBP1_SBP_like_2 Periplasmic solute-binding domain 99.57
cd06326 336 PBP1_STKc_like Type I periplasmic binding domain o 99.57
cd06334 351 PBP1_ABC_ligand_binding_like_1 Type I periplasmic 99.57
COG0683 366 LivK ABC-type branched-chain amino acid transport 99.56
cd06337 357 PBP1_ABC_ligand_binding_like_4 Type I periplasmic 99.55
cd06332 333 PBP1_aromatic_compounds_like Type I periplasmic bi 99.53
cd06333 312 PBP1_ABC-type_HAAT_like Type I periplasmic binding 99.53
TIGR03669 374 urea_ABC_arch urea ABC transporter, substrate-bind 99.52
PF13458 343 Peripla_BP_6: Periplasmic binding protein; PDB: 4E 99.52
cd06356 334 PBP1_Amide_Urea_BP_like Periplasmic component (Fmd 99.51
cd06369 380 PBP1_GC_C_enterotoxin_receptor Ligand-binding doma 99.51
TIGR03407 359 urea_ABC_UrtA urea ABC transporter, urea binding p 99.49
cd06357 360 PBP1_AmiC Periplasmic binding domain of amidase (A 99.38
TIGR03863 347 PQQ_ABC_bind ABC transporter, substrate binding pr 99.33
cd06341 341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic 99.28
KOG4440|consensus 993 99.21
cd01391269 Periplasmic_Binding_Protein_Type_1 Type 1 periplas 99.19
KOG1055|consensus 865 99.12
KOG1053|consensus 1258 98.71
PF13433 363 Peripla_BP_5: Periplasmic binding protein domain; 98.2
PF04348 536 LppC: LppC putative lipoprotein; InterPro: IPR0074 97.66
cd01537264 PBP1_Repressors_Sugar_Binding_like Ligand-binding 97.58
cd06320275 PBP1_allose_binding Periplasmic allose-binding dom 97.47
cd06300272 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-bi 97.45
cd06267264 PBP1_LacI_sugar_binding_like Ligand binding domain 97.37
cd01536267 PBP1_ABC_sugar_binding_like Periplasmic sugar-bind 97.28
cd06282266 PBP1_GntR_like_2 Ligand-binding domain of putative 96.92
cd06273268 PBP1_GntR_like_1 This group includes the ligand-bi 96.41
cd06325281 PBP1_ABC_uncharacterized_transporter Type I peripl 96.3
cd06319277 PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-b 96.25
cd01545270 PBP1_SalR Ligand-binding domain of DNA transcripti 96.22
cd06323268 PBP1_ribose_binding Periplasmic sugar-binding doma 95.87
cd06278266 PBP1_LacI_like_2 Ligand-binding domain of uncharac 95.64
cd06309273 PBP1_YtfQ_like Periplasmic binding domain of ABC-t 95.63
cd06317275 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-bi 95.6
cd06298268 PBP1_CcpA_like Ligand-binding domain of the catabo 95.01
cd06312271 PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-bi 94.98
cd06301272 PBP1_rhizopine_binding_like Periplasmic binding pr 94.95
cd06305273 PBP1_methylthioribose_binding_like Methylthioribos 94.89
cd06284267 PBP1_LacI_like_6 Ligand-binding domain of an uncha 94.54
PRK10014342 DNA-binding transcriptional repressor MalI; Provis 94.5
PRK10653295 D-ribose transporter subunit RbsB; Provisional 94.23
TIGR01481329 ccpA catabolite control protein A. Catabolite cont 94.16
cd06275269 PBP1_PurR Ligand-binding domain of purine represso 94.01
cd06289268 PBP1_MalI_like Ligand-binding domain of MalI, a tr 93.95
cd06310273 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-bi 93.9
cd06313272 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-bi 93.74
PF13407257 Peripla_BP_4: Periplasmic binding protein domain; 93.56
PF00532279 Peripla_BP_1: Periplasmic binding proteins and sug 93.05
cd06322267 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-b 92.97
cd06296270 PBP1_CatR_like Ligand-binding domain of a LacI-lik 92.62
TIGR02990239 ectoine_eutA ectoine utilization protein EutA. Mem 92.56
cd06271268 PBP1_AglR_RafR_like Ligand-binding domain of DNA t 92.15
cd06311274 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-bi 91.95
COG2984322 ABC-type uncharacterized transport system, peripla 91.89
PRK11303328 DNA-binding transcriptional regulator FruR; Provis 91.71
COG1609333 PurR Transcriptional regulators [Transcription] 91.42
cd01574264 PBP1_LacI Ligand-binding domain of DNA transcripti 91.35
cd01542259 PBP1_TreR_like Ligand-binding domain of DNA transc 91.31
cd06281269 PBP1_LacI_like_5 Ligand-binding domain of uncharac 91.23
TIGR02417327 fruct_sucro_rep D-fructose-responsive transcriptio 91.2
PRK09756158 PTS system N-acetylgalactosamine-specific transpor 90.37
cd06295275 PBP1_CelR Ligand binding domain of a transcription 90.15
cd06277268 PBP1_LacI_like_1 Ligand-binding domain of uncharac 90.07
cd06270268 PBP1_GalS_like Ligand binding domain of DNA transc 90.05
cd06308270 PBP1_sensor_kinase_like Periplasmic binding domain 90.03
cd06299265 PBP1_LacI_like_13 Ligand-binding domain of DNA-bin 89.88
cd06280263 PBP1_LacI_like_4 Ligand-binding domain of uncharac 89.21
PRK11425157 PTS system N-acetylgalactosamine-specific transpor 89.05
cd06288269 PBP1_sucrose_transcription_regulator Ligand-bindin 88.91
cd06291265 PBP1_Qymf_like Ligand binding domain of the lacI-l 88.07
TIGR00854151 pts-sorbose PTS system, mannose/fructose/sorbose f 88.04
cd06290265 PBP1_LacI_like_9 Ligand-binding domain of uncharac 87.74
cd06294270 PBP1_ycjW_transcription_regulator_like Ligand-bind 87.6
cd00001151 PTS_IIB_man PTS_IIB, PTS system, Mannose/sorbose s 87.31
cd06293269 PBP1_LacI_like_11 Ligand-binding domain of unchara 86.82
cd06279283 PBP1_LacI_like_3 Ligand-binding domain of uncharac 86.68
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 85.91
cd06274264 PBP1_FruR Ligand binding domain of DNA transcripti 85.71
PRK10703341 DNA-binding transcriptional repressor PurR; Provis 85.0
cd06272261 PBP1_hexuronate_repressor_like Ligand-binding doma 84.63
PRK10423327 transcriptional repressor RbsR; Provisional 84.6
PF03830151 PTSIIB_sorb: PTS system sorbose subfamily IIB comp 84.19
cd01575268 PBP1_GntR Ligand-binding domain of DNA transcripti 84.08
PRK10727343 DNA-binding transcriptional regulator GalR; Provis 84.07
cd06286260 PBP1_CcpB_like Ligand-binding domain of a novel tr 83.97
PRK09526342 lacI lac repressor; Reviewed 83.47
cd06283267 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of 83.32
cd01538288 PBP1_ABC_xylose_binding Periplasmic xylose-binding 83.1
PF04392294 ABC_sub_bind: ABC transporter substrate binding pr 82.83
PLN02674244 adenylate kinase 82.56
cd01543265 PBP1_XylR Ligand-binding domain of DNA transcripti 81.99
COG0426388 FpaA Uncharacterized flavoproteins [Energy product 81.17
PTZ00088229 adenylate kinase 1; Provisional 80.87
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 80.72
PF00406151 ADK: Adenylate kinase; InterPro: IPR000850 Adenyla 80.62
cd01541273 PBP1_AraR Ligand-binding domain of DNA transcripti 80.48
cd06285265 PBP1_LacI_like_7 Ligand-binding domain of uncharac 80.13
>cd06387 PBP1_iGluR_AMPA_GluR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA receptor Back     alignment and domain information
Probab=99.97  E-value=5.9e-31  Score=198.00  Aligned_cols=144  Identities=20%  Similarity=0.427  Sum_probs=130.0

Q ss_pred             hHHHHHHHhhCCcEEEEcCCCCCcHHHHHHhhcccCCCceeeccCCCCCCcccEEEecCChhHHHHHHHHHHHhcCCcEE
Q psy18065          2 AEATMCRQLQNGVQALFGPSDALLGPHVQSICEALDVPHMESRLDLELNSKEFSVNLYPSQKLLNAAFKDVIRFLNWTKV   81 (149)
Q Consensus         2 ~~~~~c~~~~~~v~aiiGp~~s~~~~~v~~~~~~~~iP~is~~~~~~~~~~~~~~~~~p~~~~~~~ai~~ll~~~~W~~v   81 (149)
                      +++++|+++++||.||+||+++.++.+++++|+.++||+|++.++. ....+|.++++|+   ++.|+++++++|||++|
T Consensus        52 ~~~~~C~l~~~GV~AIfGp~~~~s~~~v~s~c~~~~iP~i~~~~~~-~~~~~~~l~l~P~---l~~Ai~diI~~~~Wr~~  127 (372)
T cd06387          52 VTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGALHTSFITPSFPT-DADVQFVIQMRPA---LKGAILSLLAHYKWEKF  127 (372)
T ss_pred             HHHHHHHHhhcccEEEEecCCHhHHHHHHHhhccccCCeeeeCCCC-CCCCceEEEEChh---HHHHHHHHHHhcCCCEE
Confidence            6789999999999999999999999999999999999999987653 2455889999998   89999999999999999


Q ss_pred             EEEeecCcchhhHHHHHhCCCCCCceEEEEecC----CCchHHHHHHHHhCCCceEEEecCchhHHHHHhhC
Q psy18065         82 AIVYEEDNGLFKLQELVKTPPTLKTEMYIRHAN----PSTYRNVLREIRQKEIFNLIIDTSTTHISQFFRAV  149 (149)
Q Consensus        82 ~vi~~~~~~~~~l~~l~~~~~~~~~~v~~~~~~----~~d~~~~l~~i~~~~~~~iil~~~~~~~~~il~qA  149 (149)
                      +++|++++|+.++|++.+.....+..+..+.+.    ..+++.+|++|++++.++|||+|+++.+..+|+||
T Consensus       128 ~~iYd~d~gl~~Lq~L~~~~~~~~~~V~~~~v~~~~~~~~~~~~l~el~~~~~r~iIld~s~~~~~~il~~a  199 (372)
T cd06387         128 VYLYDTERGFSILQAIMEAAVQNNWQVTARSVGNIKDVQEFRRIIEEMDRRQEKRYLIDCEVERINTILEQV  199 (372)
T ss_pred             EEEecCchhHHHHHHHHHhhccCCceEEEEEeccCCchHHHHHHHHHhccccceEEEEECCHHHHHHHHHHH
Confidence            999998999999999999988888777655542    25789999999999999999999999999999986



N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR3 subunit of the AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid) receptor. The AMPA receptor is a member of the glutamate-receptor ion channels (iGluRs) which are the major mediators of excitatory synaptic transmission in the central nervous system. AMPA receptors are composed of four types of subunits (GluR1, GluR2, GluR3, and GluR4) which combine to form a tetramer and play an important role in mediating the rapid excitatory synaptic current. Furthermore, this N-terminal domain of the iGluRs has homology with LIVBP, a bacterial periplasmic binding protein, as well as with the structurally related glutamate-binding domain of the G-protein-coupled metabotropic receptors (mGluRs).

>cd06390 PBP1_iGluR_AMPA_GluR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR1 subunit of the AMPA receptor Back     alignment and domain information
>cd06394 PBP1_iGluR_Kainate_KA1_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the KA1 and KA2 subunits of Kainate receptor Back     alignment and domain information
>cd06392 PBP1_iGluR_delta_1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta1 receptor of an orphan glutamate receptor family Back     alignment and domain information
>cd06383 PBP1_iGluR_AMPA_Like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of uncharacterized AMPA-like receptors Back     alignment and domain information
>cd06389 PBP1_iGluR_AMPA_GluR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR2 subunit of the AMPA receptor Back     alignment and domain information
>cd06388 PBP1_iGluR_AMPA_GluR4 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR4 subunit of the AMPA receptor Back     alignment and domain information
>cd06393 PBP1_iGluR_Kainate_GluR5_7 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the GluR5-7 subunits of Kainate receptor Back     alignment and domain information
>cd06380 PBP1_iGluR_AMPA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the AMPA receptor Back     alignment and domain information
>cd06377 PBP1_iGluR_NMDA_NR3 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR3 subunit of NMDA receptor family Back     alignment and domain information
>cd06391 PBP1_iGluR_delta_2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the delta2 receptor of an orphan glutamate receptor family Back     alignment and domain information
>cd06375 PBP1_mGluR_groupII Ligand binding domain of the group II metabotropic glutamate receptor Back     alignment and domain information
>cd06351 PBP1_iGluR_N_LIVBP_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NMDA, AMPA, and kainate receptor subtypes of ionotropic glutamate receptors (iGluRs) Back     alignment and domain information
>cd06361 PBP1_GPC6A_like Ligand-binding domain of the promiscuous L-alpha-amino acid receptor GPRC6A which is a broad-spectrum amino acid-sensing receptor Back     alignment and domain information
>cd06365 PBP1_Pheromone_receptor Ligand-binding domain of the V2R phermone receptor, a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06368 PBP1_iGluR_non_NMDA_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the non-NMDA (N-methyl-d-asparate) subtypes of ionotropic glutamate receptors Back     alignment and domain information
>cd06381 PBP1_iGluR_delta_like N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of an orphan family of delta receptors, GluRdelta1 and GluRdelta2 Back     alignment and domain information
>cd06386 PBP1_NPR_C_like Ligand-binding domain of type C natriuretic peptide receptor Back     alignment and domain information
>cd06382 PBP1_iGluR_Kainate N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the kainate receptors Back     alignment and domain information
>cd06367 PBP1_iGluR_NMDA N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the ionotropic N-methyl-d-asparate (NMDA) subtype of glutamate receptors Back     alignment and domain information
>cd06378 PBP1_iGluR_NMDA_NR2 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR2 subunit of NMDA receptor family Back     alignment and domain information
>cd06364 PBP1_CaSR Ligand-binding domain of the CaSR calcium-sensing receptor, which is a member of the family C receptors within the G-protein coupled receptor superfamily Back     alignment and domain information
>cd06376 PBP1_mGluR_groupIII Ligand-binding domain of the group III metabotropic glutamate receptor Back     alignment and domain information
>cd06379 PBP1_iGluR_NMDA_NR1 N-terminal leucine/isoleucine/valine-binding protein (LIVBP)-like domain of the NR1, an essential channel-forming subunit of the NMDA receptor Back     alignment and domain information
>cd06374 PBP1_mGluR_groupI Ligand binding domain of the group I metabotropic glutamate receptor Back     alignment and domain information
>cd06362 PBP1_mGluR Ligand binding domain of the metabotropic glutamate receptors (mGluR) Back     alignment and domain information
>cd06350 PBP1_GPCR_family_C_like Ligand-binding domain of membrane-bound glutamate receptors that mediate excitatory transmission on the cellular surface through initial binding of glutamate and are categorized into ionotropic glutamate receptors (iGluRs) and metabotropic glutamate receptors (mGluRs) Back     alignment and domain information
>cd06373 PBP1_NPR_like Ligand binding domain of natriuretic peptide receptor (NPR) family Back     alignment and domain information
>cd06269 PBP1_glutamate_receptors_like Family C G-protein couples receptors (GPCRs), membrane bound guanylyl cyclases such as the family of natriuretic peptide receptors (NPRs), and the N-terminal leucine/isoleucine/valine- binding protein (LIVBP)-like domain of the ionotropic glutamate receptors Back     alignment and domain information
>cd06363 PBP1_Taste_receptor Ligand-binding domain of the T1R taste receptor Back     alignment and domain information
>cd06371 PBP1_sensory_GC_DEF_like Ligand-binding domain of membrane guanylyl cyclases (GC-D, GC-E, and GC-F) that are specifically expressed in sensory tissues Back     alignment and domain information
>cd06385 PBP1_NPR_A Ligand-binding domain of type A natriuretic peptide receptor Back     alignment and domain information
>cd06366 PBP1_GABAb_receptor Ligand-binding domain of GABAb receptors, which are metabotropic transmembrane receptors for gamma-aminobutyric acid (GABA) Back     alignment and domain information
>PF01094 ANF_receptor: Receptor family ligand binding region The Prosite family is a sub-family of the Pfam family; InterPro: IPR001828 This describes a ligand binding domain and includes extracellular ligand binding domains of a wide range of receptors, as well as the bacterial amino acid binding proteins of known structure [] Back     alignment and domain information
>cd06370 PBP1_Speract_GC_like Ligand-binding domain of membrane bound guanylyl cyclases Back     alignment and domain information
>cd06372 PBP1_GC_G_like Ligand-binding domain of membrane guanylyl cyclase G Back     alignment and domain information
>cd06384 PBP1_NPR_B Ligand-binding domain of type B natriuretic peptide receptor Back     alignment and domain information
>KOG1056|consensus Back     alignment and domain information
>cd06352 PBP1_NPR_GC_like Ligand-binding domain of membrane guanylyl-cyclase receptors Back     alignment and domain information
>KOG1054|consensus Back     alignment and domain information
>cd06346 PBP1_ABC_ligand_binding_like_11 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06338 PBP1_ABC_ligand_binding_like_5 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06345 PBP1_ABC_ligand_binding_like_10 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06342 PBP1_ABC_LIVBP_like Type I periplasmic ligand-binding domain of ABC (Atpase Binding Cassette)-type active transport systems that are involved in the transport of all three branched chain aliphatic amino acids (leucine, isoleucine and valine) Back     alignment and domain information
>cd06340 PBP1_ABC_ligand_binding_like_6 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06347 PBP1_ABC_ligand_binding_like_12 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06348 PBP1_ABC_ligand_binding_like_13 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06335 PBP1_ABC_ligand_binding_like_2 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06330 PBP1_Arsenic_SBP_like Periplasmic solute-binding domain of active transport proteins Back     alignment and domain information
>cd06331 PBP1_AmiC_like Type I periplasmic components of amide-binding protein (AmiC) and the active transport system for short-chain and urea (FmdDEF) Back     alignment and domain information
>cd06329 PBP1_SBP_like_3 Periplasmic solute-binding domain of active transport proteins Back     alignment and domain information
>cd04509 PBP1_ABC_transporter_GCPR_C_like Family C of G-protein coupled receptors and their close homologs, the type I periplasmic-binding proteins of ATP-binding cassette transporter-like systems Back     alignment and domain information
>cd06343 PBP1_ABC_ligand_binding_like_8 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06349 PBP1_ABC_ligand_binding_like_14 Type I periplasmic ligand-binding domain of uncharacterized ABC (Atpase Binding Cassette)-type active transport systems Back     alignment and domain information
>cd06336 PBP1_ABC_ligand_binding_like_3 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06344 PBP1_ABC_ligand_binding_like_9 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>PRK15404 leucine ABC transporter subunit substrate-binding protein LivK; Provisional Back     alignment and domain information
>cd06327 PBP1_SBP_like_1 Periplasmic solute-binding domain of active transport proteins that belong to the type I periplasmic binding fold protein family Back     alignment and domain information
>cd06359 PBP1_Nba_like Type I periplasmic binding component of active transport systems that are predicted to be involved in 2-nitrobenzoic acid degradation pathway Back     alignment and domain information
>cd06360 PBP1_alkylbenzenes_like Type I periplasmic binding component of active transport systems that are predicted be involved in anaerobic biodegradation of alkylbenzenes such as toluene and ethylbenzene Back     alignment and domain information
>cd06268 PBP1_ABC_transporter_LIVBP_like Periplasmic binding domain of ATP-binding cassette transporter-like systems that belong to the type I periplasmic binding fold protein superfamily Back     alignment and domain information
>cd06355 PBP1_FmdD_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) Back     alignment and domain information
>cd06358 PBP1_NHase Type I periplasmic-binding protein of the nitrile hydratase (NHase) system that selectively converts nitriles to corresponding amides Back     alignment and domain information
>cd06339 PBP1_YraM_LppC_lipoprotein_like Periplasmic binding component of lipoprotein LppC, an immunodominant antigen Back     alignment and domain information
>cd06328 PBP1_SBP_like_2 Periplasmic solute-binding domain of active transport proteins found in gram-negative and gram-positive bacteria Back     alignment and domain information
>cd06326 PBP1_STKc_like Type I periplasmic binding domain of uncharacterized extracellular ligand-binding proteins Back     alignment and domain information
>cd06334 PBP1_ABC_ligand_binding_like_1 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>COG0683 LivK ABC-type branched-chain amino acid transport systems, periplasmic component [Amino acid transport and metabolism] Back     alignment and domain information
>cd06337 PBP1_ABC_ligand_binding_like_4 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06332 PBP1_aromatic_compounds_like Type I periplasmic binding proteins of active transport systems that are predicted to be involved in transport of aromatic compounds such as 2-nitrobenzoic acid and alkylbenzenes Back     alignment and domain information
>cd06333 PBP1_ABC-type_HAAT_like Type I periplasmic binding component of ABC (ATPase Binding Cassette)-type transport systems that are predicted to be involved in uptake of amino acids Back     alignment and domain information
>TIGR03669 urea_ABC_arch urea ABC transporter, substrate-binding protein, archaeal type Back     alignment and domain information
>PF13458 Peripla_BP_6: Periplasmic binding protein; PDB: 4EVS_A 4EY3_A 4EYG_B 4EYK_A 3H5L_B 3TD9_A 3EAF_A 1Z18_A 1Z17_A 2LIV_A Back     alignment and domain information
>cd06356 PBP1_Amide_Urea_BP_like Periplasmic component (FmdD) of an active transport system for short-chain amides and urea (FmdDEF) Back     alignment and domain information
>cd06369 PBP1_GC_C_enterotoxin_receptor Ligand-binding domain of the membrane guanylyl cyclase C Back     alignment and domain information
>TIGR03407 urea_ABC_UrtA urea ABC transporter, urea binding protein Back     alignment and domain information
>cd06357 PBP1_AmiC Periplasmic binding domain of amidase (AmiC) that belongs to the type I periplasmic binding fold protein family Back     alignment and domain information
>TIGR03863 PQQ_ABC_bind ABC transporter, substrate binding protein, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>cd06341 PBP1_ABC_ligand_binding_like_7 Type I periplasmic ligand-binding domain of uncharacterized ABC (ATPase Binding Cassette)-type active transport systems that are predicted to be involved in transport of amino acids, peptides, or inorganic ions Back     alignment and domain information
>KOG4440|consensus Back     alignment and domain information
>cd01391 Periplasmic_Binding_Protein_Type_1 Type 1 periplasmic binding fold superfamily Back     alignment and domain information
>KOG1055|consensus Back     alignment and domain information
>KOG1053|consensus Back     alignment and domain information
>PF13433 Peripla_BP_5: Periplasmic binding protein domain; PDB: 1QNL_A 1QO0_A 1PEA_A Back     alignment and domain information
>PF04348 LppC: LppC putative lipoprotein; InterPro: IPR007443 This entry includes several bacterial outer membrane antigens, whose molecular function is unknown Back     alignment and domain information
>cd01537 PBP1_Repressors_Sugar_Binding_like Ligand-binding domain of the LacI-GalR family of transcription regulators and the sugar-binding domain of ABC-type transport systems Back     alignment and domain information
>cd06320 PBP1_allose_binding Periplasmic allose-binding domain of bacterial transport systems that function as a primary receptor of active transport and chemotaxis Back     alignment and domain information
>cd06300 PBP1_ABC_sugar_binding_like_1 Periplasmic sugar-binding component of uncharacterized ABC-type transport systems that are members of the pentose/hexose sugar-binding protein family of the type I periplasmic binding protein superfamily Back     alignment and domain information
>cd06267 PBP1_LacI_sugar_binding_like Ligand binding domain of the LacI tanscriptional regulator family belonging to the type I periplasmic-binding fold protein superfamily Back     alignment and domain information
>cd01536 PBP1_ABC_sugar_binding_like Periplasmic sugar-binding domain of active transport systems that are members of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>cd06282 PBP1_GntR_like_2 Ligand-binding domain of putative DNA transcription repressors highly similar to that of the repressor specific for gluconate (GntR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06273 PBP1_GntR_like_1 This group includes the ligand-binding domain of putative DNA transcription repressors which are highly similar to that of the repressor specific for gluconate (GntR), a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06325 PBP1_ABC_uncharacterized_transporter Type I periplasmic ligand-binding domain of uncharacterized ABC-type transport systems that are predicted to be involved in the uptake of amino acids, peptides, or inorganic ions Back     alignment and domain information
>cd06319 PBP1_ABC_sugar_binding_like_10 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd01545 PBP1_SalR Ligand-binding domain of DNA transcription repressor SalR, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06323 PBP1_ribose_binding Periplasmic sugar-binding domain of the thermophilic Thermoanaerobacter tengcongensis ribose binding protein (ttRBP) and its mesophilic homologs Back     alignment and domain information
>cd06278 PBP1_LacI_like_2 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06309 PBP1_YtfQ_like Periplasmic binding domain of ABC-type YtfQ-like transport systems Back     alignment and domain information
>cd06317 PBP1_ABC_sugar_binding_like_8 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06298 PBP1_CcpA_like Ligand-binding domain of the catabolite control protein A (CcpA), which functions as the major transcriptional regulator of carbon catabolite repression/regulation Back     alignment and domain information
>cd06312 PBP1_ABC_sugar_binding_like_4 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06301 PBP1_rhizopine_binding_like Periplasmic binding proteins specific to rhizopines Back     alignment and domain information
>cd06305 PBP1_methylthioribose_binding_like Methylthioribose-binding protein-like of ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>cd06284 PBP1_LacI_like_6 Ligand-binding domain of an uncharacterized transcription regulator from Actinobacillus succinogenes and its close homologs from other bacteria Back     alignment and domain information
>PRK10014 DNA-binding transcriptional repressor MalI; Provisional Back     alignment and domain information
>PRK10653 D-ribose transporter subunit RbsB; Provisional Back     alignment and domain information
>TIGR01481 ccpA catabolite control protein A Back     alignment and domain information
>cd06275 PBP1_PurR Ligand-binding domain of purine repressor, PurR, which functions as the master regulatory protein of de novo purine nucleotide biosynthesis in Escherichia coli Back     alignment and domain information
>cd06289 PBP1_MalI_like Ligand-binding domain of MalI, a transcription regulator of the maltose system of Escherichia coli and its close homologs from other bacteria Back     alignment and domain information
>cd06310 PBP1_ABC_sugar_binding_like_2 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06313 PBP1_ABC_sugar_binding_like_5 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>PF13407 Peripla_BP_4: Periplasmic binding protein domain; PDB: 3BRS_B 3GBP_A 3GA5_A 1GCG_A 1GCA_A 3H75_A 3D02_A 3L49_B 3EJW_B 3T95_A Back     alignment and domain information
>PF00532 Peripla_BP_1: Periplasmic binding proteins and sugar binding domain of LacI family; InterPro: IPR001761 This family includes the periplasmic binding proteins, and the LacI family transcriptional regulators Back     alignment and domain information
>cd06322 PBP1_ABC_sugar_binding_like_12 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>cd06296 PBP1_CatR_like Ligand-binding domain of a LacI-like transcriptional regulator, CatR which is involved in catechol degradation Back     alignment and domain information
>TIGR02990 ectoine_eutA ectoine utilization protein EutA Back     alignment and domain information
>cd06271 PBP1_AglR_RafR_like Ligand-binding domain of DNA transcription repressors specific for raffinose (RafR) and alpha-glucosides (AglR) which are members of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06311 PBP1_ABC_sugar_binding_like_3 Periplasmic sugar-binding domain of uncharacterized ABC-type transport systems Back     alignment and domain information
>COG2984 ABC-type uncharacterized transport system, periplasmic component [General function prediction only] Back     alignment and domain information
>PRK11303 DNA-binding transcriptional regulator FruR; Provisional Back     alignment and domain information
>COG1609 PurR Transcriptional regulators [Transcription] Back     alignment and domain information
>cd01574 PBP1_LacI Ligand-binding domain of DNA transcription repressor LacI specific for lactose, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd01542 PBP1_TreR_like Ligand-binding domain of DNA transcription repressor specific for trehalose (TreR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06281 PBP1_LacI_like_5 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>TIGR02417 fruct_sucro_rep D-fructose-responsive transcription factor Back     alignment and domain information
>PRK09756 PTS system N-acetylgalactosamine-specific transporter subunit IIB; Provisional Back     alignment and domain information
>cd06295 PBP1_CelR Ligand binding domain of a transcription regulator of cellulose genes, CelR, which is highly homologous to the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06277 PBP1_LacI_like_1 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06270 PBP1_GalS_like Ligand binding domain of DNA transcription iso-repressor GalS, which is one of two regulatory proteins involved in galactose transport and metabolism Back     alignment and domain information
>cd06308 PBP1_sensor_kinase_like Periplasmic binding domain of two-component sensor kinase signaling systems Back     alignment and domain information
>cd06299 PBP1_LacI_like_13 Ligand-binding domain of DNA-binding regulatory protein from Corynebacterium glutamicum which has a unique ability to produce significant amounts of L-glutamate directly from cheap sugar and ammonia Back     alignment and domain information
>cd06280 PBP1_LacI_like_4 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>PRK11425 PTS system N-acetylgalactosamine-specific transporter subunit IIB; Provisional Back     alignment and domain information
>cd06288 PBP1_sucrose_transcription_regulator Ligand-binding domain of DNA-binding regulatory proteins specific to sucrose that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06291 PBP1_Qymf_like Ligand binding domain of the lacI-like transcription regulator from a novel metal-reducing bacterium Alkaliphilus Metalliredigens (strain Qymf) and its close homologs Back     alignment and domain information
>TIGR00854 pts-sorbose PTS system, mannose/fructose/sorbose family, IIB component Back     alignment and domain information
>cd06290 PBP1_LacI_like_9 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06294 PBP1_ycjW_transcription_regulator_like Ligand-binding domain of uncharacterized transcription regulator ycjW which is a member of the LacI-GalR family repressors Back     alignment and domain information
>cd00001 PTS_IIB_man PTS_IIB, PTS system, Mannose/sorbose specific IIB subunit Back     alignment and domain information
>cd06293 PBP1_LacI_like_11 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>cd06279 PBP1_LacI_like_3 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd06274 PBP1_FruR Ligand binding domain of DNA transcription repressor specific for fructose (FruR) and its close homologs Back     alignment and domain information
>PRK10703 DNA-binding transcriptional repressor PurR; Provisional Back     alignment and domain information
>cd06272 PBP1_hexuronate_repressor_like Ligand-binding domain of DNA transcription repressor for the hexuronate utilization operon from Bacillus species and its close homologs from other bacteria, all of which are a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PRK10423 transcriptional repressor RbsR; Provisional Back     alignment and domain information
>PF03830 PTSIIB_sorb: PTS system sorbose subfamily IIB component; InterPro: IPR004720 Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains Back     alignment and domain information
>cd01575 PBP1_GntR Ligand-binding domain of DNA transcription repressor GntR specific for gluconate, a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>PRK10727 DNA-binding transcriptional regulator GalR; Provisional Back     alignment and domain information
>cd06286 PBP1_CcpB_like Ligand-binding domain of a novel transcription factor implicated in catabolite repression in Bacillus and Clostridium species Back     alignment and domain information
>PRK09526 lacI lac repressor; Reviewed Back     alignment and domain information
>cd06283 PBP1_RegR_EndR_KdgR_like Ligand-binding domain of DNA transcription repressor RegR and other putative regulators such as KdgR and EndR Back     alignment and domain information
>cd01538 PBP1_ABC_xylose_binding Periplasmic xylose-binding component of the ABC-type transport systems that belong to a family of pentose/hexose sugar-binding proteins of the type I periplasmic binding protein (PBP1) superfamily Back     alignment and domain information
>PF04392 ABC_sub_bind: ABC transporter substrate binding protein; InterPro: IPR007487 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>cd01543 PBP1_XylR Ligand-binding domain of DNA transcription repressor specific for xylose (XylR) Back     alignment and domain information
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction AMP + MgATP = ADP + MgADP an essential reaction for many processes in living cells Back     alignment and domain information
>cd01541 PBP1_AraR Ligand-binding domain of DNA transcription repressor specific for arabinose (AraR) which is a member of the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>cd06285 PBP1_LacI_like_7 Ligand-binding domain of uncharacterized DNA-binding regulatory proteins that are members of the LacI-GalR family of bacterial transcription repressors Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
3h6g_A 395 Crystal Structure Of The Glur6 Amino Terminal Domai 1e-22
3qlt_A 395 Crystal Structure Of A Gluk2 (Glur6) Glycan Wedge H 1e-22
3olz_A 398 Crystal Structure Of The Gluk3 (Glur7) Atd Dimer At 5e-21
3o2j_A 388 Structure Of The Glua2 Ntd-Dimer Interface Mutant, 2e-06
3om0_A 393 Crystal Structure Of The Gluk5 (Ka2) Atd Crystallog 2e-06
3kg2_A 823 Ampa Subtype Ionotropic Glutamate Receptor In Compl 5e-06
3n6v_A 374 Structure Of The Glua2 Ntd-Dimer Interface Mutant, 5e-06
3hsy_A 376 High Resolution Structure Of A Dimeric Glur2 N-Term 5e-06
3h5v_A 394 Crystal Structure Of The Glur2-atd Length = 394 6e-06
2wjw_A 388 Crystal Structure Of The Human Ionotropic Glutamate 3e-05
4gpa_A 389 High Resolution Structure Of The Glua4 N-Terminal D 2e-04
3saj_A 384 Crystal Structure Of Glutamate Receptor Glua1 Amino 2e-04
1ewk_A 490 Crystal Structure Of Metabotropic Glutamate Recepto 6e-04
3ks9_A 496 Metabotropic Glutamate Receptor Mglur1 Complexed Wi 6e-04
>pdb|3H6G|A Chain A, Crystal Structure Of The Glur6 Amino Terminal Domain Dimer Assembly Length = 395 Back     alignment and structure

Iteration: 1

Score = 102 bits (253), Expect = 1e-22, Method: Compositional matrix adjust. Identities = 53/141 (37%), Positives = 81/141 (57%), Gaps = 4/141 (2%) Query: 2 AEATMCRQLQNGVQALFGPSDALLGPHVQSICEALDVPHMESRLDLEL--NSKEFSVNLY 59 A C QL GV A+FGPS + VQSIC AL VPH+++R ++ N F V+LY Sbjct: 60 ASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLY 119 Query: 60 PSQKLLNAAFKDVIRFLNWTKVAIVYEEDNGLFKLQELVKTPPTLKTEMYIRH--ANPST 117 P L+ A D+++F W V +VY++ GL +LQEL+K P + IR A+ Sbjct: 120 PDFSSLSRAILDLVQFFKWKTVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKD 179 Query: 118 YRNVLREIRQKEIFNLIIDTS 138 + +L+E+++ + F++I D S Sbjct: 180 AKPLLKEMKRGKEFHVIFDCS 200
>pdb|3QLT|A Chain A, Crystal Structure Of A Gluk2 (Glur6) Glycan Wedge Homodimer Assembly Length = 395 Back     alignment and structure
>pdb|3OLZ|A Chain A, Crystal Structure Of The Gluk3 (Glur7) Atd Dimer At 2.75 Angstrom Resolution Length = 398 Back     alignment and structure
>pdb|3O2J|A Chain A, Structure Of The Glua2 Ntd-Dimer Interface Mutant, N54a Length = 388 Back     alignment and structure
>pdb|3OM0|A Chain A, Crystal Structure Of The Gluk5 (Ka2) Atd Crystallographic Dimer At 1.4 Angstrom Resolution Length = 393 Back     alignment and structure
>pdb|3KG2|A Chain A, Ampa Subtype Ionotropic Glutamate Receptor In Complex With Competitive Antagonist Zk 200775 Length = 823 Back     alignment and structure
>pdb|3N6V|A Chain A, Structure Of The Glua2 Ntd-Dimer Interface Mutant, T78a Length = 374 Back     alignment and structure
>pdb|3HSY|A Chain A, High Resolution Structure Of A Dimeric Glur2 N-Terminal Domain (Ntd) Length = 376 Back     alignment and structure
>pdb|3H5V|A Chain A, Crystal Structure Of The Glur2-atd Length = 394 Back     alignment and structure
>pdb|2WJW|A Chain A, Crystal Structure Of The Human Ionotropic Glutamate Receptor Glur2 Atd Region At 1.8 A Resolution Length = 388 Back     alignment and structure
>pdb|4GPA|A Chain A, High Resolution Structure Of The Glua4 N-Terminal Domain (Ntd) Length = 389 Back     alignment and structure
>pdb|3SAJ|A Chain A, Crystal Structure Of Glutamate Receptor Glua1 Amino Terminal Domain Length = 384 Back     alignment and structure
>pdb|1EWK|A Chain A, Crystal Structure Of Metabotropic Glutamate Receptor Subtype 1 Complexed With Glutamate Length = 490 Back     alignment and structure
>pdb|3KS9|A Chain A, Metabotropic Glutamate Receptor Mglur1 Complexed With Ly341495 Antagonist Length = 496 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 9e-31
3h6g_A 395 Glutamate receptor, ionotropic kainate 2; membrane 7e-30
3om0_A 393 Glutamate receptor, ionotropic kainate 5; membrane 1e-26
3o21_A 389 Glutamate receptor 3; periplasmatic binding protei 6e-26
3hsy_A 376 Glutamate receptor 2; ligand-gated ION channel, sy 6e-26
3saj_A 384 Glutamate receptor 1; rossman fold, ION channel, m 5e-25
3qel_B 364 Glutamate [NMDA] receptor subunit epsilon-2; ION c 1e-16
3qek_A 384 NMDA glutamate receptor subunit; amino terminal do 3e-16
1jdp_A 441 NPR-C, atrial natriuretic peptide clearance recept 1e-06
4f11_A 433 Gamma-aminobutyric acid type B receptor subunit 2; 4e-06
1dp4_A 435 Atrial natriuretic peptide receptor A; periplasmic 2e-05
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Length = 823 Back     alignment and structure
 Score =  115 bits (288), Expect = 9e-31
 Identities = 34/155 (21%), Positives = 60/155 (38%), Gaps = 11/155 (7%)

Query: 2   AEATMCRQLQNGVQALFGPSDALLGPHVQSICEALDVPHMESRLDLELNSKEFSVNLYPS 61
                C Q   GV A+FG  D      + S C  L V  +         +  F + + P 
Sbjct: 49  VTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFP-TDGTHPFVIQMRPD 107

Query: 62  QKLLNAAFKDVIRFLNWTKVAIVYEEDNGLFKLQELVKTPPTLKTEMYIRH-------AN 114
              L  A   +I +  W K A +Y+ D GL  LQ ++ +    K ++   +         
Sbjct: 108 ---LKGALLSLIEYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKK 164

Query: 115 PSTYRNVLREIRQKEIFNLIIDTSTTHISQFFRAV 149
             TYR++ +++  K+   +I+D     ++     V
Sbjct: 165 DETYRSLFQDLELKKERRVILDCERDKVNDIVDQV 199


>3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Length = 395 Back     alignment and structure
>3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Length = 393 Back     alignment and structure
>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Length = 389 Back     alignment and structure
>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Length = 376 Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Length = 384 Back     alignment and structure
>3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* Length = 364 Back     alignment and structure
>3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* Length = 384 Back     alignment and structure
>1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Length = 441 Back     alignment and structure
>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Length = 433 Back     alignment and structure
>1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Length = 435 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
3h6g_A 395 Glutamate receptor, ionotropic kainate 2; membrane 99.94
4gpa_A 389 Glutamate receptor 4; PBP fold, ligand-gated ION c 99.94
3o21_A 389 Glutamate receptor 3; periplasmatic binding protei 99.94
3qel_B 364 Glutamate [NMDA] receptor subunit epsilon-2; ION c 99.93
3hsy_A 376 Glutamate receptor 2; ligand-gated ION channel, sy 99.93
3om0_A 393 Glutamate receptor, ionotropic kainate 5; membrane 99.92
3sm9_A 479 Mglur3, metabotropic glutamate receptor 3; structu 99.92
3qek_A 384 NMDA glutamate receptor subunit; amino terminal do 99.92
1jdp_A 441 NPR-C, atrial natriuretic peptide clearance recept 99.92
3ks9_A 496 Mglur1, metabotropic glutamate receptor 1; glutama 99.91
2e4u_A 555 Metabotropic glutamate receptor 3; G-protein-coupl 99.91
3saj_A 384 Glutamate receptor 1; rossman fold, ION channel, m 99.91
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 99.91
4f11_A 433 Gamma-aminobutyric acid type B receptor subunit 2; 99.91
3mq4_A 481 Mglur7, metabotropic glutamate receptor 7; glutama 99.9
1dp4_A 435 Atrial natriuretic peptide receptor A; periplasmic 99.89
3h5l_A 419 Putative branched-chain amino acid ABC transporter 99.81
3i45_A 387 Twin-arginine translocation pathway signal protei; 99.8
3i09_A 375 Periplasmic branched-chain amino acid-binding Pro; 99.78
3n0w_A 379 ABC branched chain amino acid family transporter, 99.77
4eyg_A 368 Twin-arginine translocation pathway signal; PSI-bi 99.76
3td9_A 366 Branched chain amino acid ABC transporter, peripl 99.76
3ipc_A 356 ABC transporter, substrate binding protein (amino; 99.74
4f06_A 371 Extracellular ligand-binding receptor; PSI-biology 99.74
3lop_A 364 Substrate binding periplasmic protein; protein str 99.73
3eaf_A 391 ABC transporter, substrate binding protein; PSI2, 99.72
3sg0_A 386 Extracellular ligand-binding receptor; structural 99.7
3snr_A 362 Extracellular ligand-binding receptor; structural 99.7
3hut_A 358 Putative branched-chain amino acid ABC transporter 99.7
4evq_A 375 Putative ABC transporter subunit, substrate-bindi 99.7
1usg_A 346 Leucine-specific binding protein; leucine-binding 99.69
3lkb_A 392 Probable branched-chain amino acid ABC transporter 99.68
3n0x_A 374 Possible substrate binding protein of ABC transpo 99.68
4gnr_A 353 ABC transporter substrate-binding protein-branche 99.58
1pea_A 385 Amidase operon; gene regulator, receptor, binding 99.57
2h4a_A 325 YRAM (HI1655); perplasmic binding protein, lipopro 99.44
3ckm_A 327 YRAM (HI1655), LPOA; periplasmic-binding protein, 99.37
2h3h_A 313 Sugar ABC transporter, periplasmic sugar-binding p 97.0
3rot_A297 ABC sugar transporter, periplasmic sugar binding; 96.68
3o74_A272 Fructose transport system repressor FRUR; dual tra 96.63
3ksm_A276 ABC-type sugar transport system, periplasmic COMP; 96.01
2fn9_A290 Ribose ABC transporter, periplasmic ribose-bindin; 95.93
1dbq_A289 Purine repressor; transcription regulation, DNA-bi 95.81
3c3k_A285 Alanine racemase; structural genomics, protein str 95.61
3brq_A296 HTH-type transcriptional regulator ASCG; transcrip 95.6
3g1w_A 305 Sugar ABC transporter; sugar-binding protein, baci 95.44
2iks_A293 DNA-binding transcriptional dual regulator; escher 95.35
3dbi_A338 Sugar-binding transcriptional regulator, LACI FAM; 95.31
3gbv_A304 Putative LACI-family transcriptional regulator; NY 95.28
2x7x_A 325 Sensor protein; transferase, sensor histidine kina 95.2
3hcw_A295 Maltose operon transcriptional repressor; RNA-bind 95.1
1tjy_A 316 Sugar transport protein; protein-ligand complex, s 95.03
3l6u_A293 ABC-type sugar transport system periplasmic compo; 94.93
3e61_A277 Putative transcriptional repressor of ribose OPER; 94.77
2qu7_A288 Putative transcriptional regulator; structural gen 94.77
3brs_A289 Periplasmic binding protein/LACI transcriptional; 94.68
3jy6_A276 Transcriptional regulator, LACI family; NYSGXRC, P 94.57
2qh8_A302 Uncharacterized protein; conserved domain protein, 94.4
3qk7_A294 Transcriptional regulators; structural genomics, N 94.36
3k9c_A289 Transcriptional regulator, LACI family protein; PS 94.36
2h0a_A276 TTHA0807, transcriptional regulator; repressor, st 94.34
3l49_A291 ABC sugar (ribose) transporter, periplasmic substr 94.33
3tb6_A298 Arabinose metabolism transcriptional repressor; tr 94.29
2fep_A289 Catabolite control protein A; CCPA, transcriptiona 94.28
2o20_A332 Catabolite control protein A; CCPA, transcriptiona 94.24
3gyb_A280 Transcriptional regulators (LACI-family transcript 94.1
2rjo_A 332 Twin-arginine translocation pathway signal protei; 94.0
2rgy_A290 Transcriptional regulator, LACI family; 11011J, NY 93.94
3o1i_D304 Periplasmic protein TORT; ligand free, two compone 93.88
3egc_A291 Putative ribose operon repressor; structural genom 93.85
3d8u_A275 PURR transcriptional regulator; APC91343.1, vibrio 93.8
3bbl_A287 Regulatory protein of LACI family; protein structu 93.77
3kke_A303 LACI family transcriptional regulator; structural 93.65
1qpz_A340 PURA, protein (purine nucleotide synthesis repress 93.6
2hsg_A332 Glucose-resistance amylase regulator; CCPA, transc 93.52
3lft_A295 Uncharacterized protein; ABC, ATPase, cassette, L- 93.49
3gv0_A288 Transcriptional regulator, LACI family; transcript 93.38
3clk_A290 Transcription regulator; 11017J, PSI-II, NYSGXRC, 93.16
4fe7_A 412 Xylose operon regulatory protein; HTH_ARAC, helix- 93.15
3d02_A 303 Putative LACI-type transcriptional regulator; peri 93.03
2fvy_A309 D-galactose-binding periplasmic protein; periplasm 92.89
3k4h_A292 Putative transcriptional regulator; structural gen 92.54
2ioy_A283 Periplasmic sugar-binding protein; ribose binding 92.53
3cs3_A277 Sugar-binding transcriptional regulator, LACI FAM; 92.48
3bil_A348 Probable LACI-family transcriptional regulator; st 92.11
2vk2_A 306 YTFQ, ABC transporter periplasmic-binding protein 92.06
2rbg_A126 Putative uncharacterized protein ST0493; hypotheti 91.6
3h5o_A339 Transcriptional regulator GNTR; transcription regu 91.08
3m9w_A 313 D-xylose-binding periplasmic protein; xylose bindi 90.9
3g85_A289 Transcriptional regulator (LACI family); transcrip 90.58
3h75_A 350 Periplasmic sugar-binding domain protein; protein 90.03
3hs3_A277 Ribose operon repressor; PSI-II, NYSGXRC, periplas 89.36
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 88.52
3jvd_A333 Transcriptional regulators; structural genomics, P 88.36
3kjx_A344 Transcriptional regulator, LACI family; LACL famil 87.79
3huu_A305 Transcription regulator like protein; PSI-II, NYSG 87.66
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 87.52
1byk_A255 Protein (trehalose operon repressor); LACI family, 86.9
3ctp_A330 Periplasmic binding protein/LACI transcriptional; 86.57
1jye_A349 Lactose operon repressor; gene regulation, protein 86.28
3h5t_A 366 Transcriptional regulator, LACI family; DNA-depend 85.53
1jx6_A342 LUXP protein; protein-ligand complex, signaling pr 85.37
3e3m_A355 Transcriptional regulator, LACI family; structural 85.22
3ixl_A240 Amdase, arylmalonate decarboxylase; enantioselecti 84.08
2fqx_A 318 Membrane lipoprotein TMPC; ABC transport system, l 80.58
>3h6g_A Glutamate receptor, ionotropic kainate 2; membrane protein glycoprotein, cell junction, cell membrane, glycoprotein, ION transport; HET: NAG TLA; 2.70A {Rattus norvegicus} PDB: 3h6h_A* 3qlv_C 3qlu_C* 3qlt_A* 3olz_A* Back     alignment and structure
Probab=99.94  E-value=2.1e-26  Score=172.97  Aligned_cols=148  Identities=35%  Similarity=0.652  Sum_probs=132.4

Q ss_pred             hHHHHHHHhhCCcEEEEcCCCCCcHHHHHHhhcccCCCceeeccC-CC-CCCcccEEEecCChhHHHHHHHHHHHhcCCc
Q psy18065          2 AEATMCRQLQNGVQALFGPSDALLGPHVQSICEALDVPHMESRLD-LE-LNSKEFSVNLYPSQKLLNAAFKDVIRFLNWT   79 (149)
Q Consensus         2 ~~~~~c~~~~~~v~aiiGp~~s~~~~~v~~~~~~~~iP~is~~~~-~~-~~~~~~~~~~~p~~~~~~~ai~~ll~~~~W~   79 (149)
                      +.+..|++++++|.+||||.+|..+.+++++++.+++|+|++++. +. .+..+|+||+.|++..++.++++++++|||+
T Consensus        60 ~~~~a~~l~~~~V~aiiG~~~S~~~~a~~~~~~~~~ip~is~~~~~~~l~~~~~~~~r~~~~~~~~~~~~~~~~~~~g~~  139 (395)
T 3h6g_A           60 ASKKACDQLSLGVAAIFGPSHSSSANAVQSICNALGVPHIQTRWKHQVSDNKDSFYVSLYPDFSSLSRAILDLVQFFKWK  139 (395)
T ss_dssp             HHHHHHHHHHHCCSCEECCSSHHHHHHHHHHHHHTTCCEEECSCCCCCTTCCCCSEEEEEECHHHHHHHHHHHHHHTTCS
T ss_pred             HHHHHHHhhhcCcEEEECCCChhHHHHHHHHHhcCCCCeEeeccCcccccccCceEEEecCCHHHHHHHHHHHHHHCCCe
Confidence            356789999989999999999999999999999999999998753 22 3456889999999999999999999999999


Q ss_pred             EEEEEeecCcchhhHHHHHhCCCCCCceEEEEecCC--CchHHHHHHHHhCCCceEEEecCchhHHHHHhhC
Q psy18065         80 KVAIVYEEDNGLFKLQELVKTPPTLKTEMYIRHANP--STYRNVLREIRQKEIFNLIIDTSTTHISQFFRAV  149 (149)
Q Consensus        80 ~v~vi~~~~~~~~~l~~l~~~~~~~~~~v~~~~~~~--~d~~~~l~~i~~~~~~~iil~~~~~~~~~il~qA  149 (149)
                      ||+++|++++|...++.+.+.+++.|+++...+++.  .|+..++++|+++++++|++.+....+..+++||
T Consensus       140 ~v~ii~d~~~g~~~~~~~~~~~~~~g~~v~~~~~~~~~~d~~~~l~~i~~~~~~vi~~~~~~~~~~~~~~qa  211 (395)
T 3h6g_A          140 TVTVVYDDSTGLIRLQELIKAPSRYNLRLKIRQLPADTKDAKPLLKEMKRGKEFHVIFDCSHEMAAGILKQA  211 (395)
T ss_dssp             EEEEEESSTHHHHHTHHHHTGGGTSSCEEEEEECCSSGGGGHHHHHHHHHTTCCEEEEESCHHHHHHHHHHH
T ss_pred             EEEEEEEChhHHHHHHHHHHhhhcCCceEEEEEeCCCchhHHHHHHHHhhcCCeEEEEECCHHHHHHHHHHH
Confidence            999999888899889999988888899987766653  5899999999999999999999999999999885



>4gpa_A Glutamate receptor 4; PBP fold, ligand-gated ION channel, ION transport, transmembrane AMPA receptor regulating proteins, cornichons, ckamp44; HET: NAG; 2.25A {Rattus norvegicus} Back     alignment and structure
>3o21_A Glutamate receptor 3; periplasmatic binding protein, oligomerization, membrane, TR protein; HET: NAG; 2.20A {Rattus norvegicus} PDB: 3p3w_A Back     alignment and structure
>3qel_B Glutamate [NMDA] receptor subunit epsilon-2; ION channel, allosteric modulation, phenylethanolamine, N-glycosylation, extracellular; HET: NAG BMA MAN FUC QEL; 2.60A {Rattus norvegicus} PDB: 3qem_B* 3jpw_A* 3jpy_A* Back     alignment and structure
>3hsy_A Glutamate receptor 2; ligand-gated ION channel, synapse, cell CELL membrane, endoplasmic reticulum, glycoprotein, ION TRA ionic channel; HET: NAG BMA; 1.75A {Rattus norvegicus} PDB: 3h5v_A* 3h5w_A 3o2j_A* 2wjw_A* 2wjx_A 3n6v_A Back     alignment and structure
>3om0_A Glutamate receptor, ionotropic kainate 5; membrane protein, ION channel; HET: NAG BMA GOL; 1.40A {Rattus norvegicus} PDB: 3om1_A* 3qlu_A* 3qlv_A Back     alignment and structure
>3sm9_A Mglur3, metabotropic glutamate receptor 3; structural genomics, structural genomics consortium, SGC, CE membrane, G-protein coupled receptor; HET: Z99; 2.26A {Homo sapiens} Back     alignment and structure
>3qek_A NMDA glutamate receptor subunit; amino terminal domain, ION channel, NMDA receptor, allosteri modulation, phenylethanolamine, polyamine; HET: NAG BMA; 2.00A {Xenopus laevis} PDB: 3qel_A* 3qem_A* 3q41_A* Back     alignment and structure
>1jdp_A NPR-C, atrial natriuretic peptide clearance receptor; hormone-receptor complex, natriuretic peptide receptor, ALLO activation, signaling protein; HET: NDG NAG; 2.00A {Homo sapiens} SCOP: c.93.1.1 PDB: 1jdn_A* 1yk0_A* 1yk1_A* Back     alignment and structure
>3ks9_A Mglur1, metabotropic glutamate receptor 1; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99 NAG; 1.90A {Homo sapiens} SCOP: c.93.1.1 PDB: 1ewk_A* 1ewt_A* 1ewv_A 1isr_A* 1iss_A* 3lmk_A* Back     alignment and structure
>2e4u_A Metabotropic glutamate receptor 3; G-protein-coupled receptor, neuron, central nerve system, SI protein; HET: NAG GLU; 2.35A {Rattus norvegicus} PDB: 2e4v_A* 2e4w_A* 2e4x_A* 2e4y_A* Back     alignment and structure
>3saj_A Glutamate receptor 1; rossman fold, ION channel, membrane, transport protein; HET: NAG BMA MAN; 2.50A {Rattus norvegicus} Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
>4f11_A Gamma-aminobutyric acid type B receptor subunit 2; venus flytrap module, G-protein coupled receptor, signaling; 2.38A {Homo sapiens} PDB: 4f12_A* Back     alignment and structure
>3mq4_A Mglur7, metabotropic glutamate receptor 7; glutamate receptors, dimerization, glutamic acid BIN structural genomics, structural genomics consortium; HET: Z99; 2.80A {Homo sapiens} SCOP: c.93.1.0 PDB: 2e4z_A* Back     alignment and structure
>1dp4_A Atrial natriuretic peptide receptor A; periplasmic binding protein fold, dimer, hormone/growth FACT receptor, lyase complex; HET: NAG; 2.00A {Rattus norvegicus} SCOP: c.93.1.1 PDB: 1t34_A* 3a3k_A* Back     alignment and structure
>3h5l_A Putative branched-chain amino acid ABC transporter; structural genomics, PSI-2, protein structure initiative; 1.70A {Ruegeria pomeroyi} Back     alignment and structure
>3i45_A Twin-arginine translocation pathway signal protei; structural genomics; 1.36A {Rhodospirillum rubrum} Back     alignment and structure
>3i09_A Periplasmic branched-chain amino acid-binding Pro; type I periplasmic binding protein, structural genomics, JOI for structural genomics; HET: MSE CIT; 1.80A {Burkholderia mallei} Back     alignment and structure
>3n0w_A ABC branched chain amino acid family transporter, periplasmic ligand binding protein...; receptor family ligand binding region; HET: MSE; 1.88A {Burkholderia xenovorans} Back     alignment and structure
>4eyg_A Twin-arginine translocation pathway signal; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: VNL; 1.86A {Rhodopseudomonas palustris} PDB: 4ey3_A* 3t0n_A* 4eyk_A* Back     alignment and structure
>3td9_A Branched chain amino acid ABC transporter, peripl amino acid-binding protein; leucine binding, structural genomics; HET: MSE PHE; 1.90A {Thermotoga maritima} Back     alignment and structure
>3ipc_A ABC transporter, substrate binding protein (amino; venus flytrap domain, transport protein; 1.30A {Agrobacterium tumefaciens} PDB: 3ip5_A 3ip6_A 3ip7_A 3ip9_A 3ipa_A Back     alignment and structure
>4f06_A Extracellular ligand-binding receptor; PSI-biology, MCSG, midwest center for structural genomics, transporter; HET: MSE PHB; 1.30A {Rhodopseudomonas palustris} PDB: 4evs_A* Back     alignment and structure
>3lop_A Substrate binding periplasmic protein; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.55A {Ralstonia solanacearum} Back     alignment and structure
>3eaf_A ABC transporter, substrate binding protein; PSI2, NYSGXRC, substrate binding P structural genomics, protein structure initiative; 2.00A {Aeropyrum pernix} Back     alignment and structure
>3sg0_A Extracellular ligand-binding receptor; structural genomics, PSI-biology; HET: 173; 1.20A {Rhodopseudomonas palustris} PDB: 4dqd_A* Back     alignment and structure
>3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170} Back     alignment and structure
>4evq_A Putative ABC transporter subunit, substrate-bindi component; structural genomics, PSI-biology, midwest center for structu genomics; HET: MSE PHB; 1.40A {Rhodopseudomonas palustris} PDB: 4evr_A Back     alignment and structure
>1usg_A Leucine-specific binding protein; leucine-binding protein, X-RAY crystallography, protein structure, ABC transport systems, transport protein; 1.53A {Escherichia coli} SCOP: c.93.1.1 PDB: 1usi_A* 1usk_A 2lbp_A 1z15_A 1z16_A 1z17_A 1z18_A 2liv_A Back     alignment and structure
>3lkb_A Probable branched-chain amino acid ABC transporter, amino acid binding protein; branched amino acid, PSI-II, NYSGXRC, structural genomics; 2.40A {Thermus thermophilus} Back     alignment and structure
>3n0x_A Possible substrate binding protein of ABC transpo system; receptor family ligand binding region, structural genomics; HET: MSE; 1.50A {Rhodopseudomonas palustris} PDB: 3nnd_B Back     alignment and structure
>4gnr_A ABC transporter substrate-binding protein-branche amino acid transport; amino acid-binding protein, surface-exposed protein; HET: MLY; 1.00A {Streptococcus pneumoniae} Back     alignment and structure
>1pea_A Amidase operon; gene regulator, receptor, binding protein; 2.10A {Pseudomonas aeruginosa} SCOP: c.93.1.1 PDB: 1qo0_A 1qnl_A Back     alignment and structure
>3ckm_A YRAM (HI1655), LPOA; periplasmic-binding protein, lipoprotein, unliganded, biosynthetic protein; 1.35A {Haemophilus influenzae} SCOP: c.93.1.1 Back     alignment and structure
>2h3h_A Sugar ABC transporter, periplasmic sugar-binding protein; glucose binding protein, periplasmic binding protein, GBP; HET: BGC; 1.70A {Thermotoga maritima} PDB: 2qvc_A* 3c6q_B* Back     alignment and structure
>3rot_A ABC sugar transporter, periplasmic sugar binding; nysgrc, PSI-biology, structural genomics; 1.91A {Legionella pneumophila subsp} Back     alignment and structure
>3o74_A Fructose transport system repressor FRUR; dual transcriptional regulator, DNA, transcription; 2.00A {Pseudomonas putida} PDB: 3o75_A* Back     alignment and structure
>3ksm_A ABC-type sugar transport system, periplasmic COMP; periplasmic component, PSI- 11023L, structural genomics, protein structure initiative; HET: BDR; 1.90A {Hahella chejuensis} Back     alignment and structure
>2fn9_A Ribose ABC transporter, periplasmic ribose-bindin; RBP, ribose binding protein, periplasmic binding protein, thermophilic proteins; 1.40A {Thermotoga maritima} PDB: 2fn8_A* Back     alignment and structure
>1dbq_A Purine repressor; transcription regulation, DNA-binding regulatory protein; 2.20A {Escherichia coli} SCOP: c.93.1.1 PDB: 1jhz_A Back     alignment and structure
>3c3k_A Alanine racemase; structural genomics, protein structure initiative, NEW YORK research center for structural genomics, nysgxrc; 1.99A {Actinobacillus succinogenes} Back     alignment and structure
>3brq_A HTH-type transcriptional regulator ASCG; transcriptional repressor structure escherichia coli, struct genomics, PSI-2; HET: FRU; 2.00A {Escherichia coli} Back     alignment and structure
>3g1w_A Sugar ABC transporter; sugar-binding protein, bacillus halod target 11229F, transport protein, structural genomics; 2.02A {Bacillus halodurans c-125} Back     alignment and structure
>2iks_A DNA-binding transcriptional dual regulator; escherichia coli structural genomics, PSI-2, protein structure initiative; 1.85A {Escherichia coli} Back     alignment and structure
>3dbi_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative, PSI-2; HET: MSE; 2.45A {Escherichia coli K12} Back     alignment and structure
>3gbv_A Putative LACI-family transcriptional regulator; NYSGXRC, PSI-II, 11231J, structur genomics, protein structure initiative; 2.20A {Bacteroides fragilis} Back     alignment and structure
>2x7x_A Sensor protein; transferase, sensor histidine kinase; HET: FRU; 2.64A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3hcw_A Maltose operon transcriptional repressor; RNA-binding, PSI-2, NYSGXRC, STRU genomics, protein structure initiative; 2.20A {Staphylococcus aureus subsp} Back     alignment and structure
>1tjy_A Sugar transport protein; protein-ligand complex, signaling protein; HET: PAV; 1.30A {Salmonella typhimurium} SCOP: c.93.1.1 PDB: 1tm2_A 3t95_A* 3ejw_A* Back     alignment and structure
>3l6u_A ABC-type sugar transport system periplasmic compo; structural genomics, nysgrc, target 11006S, PSI-2, protein S initiative; 1.90A {Exiguobacterium sibiricum} Back     alignment and structure
>3e61_A Putative transcriptional repressor of ribose OPER; structural genomics, DNA-binding, transcripti regulation, PSI-2; 2.00A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>2qu7_A Putative transcriptional regulator; structural genomics, PSI-2, protein structure initiative; 2.30A {Staphylococcus saprophyticus subsp} Back     alignment and structure
>3brs_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; 2.00A {Clostridium phytofermentans} Back     alignment and structure
>3jy6_A Transcriptional regulator, LACI family; NYSGXRC, PSI-II, protein S initiative, structural genomics; 1.97A {Lactobacillus brevis} Back     alignment and structure
>3qk7_A Transcriptional regulators; structural genomics, NEW YORK structural genomix research CO NYSGXRC, PSI-2, protein structur initiative; 2.70A {Yersinia pestis} Back     alignment and structure
>3k9c_A Transcriptional regulator, LACI family protein; PSI-II, 11026W, structural genomics, PR structure initiative; 2.14A {Rhodococcus jostii} Back     alignment and structure
>2h0a_A TTHA0807, transcriptional regulator; repressor, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Back     alignment and structure
>3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides} Back     alignment and structure
>3tb6_A Arabinose metabolism transcriptional repressor; transcription regulation, arabinose binding, DNA binding Pro; HET: ARB; 2.21A {Bacillus subtilis} Back     alignment and structure
>2fep_A Catabolite control protein A; CCPA, transcriptional regulator; HET: SEP; 2.45A {Bacillus subtilis} PDB: 2nzu_G* 1sxh_A 1sxi_A 1sxg_A* 2nzv_G* 2oen_G* Back     alignment and structure
>2o20_A Catabolite control protein A; CCPA, transcriptional regulator, helix-turn-helix, transcrip; 1.90A {Lactococcus lactis} Back     alignment and structure
>3gyb_A Transcriptional regulators (LACI-family transcriptional regulatory protein); protein structure initiative II(PSI II), nysgxrc; 1.60A {Corynebacterium glutamicum} Back     alignment and structure
>2rjo_A Twin-arginine translocation pathway signal protei; PSI-2, NYSGXRC, twin arginine translocation pathway signal P structural genomics; HET: GAL; 2.05A {Burkholderia phytofirmans} Back     alignment and structure
>2rgy_A Transcriptional regulator, LACI family; 11011J, NYSGXRC, transctiptional regulator, SUG binding protein, structural genomics, PSI-2; 2.05A {Burkholderia phymatum} Back     alignment and structure
>3o1i_D Periplasmic protein TORT; ligand free, two component sensor, periplasmic binding prote signaling protein; HET: PE4; 2.80A {Vibrio parahaemolyticus} PDB: 3o1h_B* 3o1j_C Back     alignment and structure
>3egc_A Putative ribose operon repressor; structural genomics, unknown function, DNA-binding, transcri transcription regulation, PSI-2; 2.35A {Burkholderia thailandensis} Back     alignment and structure
>3d8u_A PURR transcriptional regulator; APC91343.1, vibrio parahaem RIMD 2210633, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.88A {Vibrio parahaemolyticus} Back     alignment and structure
>3bbl_A Regulatory protein of LACI family; protein structure initiative II, PSI-II, NYSGXRC, transcript regulator, periplasmic binding protein; 2.35A {Chloroflexus aggregans} Back     alignment and structure
>3kke_A LACI family transcriptional regulator; structural genomics, DNA-binding, transcription regulation, PSI-2; 2.20A {Mycobacterium smegmatis str} Back     alignment and structure
>1qpz_A PURA, protein (purine nucleotide synthesis repressor); transcription regulation, DNA-binding, purine biosynthesis; HET: DNA HPA; 2.50A {Escherichia coli} SCOP: a.35.1.5 c.93.1.1 PDB: 1bdi_A* 1qp0_A* 1qp4_A* 1pnr_A* 1wet_A* 1zay_A* 1vpw_A* 2pue_A* 2puf_A* 2pug_A* 1bdh_A* 1qp7_A* 1qqa_A* 1qqb_A* 2puc_A* 2pua_A* 2pub_A* 2pud_A* 1jfs_A* 1jh9_A* ... Back     alignment and structure
>2hsg_A Glucose-resistance amylase regulator; CCPA, transcriptional regulator, transcription regulator; 2.50A {Bacillus megaterium} SCOP: a.35.1.5 c.93.1.1 PDB: 1rzr_G 2jcg_A 1zvv_A 3oqo_A* 3oqm_A* 3oqn_A* Back     alignment and structure
>3lft_A Uncharacterized protein; ABC, ATPase, cassette, L-Trp, PSI, MCSG, structural genomics center for structural genomics; HET: MSE TRP; 1.35A {Streptococcus pneumoniae} Back     alignment and structure
>3gv0_A Transcriptional regulator, LACI family; transcription regulator, PSI-II, structural genomics structure initiative; 2.35A {Agrobacterium tumefaciens str} Back     alignment and structure
>3clk_A Transcription regulator; 11017J, PSI-II, NYSGXRC, dimer, structural genomics, protein structure initiative; 2.08A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4fe7_A Xylose operon regulatory protein; HTH_ARAC, helix-turn-helix, PBP, periplasmic binding protein binding transcription regulator, DNA xylose; HET: XYS; 2.90A {Escherichia coli} PDB: 4fe4_A Back     alignment and structure
>3d02_A Putative LACI-type transcriptional regulator; periplasmic sugar-binding protein, structura genomics; HET: MSE GOL; 1.30A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2fvy_A D-galactose-binding periplasmic protein; periplasmic binding protien, hinge, chemotaxis, transport,; HET: BGC; 0.92A {Escherichia coli} SCOP: c.93.1.1 PDB: 1glg_A* 2fw0_A* 2gbp_A* 2qw1_A* 2hph_A* 2ipn_A* 2ipm_A* 2ipl_A* 1gca_A* 1gcg_A 3ga5_A* 3gbp_A* Back     alignment and structure
>3k4h_A Putative transcriptional regulator; structural genomics, protein structure INI NEW YORK structural genomix research consortium; HET: MAL; 2.80A {Bacillus cytotoxicus nvh 391-98} Back     alignment and structure
>2ioy_A Periplasmic sugar-binding protein; ribose binding protein, thermophilic proteins; HET: RIP; 1.90A {Thermoanaerobacter tengcongensis} Back     alignment and structure
>3cs3_A Sugar-binding transcriptional regulator, LACI FAM; structural genomics, sugar-binding transcriptional regulator structure initiative; 2.40A {Enterococcus faecalis} Back     alignment and structure
>3bil_A Probable LACI-family transcriptional regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.50A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2vk2_A YTFQ, ABC transporter periplasmic-binding protein YTFQ; transport protein, galactofuranose; HET: GZL; 1.20A {Escherichia coli} Back     alignment and structure
>2rbg_A Putative uncharacterized protein ST0493; hypothetical protein, structural genomics, unknown function, NPPSFA; 1.75A {Sulfolobus tokodaii} Back     alignment and structure
>3h5o_A Transcriptional regulator GNTR; transcription regulator, GNTR,chromobacterium violaceum, PSI, SGX, DNA-binding; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3m9w_A D-xylose-binding periplasmic protein; xylose binding protein, conformational changes, SUGA protein; 2.15A {Escherichia coli} PDB: 3m9x_A* 3ma0_A* Back     alignment and structure
>3g85_A Transcriptional regulator (LACI family); transcription regulator, PSI-II, structural genomics structure initiative; 1.84A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>3h75_A Periplasmic sugar-binding domain protein; protein structure initiative II (PSI II), sugar binding PROT alpha/beta fold; 1.60A {Pseudomonas fluorescens pf-5} Back     alignment and structure
>3hs3_A Ribose operon repressor; PSI-II, NYSGXRC, periplasmic binding protein, structural genomics, protein structure initiative; 1.60A {Lactobacillus acidophilus} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>3jvd_A Transcriptional regulators; structural genomics, PSI-2, sugar binding protein, transcrip regulation, protein structure initiative; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3kjx_A Transcriptional regulator, LACI family; LACL family, protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.33A {Silicibacter pomeroyi} Back     alignment and structure
>3huu_A Transcription regulator like protein; PSI-II, NYSGXRC, LAC I, STR genomics, protein structure initiative; 1.95A {Staphylococcus haemolyticus} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1byk_A Protein (trehalose operon repressor); LACI family, phosphate binding, protein structure, trehalose repressor, gene regulation; HET: T6P; 2.50A {Escherichia coli} SCOP: c.93.1.1 Back     alignment and structure
>3ctp_A Periplasmic binding protein/LACI transcriptional; structural genomics, protein structure initiative; HET: XLF; 1.41A {Alkaliphilus metalliredigens} Back     alignment and structure
>1jye_A Lactose operon repressor; gene regulation, protein stability, protein DNA-binding, transcription; 1.70A {Escherichia coli} SCOP: c.93.1.1 PDB: 1lbi_A 1lbg_A* 1lbh_A 1jyf_A 3edc_A 1efa_A* 1jwl_A* 2pe5_A* 1tlf_A* 2p9h_A* 2paf_A* 1cjg_A* 1l1m_A 1osl_A 2kei_A* 2kej_A* 2kek_A* 2bjc_A 1lqc_A 1lcc_A* ... Back     alignment and structure
>3h5t_A Transcriptional regulator, LACI family; DNA-dependent, protein structure initiative II(PSI II), NYSGXRC, 11232D), structural genomics; 2.53A {Corynebacterium glutamicum} Back     alignment and structure
>1jx6_A LUXP protein; protein-ligand complex, signaling protein; HET: AI2; 1.50A {Vibrio harveyi} SCOP: c.93.1.1 PDB: 1zhh_A* 2hj9_A* Back     alignment and structure
>3e3m_A Transcriptional regulator, LACI family; structural genomics, DNA-binding, plasmid, transcription regulation, PSI-2; 1.60A {Silicibacter pomeroyi} Back     alignment and structure
>3ixl_A Amdase, arylmalonate decarboxylase; enantioselective decarboxylation, lyase; HET: CME PAC; 1.45A {Bordetella bronchiseptica} PDB: 3ixm_A 2vlb_A 3dg9_A 3ip8_A* 3dtv_A* 3eis_A* Back     alignment and structure
>2fqx_A Membrane lipoprotein TMPC; ABC transport system, ligand-binding protein, guanosine, TP0319, transport protein; HET: GMP; 1.70A {Treponema pallidum} PDB: 2fqw_A* 2fqy_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
d1ewka_ 477 Metabotropic glutamate receptor subtype 1 {Rat (Ra 99.93
d1jdpa_ 401 Hormone binding domain of the atrial natriuretic p 99.78
d1dp4a_ 425 Hormone binding domain of the atrial natriuretic p 99.78
d1usga_ 346 Leucine-binding protein {Escherichia coli [TaxId: 99.65
d1qo0a_ 373 Amide receptor/negative regulator of the amidase o 99.59
d3ckma1 317 YraM C-terminal domain {Haemophilus influenzae [Ta 99.38
d1jyea_271 Lac-repressor (lacR) core (C-terminal domain) {Esc 96.18
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 93.98
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 91.35
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 91.23
d1byka_255 Trehalose repressor, C-terminal domain {Escherichi 89.43
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 89.24
d1jx6a_338 Quorum-sensing signal (autoinducer-2) binding prot 88.86
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 88.23
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 86.86
d1dbqa_282 Purine repressor (PurR), C-terminal domain {Escher 86.3
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 86.06
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 85.42
d1nrza_163 Sorbose permease subunit IIb , EIIb-sor {Klebsiell 84.45
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 83.55
d1e5da1152 Rubredoxin oxygen:oxidoreductase (ROO), C-terminal 82.5
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 82.15
d1blea_161 Fructose permease, subunit IIb {Bacillus subtilis 81.95
>d1ewka_ c.93.1.1 (A:) Metabotropic glutamate receptor subtype 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like I
superfamily: Periplasmic binding protein-like I
family: L-arabinose binding protein-like
domain: Metabotropic glutamate receptor subtype 1
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.93  E-value=5.3e-26  Score=173.13  Aligned_cols=139  Identities=16%  Similarity=0.311  Sum_probs=119.2

Q ss_pred             hCCcEEEEcCCCCCcHHHHHHhhcccCCCceeeccC-C--C-CCCcccEEEecCChhHHHHHHHHHHHhcCCcEEEEEee
Q psy18065         11 QNGVQALFGPSDALLGPHVQSICEALDVPHMESRLD-L--E-LNSKEFSVNLYPSQKLLNAAFKDVIRFLNWTKVAIVYE   86 (149)
Q Consensus        11 ~~~v~aiiGp~~s~~~~~v~~~~~~~~iP~is~~~~-~--~-~~~~~~~~~~~p~~~~~~~ai~~ll~~~~W~~v~vi~~   86 (149)
                      .++|.|||||.+|..+.+++.+++.++||+|++++. +  + ...+|+++|+.|++..+++++++++++|||++|++||+
T Consensus       118 ~~~v~aviGp~~s~~s~~va~~~~~~~iP~IS~~ats~~lsd~~~yp~f~Rt~psd~~~~~ai~~ll~~f~W~~V~vi~~  197 (477)
T d1ewka_         118 KKPIAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHT  197 (477)
T ss_dssp             -CCEEEEECCSSHHHHHHHHHHHGGGTCCEEESSCCCGGGGCTTTCTTEEESSCCHHHHHHHHHHHHHHTTCCEEEEEEE
T ss_pred             ccceEEEECCCcchhHHHHHHHhhhccCceeccccCCccccccccCCceEEecccchhhHHHHHHHHHHcCCcEEEEEEe
Confidence            346999999999999999999999999999999863 2  2 35679999999999999999999999999999999998


Q ss_pred             c-CcchhhHHHHHhCCCCCCceEEEE-ecC--C--CchHHHHHHHHhC--CCceEEEecCchhHHHHHhhC
Q psy18065         87 E-DNGLFKLQELVKTPPTLKTEMYIR-HAN--P--STYRNVLREIRQK--EIFNLIIDTSTTHISQFFRAV  149 (149)
Q Consensus        87 ~-~~~~~~l~~l~~~~~~~~~~v~~~-~~~--~--~d~~~~l~~i~~~--~~~~iil~~~~~~~~~il~qA  149 (149)
                      + ++|....+.+.+.+.+.|+|+... .++  .  .++..++++|+++  .+++||+++....+..++++|
T Consensus       198 ~d~~g~~~~~~l~~~~~~~~i~v~~~~~i~~~~~~~~~~~~l~~l~~~~~~~rVIv~~~~~~~~~~ll~~a  268 (477)
T d1ewka_         198 EGNYGESGMDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLLSAM  268 (477)
T ss_dssp             SSHHHHHHHHHHHHHHHHHTCEEEEEEEECTTCCHHHHHHHHHHHHTTTTTCCEEEEECCHHHHHHHHHHH
T ss_pred             cchhHHHHHHHHHHHHHHcCcEEEEEeeccCCCchhhHHHHHHHHhhhccCceEEEEecCHHHHHHHHHHH
Confidence            7 478888888888888889998653 343  2  4688999999876  678899999999999999875



>d1jdpa_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dp4a_ c.93.1.1 (A:) Hormone binding domain of the atrial natriuretic peptide receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1usga_ c.93.1.1 (A:) Leucine-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qo0a_ c.93.1.1 (A:) Amide receptor/negative regulator of the amidase operon (AmiC) {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3ckma1 c.93.1.1 (A:257-573) YraM C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jyea_ c.93.1.1 (A:) Lac-repressor (lacR) core (C-terminal domain) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1byka_ c.93.1.1 (A:) Trehalose repressor, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jx6a_ c.93.1.1 (A:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dbqa_ c.93.1.1 (A:) Purine repressor (PurR), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1nrza_ c.38.1.1 (A:) Sorbose permease subunit IIb , EIIb-sor {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1e5da1 c.23.5.1 (A:251-402) Rubredoxin oxygen:oxidoreductase (ROO), C-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1blea_ c.38.1.1 (A:) Fructose permease, subunit IIb {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure