Psyllid ID: psy18096


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MDYVLPLMETGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSVLPDFDLAELPVEKRLDFGGILASQELLDSLIKERINCYNNLAQAQIKLGSLEPALMSLENVLNLDPNNIKALQRKAKCLILT
cHHHHHccccccEEEEEEccccccccccccccccccccEEEEEEEccccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHcc
cccEHHHHccccEEEEEEccccccccccccccccccccEEEEEEEEEEccccccHHHccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccEEEEc
mdyvlplmetgEECQIEITArfgygdkgepsksippgakLYYSLTLhsvlpdfdlaelpvekrldfggILASQELLDSLIKERINCYNNLAQAQIKLGSLEPALMSLEnvlnldpnnIKALQRKAKCLILT
MDYVLPLMETGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSVLPDFDLAELPVEKRLDFGGILASQELLDSLIKERINCYNNLAQAQIKLGSLEPALMSLENVLNLDPNNIKALQRKAKCLILT
MDYVLPLMETGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSVLPDFDLAELPVEKRLDFGGILASQELLDSLIKERINCYNNLAQAQIKLGSLEPALMSLENVLNLDPNNIKALQRKAKCLILT
****LPLMETGEECQIEITARFGYG***********GAKLYYSLTLHSVLPDFDLAELPVEKRLDFGGILASQELLDSLIKERINCYNNLAQAQIKLGSLEPALMSLENVLNLDPNNIKALQRKAKCLI**
MDYVLPLMETGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSVLPDFDLAELPVEKRLDFGGILASQELLDSLIKERINCYNNLAQAQIKLGSLEPALMSLENVLNLDPNNIKALQRKAKCLILT
MDYVLPLMETGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSVLPDFDLAELPVEKRLDFGGILASQELLDSLIKERINCYNNLAQAQIKLGSLEPALMSLENVLNLDPNNIKALQRKAKCLILT
MDYVLPLMETGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSVLPDFDLAELPVEKRLDFGGILASQELLDSLIKERINCYNNLAQAQIKLGSLEPALMSLENVLNLDPNNIKALQRKAKCLILT
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDYVLPLMETGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSVLPDFDLAELPVEKRLDFGGILASQELLDSLIKERINCYNNLAQAQIKLGSLEPALMSLENVLNLDPNNIKALQRKAKCLILT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query131 2.2.26 [Sep-21-2011]
Q3B7U9403 Peptidyl-prolyl cis-trans yes N/A 0.954 0.310 0.309 2e-09
Q14318412 Peptidyl-prolyl cis-trans yes N/A 0.969 0.308 0.290 7e-09
O35465402 Peptidyl-prolyl cis-trans yes N/A 0.946 0.308 0.309 2e-08
Q9XSI2457 Peptidyl-prolyl cis-trans N/A N/A 0.992 0.284 0.234 4e-05
Q9XSH5457 Peptidyl-prolyl cis-trans N/A N/A 0.992 0.284 0.234 4e-05
Q9XT11457 Peptidyl-prolyl cis-trans N/A N/A 0.992 0.284 0.234 4e-05
Q9VL78439 FK506-binding protein 59 no N/A 0.969 0.289 0.264 5e-05
Q95L05457 Peptidyl-prolyl cis-trans N/A N/A 0.992 0.284 0.234 9e-05
Q13451457 Peptidyl-prolyl cis-trans no N/A 0.992 0.284 0.234 0.0001
Q64378456 Peptidyl-prolyl cis-trans no N/A 0.992 0.285 0.228 0.0001
>sp|Q3B7U9|FKBP8_RAT Peptidyl-prolyl cis-trans isomerase FKBP8 OS=Rattus norvegicus GN=Fkbp8 PE=2 SV=1 Back     alignment and function desciption
 Score = 60.8 bits (146), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/165 (30%), Positives = 70/165 (42%), Gaps = 40/165 (24%)

Query: 1   MDYVLPLMETGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSVLPDFDLAELPV 60
           +D  +PLM  GE   +   +++ YG +G  S  IPP A L   +TL +     DL  L  
Sbjct: 146 LDLSVPLMHVGETAMVTADSKYCYGPQGSRSPYIPPHAALCLEVTLKTAEDGPDLEMLSG 205

Query: 61  EKRL-----------------DFGGILASQELLDSLIKE--------------------R 83
           ++R+                 DF  +LA+    D  IK                     +
Sbjct: 206 QERVALANRKRECGNAHYQRADF--VLAANSY-DLAIKAITSNAKVDMTCEEEEELLQLK 262

Query: 84  INCYNNLAQAQIKLGSLEPALMSLENVLNLDPNNIKALQRKAKCL 128
           + C NNLA +Q+KL     AL S   VL   P+NIKAL RK K L
Sbjct: 263 VKCLNNLAASQLKLDHYRAALRSCSQVLEHQPDNIKALFRKGKVL 307




Constitutively inactive PPiase, which becomes active when bound to calmodulin and calcium. Seems to act as a chaperone for BCL2, targets it to the mitochondria and modulates its phosphorylation state. The BCL2/FKBP8/calmodulin/calcium complex probably interferes with the binding of BCL2 to its targets. The active form of FKBP8 may therefore play a role in the regulation of apoptosis.
Rattus norvegicus (taxid: 10116)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q14318|FKBP8_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP8 OS=Homo sapiens GN=FKBP8 PE=1 SV=2 Back     alignment and function description
>sp|O35465|FKBP8_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP8 OS=Mus musculus GN=Fkbp8 PE=1 SV=2 Back     alignment and function description
>sp|Q9XSI2|FKBP5_SAGOE Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Saguinus oedipus GN=FKBP5 PE=2 SV=2 Back     alignment and function description
>sp|Q9XSH5|FKBP5_SAIBB Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Saimiri boliviensis boliviensis GN=FKBP5 PE=1 SV=1 Back     alignment and function description
>sp|Q9XT11|FKBP5_AOTNA Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Aotus nancymaae GN=FKBP5 PE=2 SV=2 Back     alignment and function description
>sp|Q9VL78|FKB59_DROME FK506-binding protein 59 OS=Drosophila melanogaster GN=FKBP59 PE=1 SV=1 Back     alignment and function description
>sp|Q95L05|FKBP5_CHLAE Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Chlorocebus aethiops GN=FKBP5 PE=2 SV=1 Back     alignment and function description
>sp|Q13451|FKBP5_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens GN=FKBP5 PE=1 SV=2 Back     alignment and function description
>sp|Q64378|FKBP5_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Mus musculus GN=Fkbp5 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
225714660 350 FK506-binding protein 8 [Lepeophtheirus 0.977 0.365 0.362 2e-15
427779287 382 Putative fk506 binding protein 8 [Rhipic 0.961 0.329 0.335 5e-14
427779569 499 Putative fk506 binding protein 8 [Rhipic 0.961 0.252 0.335 7e-14
195120067 401 GI19549 [Drosophila mojavensis] gi|19390 0.977 0.319 0.350 1e-13
170037479 387 FK506 binding protein [Culex quinquefasc 0.977 0.330 0.310 2e-13
195380083 402 GJ21121 [Drosophila virilis] gi|19414359 0.977 0.318 0.338 2e-13
195027892 401 GH21577 [Drosophila grimshawi] gi|193902 0.977 0.319 0.338 3e-13
427783123 425 Putative fk506 binding protein 8 [Rhipic 0.961 0.296 0.329 1e-12
157131940 386 fk506 binding protein [Aedes aegypti] gi 0.977 0.331 0.293 1e-12
427783125 425 Putative fk506 binding protein 8 [Rhipic 0.961 0.296 0.329 1e-12
>gi|225714660|gb|ACO13176.1| FK506-binding protein 8 [Lepeophtheirus salmonis] Back     alignment and taxonomy information
 Score = 87.0 bits (214), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 62/171 (36%), Positives = 84/171 (49%), Gaps = 43/171 (25%)

Query: 1   MDYVLPLMETGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTL-HSVLPDFDLAELP 59
           +DY+LP+M   E  ++   + F YGD+G  S  +PP A L   L L  SV+P  +L +LP
Sbjct: 82  LDYILPIMNVNEVVEVITESDFMYGDQGLDSPPVPPKATLQLKLHLIDSVVPPPNL-DLP 140

Query: 60  VEKRLDFG---------------------GILASQELLDS-------------------- 78
           +E+R+  G                     G   + ++LD                     
Sbjct: 141 LEERMALGARKKERGTFWYNRGEYQMAIFGYRKASQILDDAEIDIEVPIERHTLPLPLQL 200

Query: 79  LIKERINCYNNLAQAQIKLGSLEPALMSLENVLNLDPNNIKALQRKAKCLI 129
           LIKERIN  NNLAQAQ+K  S E +L +L  VL LDPNN KAL RK+K  +
Sbjct: 201 LIKERINALNNLAQAQMKNNSWESSLATLNQVLRLDPNNEKALFRKSKVFL 251




Source: Lepeophtheirus salmonis

Species: Lepeophtheirus salmonis

Genus: Lepeophtheirus

Family: Caligidae

Order: Siphonostomatoida

Class: Maxillopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|427779287|gb|JAA55095.1| Putative fk506 binding protein 8 [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427779569|gb|JAA55236.1| Putative fk506 binding protein 8 [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|195120067|ref|XP_002004550.1| GI19549 [Drosophila mojavensis] gi|193909618|gb|EDW08485.1| GI19549 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|170037479|ref|XP_001846585.1| FK506 binding protein [Culex quinquefasciatus] gi|167880693|gb|EDS44076.1| FK506 binding protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195380083|ref|XP_002048800.1| GJ21121 [Drosophila virilis] gi|194143597|gb|EDW59993.1| GJ21121 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195027892|ref|XP_001986816.1| GH21577 [Drosophila grimshawi] gi|193902816|gb|EDW01683.1| GH21577 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|427783123|gb|JAA57013.1| Putative fk506 binding protein 8 [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|157131940|ref|XP_001662371.1| fk506 binding protein [Aedes aegypti] gi|108871336|gb|EAT35561.1| AAEL012272-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|427783125|gb|JAA57014.1| Putative fk506 binding protein 8 [Rhipicephalus pulchellus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
ZFIN|ZDB-GENE-050208-116504 si:ch211-13k12.1 "si:ch211-13k 0.351 0.091 0.565 6e-11
UNIPROTKB|B7Z7Z8 278 FKBP5 "Peptidyl-prolyl cis-tra 0.534 0.251 0.3 7.1e-09
UNIPROTKB|Q9XSI2 457 FKBP5 "Peptidyl-prolyl cis-tra 0.557 0.159 0.287 1.7e-08
UNIPROTKB|Q9XT11 457 FKBP5 "Peptidyl-prolyl cis-tra 0.580 0.166 0.289 1.7e-08
UNIPROTKB|E1C4X2 449 FKBP5 "Uncharacterized protein 0.534 0.155 0.3 2.1e-08
UNIPROTKB|Q646T7 449 FKBP51 "Uncharacterized protei 0.534 0.155 0.3 2.1e-08
UNIPROTKB|Q9XSH5 457 FKBP5 "Peptidyl-prolyl cis-tra 0.534 0.153 0.3 2.1e-08
UNIPROTKB|E2RLB3 456 FKBP5 "Uncharacterized protein 0.534 0.153 0.3 2.7e-08
UNIPROTKB|F1RYY0 456 FKBP5 "Uncharacterized protein 0.534 0.153 0.3 3.4e-08
UNIPROTKB|G3MXV0 457 FKBP5 "Uncharacterized protein 0.534 0.153 0.3 3.4e-08
ZFIN|ZDB-GENE-050208-116 si:ch211-13k12.1 "si:ch211-13k12.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 128 (50.1 bits), Expect = 6.0e-11, Sum P(2) = 6.0e-11
 Identities = 26/46 (56%), Positives = 33/46 (71%)

Query:    83 RINCYNNLAQAQIKLGSLEPALMSLENVLNLDPNNIKALQRKAKCL 128
             R+ C NNLA AQ+KLG  + AL + ++VL LDP N+KAL RK K L
Sbjct:   360 RVKCLNNLAAAQLKLGHFDEALHTSQDVLFLDPQNVKALFRKGKLL 405


GO:0006457 "protein folding" evidence=IEA
GO:0018208 "peptidyl-proline modification" evidence=IBA
GO:0030176 "integral to endoplasmic reticulum membrane" evidence=IBA
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=IBA
GO:0000413 "protein peptidyl-prolyl isomerization" evidence=IBA
GO:0005528 "FK506 binding" evidence=IBA
GO:0005740 "mitochondrial envelope" evidence=IBA
UNIPROTKB|B7Z7Z8 FKBP5 "Peptidyl-prolyl cis-trans isomerase FKBP5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9XSI2 FKBP5 "Peptidyl-prolyl cis-trans isomerase FKBP5" [Saguinus oedipus (taxid:9490)] Back     alignment and assigned GO terms
UNIPROTKB|Q9XT11 FKBP5 "Peptidyl-prolyl cis-trans isomerase FKBP5" [Aotus nancymaae (taxid:37293)] Back     alignment and assigned GO terms
UNIPROTKB|E1C4X2 FKBP5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q646T7 FKBP51 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9XSH5 FKBP5 "Peptidyl-prolyl cis-trans isomerase FKBP5" [Saimiri boliviensis boliviensis (taxid:39432)] Back     alignment and assigned GO terms
UNIPROTKB|E2RLB3 FKBP5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RYY0 FKBP5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|G3MXV0 FKBP5 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 8e-07
pfam1341469 pfam13414, TPR_11, TPR repeat 0.002
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 0.004
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information
 Score = 43.8 bits (104), Expect = 8e-07
 Identities = 15/47 (31%), Positives = 23/47 (48%)

Query: 1  MDYVLPLMETGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLH 47
           D  L  M+ GE+ ++ I     YG++G     IPP A L + + L 
Sbjct: 48 WDEGLLGMKVGEKRKLTIPPELAYGEEGLAGGVIPPNATLVFEVELL 94


Length = 94

>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 131
KOG0543|consensus397 100.0
KOG0545|consensus329 99.81
KOG0553|consensus 304 99.59
KOG0547|consensus 606 99.57
KOG0544|consensus108 99.46
KOG0548|consensus539 99.45
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.39
KOG4234|consensus271 99.38
KOG0549|consensus188 99.33
KOG0551|consensus 390 99.27
KOG4648|consensus 536 99.16
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.16
KOG0548|consensus 539 99.11
KOG0550|consensus 486 99.1
KOG4642|consensus 284 99.09
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.09
KOG0376|consensus 476 99.08
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.05
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.03
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.01
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.0
PRK15359144 type III secretion system chaperone protein SscB; 98.99
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 98.97
PRK15359144 type III secretion system chaperone protein SscB; 98.92
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.91
KOG0552|consensus226 98.89
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 98.83
PRK11189 296 lipoprotein NlpI; Provisional 98.82
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.73
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.72
PF1337173 TPR_9: Tetratricopeptide repeat 98.72
PF1342844 TPR_14: Tetratricopeptide repeat 98.71
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.68
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.68
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.63
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 98.59
KOG0553|consensus 304 98.47
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.46
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.41
KOG1308|consensus 377 98.4
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 98.36
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 98.33
PLN02789 320 farnesyltranstransferase 98.33
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.33
KOG0543|consensus397 98.33
PRK10370198 formate-dependent nitrite reductase complex subuni 98.3
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.29
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.29
PRK12370 553 invasion protein regulator; Provisional 98.28
PRK10370198 formate-dependent nitrite reductase complex subuni 98.28
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 98.28
KOG0550|consensus 486 98.25
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.24
TIGR02552135 LcrH_SycD type III secretion low calcium response 98.18
PRK11189 296 lipoprotein NlpI; Provisional 98.18
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.15
TIGR03302 235 OM_YfiO outer membrane assembly lipoprotein YfiO. 98.15
PLN02789 320 farnesyltranstransferase 98.14
KOG4234|consensus271 98.13
KOG0624|consensus 504 98.11
KOG4626|consensus 966 98.11
COG4785 297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.09
PRK15331165 chaperone protein SicA; Provisional 98.09
TIGR02521 234 type_IV_pilW type IV pilus biogenesis/stability pr 98.09
KOG4626|consensus 966 98.08
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.08
KOG1125|consensus579 98.07
KOG4555|consensus175 98.06
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 98.04
PRK12370 553 invasion protein regulator; Provisional 98.03
PF13512142 TPR_18: Tetratricopeptide repeat 98.0
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 97.98
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.95
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 97.95
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 97.95
KOG1310|consensus 758 97.95
PRK10866 243 outer membrane biogenesis protein BamD; Provisiona 97.92
KOG0547|consensus 606 97.91
PF1337173 TPR_9: Tetratricopeptide repeat 97.9
KOG1126|consensus638 97.89
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.89
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 97.88
PF13525 203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 97.87
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 97.87
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 97.85
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 97.84
PF1343134 TPR_17: Tetratricopeptide repeat 97.84
KOG1155|consensus 559 97.81
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.8
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 97.79
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.77
cd00189100 TPR Tetratricopeptide repeat domain; typically con 97.74
PF1343134 TPR_17: Tetratricopeptide repeat 97.73
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 97.7
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 97.66
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 97.65
PF06552 186 TOM20_plant: Plant specific mitochondrial import r 97.65
COG4783484 Putative Zn-dependent protease, contains TPR repea 97.63
KOG2076|consensus 895 97.63
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 97.62
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 97.59
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 97.54
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 97.54
KOG1128|consensus 777 97.54
KOG1155|consensus559 97.53
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 97.53
KOG0624|consensus 504 97.51
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 97.49
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 97.48
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.47
COG3063 250 PilF Tfp pilus assembly protein PilF [Cell motilit 97.47
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 97.46
PRK10803263 tol-pal system protein YbgF; Provisional 97.43
PRK11788 389 tetratricopeptide repeat protein; Provisional 97.42
KOG1125|consensus579 97.39
KOG1173|consensus611 97.39
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 97.37
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 97.35
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 97.34
KOG1173|consensus 611 97.33
PF03704146 BTAD: Bacterial transcriptional activator domain; 97.31
PRK11788 389 tetratricopeptide repeat protein; Provisional 97.26
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 97.2
PF09295 395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 97.19
PRK02603172 photosystem I assembly protein Ycf3; Provisional 97.14
KOG1126|consensus 638 97.11
KOG3364|consensus149 97.03
PF06552186 TOM20_plant: Plant specific mitochondrial import r 97.0
KOG0546|consensus372 96.99
PRK14720 906 transcript cleavage factor/unknown domain fusion p 96.98
KOG4162|consensus799 96.96
KOG4648|consensus 536 96.91
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 96.82
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 96.82
PRK15331165 chaperone protein SicA; Provisional 96.81
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 96.78
CHL00033168 ycf3 photosystem I assembly protein Ycf3 96.67
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 96.66
PRK11906458 transcriptional regulator; Provisional 96.63
KOG1840|consensus 508 96.61
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 96.6
PF12688120 TPR_5: Tetratrico peptide repeat 96.56
KOG0376|consensus 476 96.53
COG4235287 Cytochrome c biogenesis factor [Posttranslational 96.45
PRK14574 822 hmsH outer membrane protein; Provisional 96.41
KOG0545|consensus329 96.34
KOG3785|consensus 557 96.33
PRK10153517 DNA-binding transcriptional activator CadC; Provis 96.33
COG4105 254 ComL DNA uptake lipoprotein [General function pred 96.32
KOG2002|consensus 1018 96.29
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 96.27
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.25
PRK11906 458 transcriptional regulator; Provisional 96.21
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 96.21
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 96.15
PRK10803263 tol-pal system protein YbgF; Provisional 96.12
KOG2002|consensus 1018 96.08
KOG0551|consensus 390 96.06
COG4235287 Cytochrome c biogenesis factor [Posttranslational 95.96
KOG3060|consensus289 95.94
KOG2076|consensus 895 95.94
KOG1129|consensus 478 95.88
COG4783484 Putative Zn-dependent protease, contains TPR repea 95.8
PF1286294 Apc5: Anaphase-promoting complex subunit 5 95.76
KOG1128|consensus 777 95.73
KOG1174|consensus564 95.72
KOG1840|consensus508 95.49
KOG3060|consensus289 95.48
KOG4814|consensus 872 95.41
PRK10941269 hypothetical protein; Provisional 95.41
KOG2003|consensus 840 95.34
KOG1129|consensus478 95.32
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 95.32
PRK10737196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 95.27
KOG1127|consensus 1238 95.13
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 95.11
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 95.1
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 95.08
PRK10747398 putative protoheme IX biogenesis protein; Provisio 95.07
PRK10747 398 putative protoheme IX biogenesis protein; Provisio 95.04
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 95.03
KOG3081|consensus299 94.98
KOG4555|consensus175 94.97
PRK10153517 DNA-binding transcriptional activator CadC; Provis 94.84
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 94.84
KOG0549|consensus188 94.78
COG5010 257 TadD Flp pilus assembly protein TadD, contains TPR 94.71
KOG1156|consensus 700 94.5
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 94.4
KOG4151|consensus 748 94.35
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 94.28
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 94.26
KOG2796|consensus366 94.25
KOG1156|consensus 700 94.22
PF12688120 TPR_5: Tetratrico peptide repeat 94.09
KOG2471|consensus 696 94.06
PF10255 404 Paf67: RNA polymerase I-associated factor PAF67; I 93.95
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 93.87
PRK14574 822 hmsH outer membrane protein; Provisional 93.79
COG3947361 Response regulator containing CheY-like receiver a 93.51
KOG4340|consensus 459 93.51
KOG4162|consensus799 93.49
KOG2003|consensus 840 93.38
PF13525 203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 93.36
PRK10941269 hypothetical protein; Provisional 93.15
PF10300 468 DUF3808: Protein of unknown function (DUF3808); In 93.15
COG4785 297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 93.01
KOG3824|consensus 472 92.81
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 92.37
KOG1586|consensus288 92.36
PF03704146 BTAD: Bacterial transcriptional activator domain; 92.1
COG1729262 Uncharacterized protein conserved in bacteria [Fun 92.04
KOG1127|consensus 1238 91.93
COG1729262 Uncharacterized protein conserved in bacteria [Fun 91.79
TIGR00115408 tig trigger factor. Trigger factor is a ribosome-a 91.66
COG0457291 NrfG FOG: TPR repeat [General function prediction 91.55
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 91.34
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 91.31
KOG3785|consensus 557 91.01
PRK14720 906 transcript cleavage factor/unknown domain fusion p 90.65
PRK10866 243 outer membrane biogenesis protein BamD; Provisiona 90.18
COG4976 287 Predicted methyltransferase (contains TPR repeat) 90.05
KOG4642|consensus 284 89.86
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 89.44
KOG4340|consensus 459 89.42
COG2912269 Uncharacterized conserved protein [Function unknow 89.34
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 88.85
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 88.72
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 88.33
PF09986214 DUF2225: Uncharacterized protein conserved in bact 87.69
PF00244236 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14 87.3
PRK01490 435 tig trigger factor; Provisional 87.03
KOG2796|consensus366 86.96
KOG1130|consensus 639 86.3
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 86.3
KOG3824|consensus 472 86.09
PF13512142 TPR_18: Tetratricopeptide repeat 85.37
KOG1130|consensus 639 85.09
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 84.69
PF1285434 PPR_1: PPR repeat 84.5
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 84.46
KOG1174|consensus 564 84.29
COG3629280 DnrI DNA-binding transcriptional activator of the 84.03
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 83.9
COG0457 291 NrfG FOG: TPR repeat [General function prediction 83.5
PF0123931 PPTA: Protein prenyltransferase alpha subunit repe 83.21
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 82.41
KOG2376|consensus 652 81.89
PF0421269 MIT: MIT (microtubule interacting and transport) d 81.84
cd0267979 MIT_spastin MIT: domain contained within Microtubu 81.52
KOG2610|consensus 491 81.4
KOG2376|consensus 652 80.6
KOG1308|consensus 377 80.37
>KOG0543|consensus Back     alignment and domain information
Probab=100.00  E-value=2.7e-36  Score=220.91  Aligned_cols=130  Identities=31%  Similarity=0.462  Sum_probs=117.5

Q ss_pred             CcchhcccCCCcEEEEEEcCCCCCCCCCCCCCCCCCCceEEEEEeecccc-CCccCcCcchhhhHHHH------------
Q psy18096          1 MDYVLPLMETGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSVL-PDFDLAELPVEKRLDFG------------   67 (131)
Q Consensus         1 ld~~l~~M~~gE~~~v~i~~~~ayG~~G~~~~~ip~~~~~~~~v~l~~~~-~~~~~~~~~~~e~~~~~------------   67 (131)
                      ||.||++|++||++.|+|+|+|+||+.|..++.|||++++.|+|+|++|. +....|.+...+++..+            
T Consensus       141 le~al~~M~~GE~a~v~i~~~YayG~~~~~~p~IPPnA~l~yEVeL~~f~~~~~~s~~~~~~e~l~~A~~~ke~Gn~~fK  220 (397)
T KOG0543|consen  141 LEIALRMMKVGEVALVTIDPKYAYGEEGGEPPLIPPNATLLYEVELLDFELKEDESWKMFAEERLEAADRKKERGNVLFK  220 (397)
T ss_pred             HHHHHHhcCccceEEEEeCcccccCCCCCCCCCCCCCceEEEEEEEEeeecCcccccccchHHHHHHHHHHHHhhhHHHh
Confidence            58899999999999999999999997777789999999999999999999 77789999888777655            


Q ss_pred             ----------HHHHHHHHHH----------HhhhhhHHHHHHHHHHHHHhCChHHHHHHHHHHHhhCCCCHHHHHHHHHh
Q psy18096         68 ----------GILASQELLD----------SLIKERINCYNNLAQAQIKLGSLEPALMSLENVLNLDPNNIKALQRKAKC  127 (131)
Q Consensus        68 ----------y~~Ai~~~~~----------~~~~~~~~~~~N~a~~~~kl~~~~~a~~~~~~al~~dp~~~ka~~rrg~a  127 (131)
                                |++|+++++.          ........+++|+|+||+|+++|.+|+..|++||++||+|+|||||||+|
T Consensus       221 ~gk~~~A~~~Yerav~~l~~~~~~~~ee~~~~~~~k~~~~lNlA~c~lKl~~~~~Ai~~c~kvLe~~~~N~KALyRrG~A  300 (397)
T KOG0543|consen  221 EGKFKLAKKRYERAVSFLEYRRSFDEEEQKKAEALKLACHLNLAACYLKLKEYKEAIESCNKVLELDPNNVKALYRRGQA  300 (397)
T ss_pred             hchHHHHHHHHHHHHHHhhccccCCHHHHHHHHHHHHHHhhHHHHHHHhhhhHHHHHHHHHHHHhcCCCchhHHHHHHHH
Confidence                      6666666664          45677889999999999999999999999999999999999999999999


Q ss_pred             hhc
Q psy18096        128 LIL  130 (131)
Q Consensus       128 ~~~  130 (131)
                      ++.
T Consensus       301 ~l~  303 (397)
T KOG0543|consen  301 LLA  303 (397)
T ss_pred             HHh
Confidence            975



>KOG0545|consensus Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>KOG0544|consensus Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>KOG0549|consensus Back     alignment and domain information
>KOG0551|consensus Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0552|consensus Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1308|consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>KOG3364|consensus Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>KOG0546|consensus Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>KOG0551|consensus Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>KOG4814|consensus Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG0549|consensus Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG4151|consensus Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG2471|consensus Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG3824|consensus Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>PF00244 14-3-3: 14-3-3 protein; InterPro: IPR023410 The 14-3-3 proteins are a large family of approximately 30kDa acidic proteins which exist primarily as homo- and heterodimeric within all eukaryotic cells [, ] Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG3824|consensus Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PF01239 PPTA: Protein prenyltransferase alpha subunit repeat; InterPro: IPR002088 Protein prenylation is the posttranslational attachment of either a farnesyl group or a geranylgeranyl group via a thioether linkage (-C-S-C-) to a cysteine at or near the carboxyl terminus of the protein Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>cd02679 MIT_spastin MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>KOG1308|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
1kt1_A457 Structure Of The Large Fkbp-Like Protein, Fkbp51, I 3e-06
1kt0_A457 Structure Of The Large Fkbp-like Protein, Fkbp51, I 8e-06
1qz2_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Compl 4e-05
1pbk_A116 Homologous Domain Of Human Fkbp25 Length = 116 7e-05
1p5q_A336 Crystal Structure Of Fkbp52 C-Terminal Domain Lengt 2e-04
3kz7_A119 C-Terminal Domain Of Murine Fkbp25 Rapamycin Comple 3e-04
3o5d_A264 Crystal Structure Of A Fragment Of Fkbp51 Comprisin 8e-04
>pdb|1KT1|A Chain A, Structure Of The Large Fkbp-Like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure

Iteration: 1

Score = 47.0 bits (110), Expect = 3e-06, Method: Composition-based stats. Identities = 38/162 (23%), Positives = 69/162 (42%), Gaps = 32/162 (19%) Query: 1 MDYVLPLMETGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSVLPDFDLAELPV 60 +D L M+ E+C + + R+G+G+ G+P I P A+L Y +TL S + E+ Sbjct: 202 IDKALEKMQREEQCILHLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDT 261 Query: 61 EKRLD------------------------FGGILASQELLDSLIKER--------INCYN 88 +++L+ +G I++ E+ L ++ + + Sbjct: 262 KEKLEQAAIVKEKGTVYFKGGKYVQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFL 321 Query: 89 NLAQAQIKLGSLEPALMSLENVLNLDPNNIKALQRKAKCLIL 130 NLA +KL A+ + L LD N K L R+ + +L Sbjct: 322 NLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQLL 363
>pdb|1KT0|A Chain A, Structure Of The Large Fkbp-like Protein, Fkbp51, Involved In Steroid Receptor Complexes Length = 457 Back     alignment and structure
>pdb|1QZ2|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Complex With The C-Terminal Peptide Meevd Of Hsp90 Length = 336 Back     alignment and structure
>pdb|1PBK|A Chain A, Homologous Domain Of Human Fkbp25 Length = 116 Back     alignment and structure
>pdb|1P5Q|A Chain A, Crystal Structure Of Fkbp52 C-Terminal Domain Length = 336 Back     alignment and structure
>pdb|3KZ7|A Chain A, C-Terminal Domain Of Murine Fkbp25 Rapamycin Complex Length = 119 Back     alignment and structure
>pdb|3O5D|A Chain A, Crystal Structure Of A Fragment Of Fkbp51 Comprising The Fk1 And Fk2 Domains Length = 264 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 2e-23
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 4e-07
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 7e-23
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 4e-18
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 7e-12
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 7e-11
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 1e-10
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 7e-10
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 6e-09
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 7e-09
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 8e-09
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 1e-08
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 8e-06
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 2e-07
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 3e-07
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 5e-07
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-07
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-06
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-04
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 6e-07
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 4e-06
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 5e-05
3q49_B137 STIP1 homology and U box-containing protein 1; E3 6e-07
3q49_B137 STIP1 homology and U box-containing protein 1; E3 4e-04
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 1e-06
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 2e-04
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 2e-06
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-06
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 3e-06
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-04
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 5e-04
2l6j_A111 TPR repeat-containing protein associated with HSP; 2e-06
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 2e-06
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 8e-04
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 4e-06
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 4e-06
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 3e-04
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 5e-06
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 7e-06
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 2e-05
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 2e-05
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 3e-05
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 3e-05
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 3e-05
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 3e-05
2ppn_A107 FK506-binding protein 1A; high resolution protein 3e-05
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 4e-05
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 9e-05
2gw1_A 514 Mitochondrial precursor proteins import receptor; 1e-04
2gw1_A 514 Mitochondrial precursor proteins import receptor; 6e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 2e-04
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 2e-04
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 7e-04
3u4t_A272 TPR repeat-containing protein; structural genomics 3e-04
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 4e-04
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 5e-04
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 5e-04
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 7e-04
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 7e-04
3k9i_A117 BH0479 protein; putative protein binding protein, 8e-04
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-04
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 8e-04
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 8e-04
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
 Score = 92.8 bits (230), Expect = 2e-23
 Identities = 34/161 (21%), Positives = 60/161 (37%), Gaps = 32/161 (19%)

Query: 1   MDYVLPLMETGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSVLPDFDLAELPV 60
           +D  L  M+  E+C + +  R+G+G+ G+P   I P A+L Y +TL S     +  E+  
Sbjct: 202 IDKALEKMQREEQCILYLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSFEKAKESWEMDT 261

Query: 61  E-----------------KRLDFGG---------------ILASQELLDSLIKERINCYN 88
           +                 K   +                    S++   +     +  + 
Sbjct: 262 KEKLEQAAIVKEKGTVYFKGGKYMQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFL 321

Query: 89  NLAQAQIKLGSLEPALMSLENVLNLDPNNIKALQRKAKCLI 129
           NLA   +KL     A+   +  L LD  N K L R+ +  +
Sbjct: 322 NLAMCYLKLREYTKAVECCDKALGLDSANEKGLYRRGEAQL 362


>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Length = 370 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Length = 102 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Length = 121 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Length = 208 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Length = 226 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Length = 117 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Length = 100 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Length = 125 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.91
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.89
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.89
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.63
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.49
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.48
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.45
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.38
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.36
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.34
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.33
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.3
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.23
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 99.22
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.22
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.2
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.19
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 99.17
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.14
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.14
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.14
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 99.14
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.14
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.11
1jvw_A167 Macrophage infectivity potentiator; chagas disease 99.11
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 99.1
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.1
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 99.09
2ppn_A107 FK506-binding protein 1A; high resolution protein 99.08
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 99.08
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 99.08
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 99.08
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.07
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.07
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.06
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 99.06
3k9i_A117 BH0479 protein; putative protein binding protein, 99.05
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.05
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.04
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 99.04
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 99.04
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.03
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 99.03
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 99.02
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.02
3urz_A 208 Uncharacterized protein; tetratricopeptide repeats 99.01
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 98.96
1fd9_A213 Protein (macrophage infectivity potentiator prote; 98.96
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 98.94
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.93
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.92
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.91
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 98.91
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.9
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 98.89
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.87
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 98.86
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 98.86
4i17_A 228 Hypothetical protein; TPR repeats protein, structu 98.86
2pl2_A 217 Hypothetical conserved protein TTC0263; TPR, prote 98.85
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.84
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.83
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.83
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.83
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.82
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.81
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.8
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.8
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.79
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 98.79
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 98.79
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 98.77
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 98.77
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 98.75
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 98.75
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.75
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 98.74
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.73
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.73
4i17_A228 Hypothetical protein; TPR repeats protein, structu 98.71
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.7
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.7
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 98.7
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 98.69
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 98.69
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 98.68
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 98.68
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.68
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 98.68
1hh8_A 213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 98.68
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 98.68
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.68
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.67
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 98.65
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.64
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 98.63
2yhc_A 225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.63
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.61
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.61
2gw1_A 514 Mitochondrial precursor proteins import receptor; 98.61
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.58
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.58
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.58
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 98.58
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 98.58
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 98.57
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 98.57
3k9i_A117 BH0479 protein; putative protein binding protein, 98.57
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.56
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.55
3qky_A 261 Outer membrane assembly lipoprotein YFIO; membrane 98.55
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.54
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.54
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 98.53
4eqf_A365 PEX5-related protein; accessory protein, tetratric 98.53
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.5
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.49
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 98.49
3u4t_A 272 TPR repeat-containing protein; structural genomics 98.48
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 98.47
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 98.46
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 98.46
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 98.45
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 98.45
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 98.44
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 98.44
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 98.44
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.43
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 98.43
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 98.42
2q7f_A 243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 98.41
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.41
2vq2_A 225 PILW, putative fimbrial biogenesis and twitching m 98.4
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 98.4
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 98.38
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 98.38
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 98.38
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.37
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.37
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.35
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 98.35
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 98.35
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 98.33
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 98.32
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 98.3
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.29
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 98.28
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 98.27
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 98.26
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.26
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 98.25
3u3w_A293 Transcriptional activator PLCR protein; ternary co 98.25
3u4t_A 272 TPR repeat-containing protein; structural genomics 98.24
3q49_B137 STIP1 homology and U box-containing protein 1; E3 98.24
2ho1_A 252 Type 4 fimbrial biogenesis protein PILF; type IV p 98.23
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.23
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.23
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.23
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 98.2
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.2
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 98.2
4g1t_A 472 Interferon-induced protein with tetratricopeptide 98.18
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.18
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 98.18
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 98.14
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.13
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 98.12
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 98.11
3dra_A 306 Protein farnesyltransferase/geranylgeranyltransfer 98.08
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 98.08
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 98.03
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 98.02
3dra_A 306 Protein farnesyltransferase/geranylgeranyltransfer 98.02
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 98.01
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 98.0
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.98
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 97.97
4g1t_A 472 Interferon-induced protein with tetratricopeptide 97.97
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 97.97
1qqe_A 292 Vesicular transport protein SEC17; helix-turn-heli 97.95
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 97.95
3edt_B 283 KLC 2, kinesin light chain 2; superhelical, struct 97.95
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 97.95
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.92
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 97.87
2gw1_A514 Mitochondrial precursor proteins import receptor; 97.87
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 97.87
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 97.87
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 97.85
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.79
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 97.78
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 97.75
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 97.73
2ond_A 308 Cleavage stimulation factor 77 kDa subunit; HAT do 97.72
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.71
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.69
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 97.68
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 97.67
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.64
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 97.63
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 97.63
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.62
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.62
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 97.62
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.6
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.6
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 97.56
3u3w_A293 Transcriptional activator PLCR protein; ternary co 97.55
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 97.53
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.52
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 97.51
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 97.47
1klx_A138 Cysteine rich protein B; structural genomics, heli 97.46
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 97.44
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.38
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 97.38
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 97.29
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 97.24
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.23
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.22
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 97.22
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 97.21
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 97.21
3gw4_A 203 Uncharacterized protein; structural genomics, PSI- 97.14
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 97.11
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.09
3prb_A231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 97.09
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.08
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 97.04
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 97.03
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 97.02
2ooe_A 530 Cleavage stimulation factor 77 kDa subunit; HAT do 96.97
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 96.92
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 96.82
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.81
1klx_A138 Cysteine rich protein B; structural genomics, heli 96.8
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 96.77
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 96.75
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 96.66
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 96.64
1w26_A 432 Trigger factor, TF; chaperone, protein folding, ri 96.49
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 96.32
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 96.29
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 96.12
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 96.03
1pc2_A152 Mitochondria fission protein; unknown function; NM 96.0
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 95.87
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 95.73
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 95.42
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 95.27
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 95.03
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 94.82
3mv2_B 310 Coatomer subunit epsilon; vesicular membrane coat 94.77
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 94.52
1t11_A392 Trigger factor, TF; helix-turn-helix, four-helix-b 93.95
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 93.32
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 92.81
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 91.2
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 90.3
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 89.55
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 87.86
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 87.44
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 85.21
2br9_A234 14-3-3E, 14-3-3 protein epsilon; cell regulator pr 81.59
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 81.17
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
Probab=99.91  E-value=1.6e-23  Score=153.10  Aligned_cols=130  Identities=24%  Similarity=0.309  Sum_probs=111.6

Q ss_pred             CcchhcccCCCcEEEEEEcCCCCCCCCCCC-CCCCCCCceEEEEEeeccccCCc---cCcCcchhhhHHHH---------
Q psy18096          1 MDYVLPLMETGEECQIEITARFGYGDKGEP-SKSIPPGAKLYYSLTLHSVLPDF---DLAELPVEKRLDFG---------   67 (131)
Q Consensus         1 ld~~l~~M~~gE~~~v~i~~~~ayG~~G~~-~~~ip~~~~~~~~v~l~~~~~~~---~~~~~~~~e~~~~~---------   67 (131)
                      +|.+|.+|++||++.|+|+|.++||..|.+ .+.||+++++.|.++|.++....   ..|.+...++...+         
T Consensus       109 ~e~~l~~m~~Ge~~~~~i~~~~~yg~~~~~~~~~ip~~~~l~f~v~L~~~~~~~e~~~~~~~~~~~~~~~a~~~~~~g~~  188 (338)
T 2if4_A          109 LAIGVASMKSGERALVHVGWELAYGKEGNFSFPNVPPMADLLYEVEVIGFDETKEGKARSDMTVEERIGAADRRKMDGNS  188 (338)
T ss_dssp             HHHHHHHCCBTCEEEEEECGGGSSCSSCCCSSSCCCTTCCEEEEEEEEEEECCCCCBTTTBCCHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHhcCCCCCeEEEEECHHHhcCCCCCCCCCCCCCCCcEEEEEEEEEecCCccccccccCCHHHHHHHHHHHHHHHHH
Confidence            367999999999999999999999999963 26799999999999999987654   36777776665543         


Q ss_pred             ------HHHHHHHHHH--HhhhhhH-----------------HHHHHHHHHHHHhCChHHHHHHHHHHHhhCCCCHHHHH
Q psy18096         68 ------GILASQELLD--SLIKERI-----------------NCYNNLAQAQIKLGSLEPALMSLENVLNLDPNNIKALQ  122 (131)
Q Consensus        68 ------y~~Ai~~~~~--~~~~~~~-----------------~~~~N~a~~~~kl~~~~~a~~~~~~al~~dp~~~ka~~  122 (131)
                            |.+|+..|.+  .+.+...                 .+|+|+|.||+++++|++|+.+|+++|+++|++.++||
T Consensus       189 ~~~~g~~~~A~~~y~~Al~~~p~~~~~~~~~~~~~~~~~l~~~~~~nla~~~~~~g~~~~A~~~~~~al~~~p~~~~a~~  268 (338)
T 2if4_A          189 LFKEEKLEEAMQQYEMAIAYMGDDFMFQLYGKYQDMALAVKNPCHLNIAACLIKLKRYDEAIGHCNIVLTEEEKNPKALF  268 (338)
T ss_dssp             TCSSSCCHHHHHHHHHHHHHSCHHHHHTCCHHHHHHHHHHHTHHHHHHHHHHHTTTCCHHHHHHHHHHHHHCTTCHHHHH
T ss_pred             HHhcCCHHHHHHHHHHHHHHhccchhhhhcccHHHHHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHH
Confidence                  8889988888  4444443                 48999999999999999999999999999999999999


Q ss_pred             HHHHhhhc
Q psy18096        123 RKAKCLIL  130 (131)
Q Consensus       123 rrg~a~~~  130 (131)
                      ++|.+|..
T Consensus       269 ~lg~a~~~  276 (338)
T 2if4_A          269 RRGKAKAE  276 (338)
T ss_dssp             HHHHHHHT
T ss_pred             HHHHHHHH
Confidence            99999874



>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>2br9_A 14-3-3E, 14-3-3 protein epsilon; cell regulator protein, 14-3-3, phosphoserine, structural GE consortium, SGC, ywhae; HET: SEP; 1.75A {Homo sapiens} PDB: 3ual_A* 2o98_A* 3m50_A* 3m51_A* 3axy_C* Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 131
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 3e-06
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 3e-06
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 5e-06
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 4e-05
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 5e-05
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 3e-04
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-04
d1q6ha_210 d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase 5e-05
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 1e-04
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 2e-04
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 6e-04
d1jvwa_160 d.26.1.1 (A:) Macrophage infectivity potentiator p 7e-04
d2pqrb1124 a.118.8.1 (B:5-128) Mitochondria fission protein F 0.001
d2ppna1107 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12) 0.001
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 0.002
d1nzna_122 a.118.8.1 (A:) Mitochondria fission protein Fis1 { 0.002
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKBP51, N-terminal domains
species: Monkey (Saimiri boliviensis) [TaxId: 27679]
 Score = 41.2 bits (96), Expect = 3e-06
 Identities = 18/49 (36%), Positives = 29/49 (59%)

Query: 1   MDYVLPLMETGEECQIEITARFGYGDKGEPSKSIPPGAKLYYSLTLHSV 49
           +D  L  M+  E+C + +  R+G+G+ G+P   I P A+L Y +TL S 
Sbjct: 64  IDKALEKMQREEQCILHLGPRYGFGEAGKPKFGIEPNAELIYEVTLKSF 112


>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Length = 210 Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Length = 160 Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 124 Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.68
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.68
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.62
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.54
d2c2la1 201 STIP1 homology and U box-containing protein 1, STU 99.53
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.49
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.46
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.42
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.4
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.36
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.34
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.34
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.32
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.31
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.29
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.29
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.29
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.29
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.26
d1hh8a_ 192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.23
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.22
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.18
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.13
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.12
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.06
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.03
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.01
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.01
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 98.99
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 98.98
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.97
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 98.97
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 98.88
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 98.86
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 98.86
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.85
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 98.85
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.84
d1fcha_ 323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.83
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 98.83
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 98.82
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.65
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 98.63
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.59
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.58
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.55
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 98.41
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 98.35
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 98.27
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 98.14
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.09
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 98.05
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 97.93
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 97.84
d1qqea_ 290 Vesicular transport protein sec17 {Baker's yeast ( 97.67
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 97.59
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 97.46
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 97.31
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 97.24
d1hz4a_366 Transcription factor MalT domain III {Escherichia 96.89
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 96.84
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 96.54
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.01
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 95.86
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 95.35
d2onda1 308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 93.08
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 92.28
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 92.24
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 92.07
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 90.85
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 89.98
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 82.78
d2o02a1230 zeta isoform {Cow (Bos taurus) [TaxId: 9913]} 81.49
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: FKBP51, C-terminal domain
species: Monkey (Saimiri boliviensis) [TaxId: 27679]
Probab=99.68  E-value=1.5e-16  Score=104.07  Aligned_cols=78  Identities=22%  Similarity=0.238  Sum_probs=67.8

Q ss_pred             ccCcCcchhhhHHHH---------------HHHHHHHHHH-----------------HhhhhhHHHHHHHHHHHHHhCCh
Q psy18096         53 FDLAELPVEKRLDFG---------------GILASQELLD-----------------SLIKERINCYNNLAQAQIKLGSL  100 (131)
Q Consensus        53 ~~~~~~~~~e~~~~~---------------y~~Ai~~~~~-----------------~~~~~~~~~~~N~a~~~~kl~~~  100 (131)
                      ++.|.|+..|+++.+               |.+|++.|++                 ...+....+|+|+|.||.++|+|
T Consensus         1 ~e~~~m~~~E~~~~a~~~~e~G~~~~~~~~~~~A~~~Y~~al~~~~~~~~~~~~~~~~~~~~~~~~~~Nla~~~~~l~~~   80 (168)
T d1kt1a1           1 KESWEMDTKEKLEQAAIVKEKGTVYFKGGKYVQAVIQYGKIVSWLEMEYGLSEKESKASESFLLAAFLNLAMCYLKLREY   80 (168)
T ss_dssp             CCGGGSCHHHHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHTTCCSCCHHHHHHHHHHHHHHHHHHHHHHHHTTCH
T ss_pred             CCcccCCHHHHHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHHhhccchhhhhhcchhHHHHHHhHHHHHHHhhhc
Confidence            367999998887654               7778777766                 34566788999999999999999


Q ss_pred             HHHHHHHHHHHhhCCCCHHHHHHHHHhhhc
Q psy18096        101 EPALMSLENVLNLDPNNIKALQRKAKCLIL  130 (131)
Q Consensus       101 ~~a~~~~~~al~~dp~~~ka~~rrg~a~~~  130 (131)
                      ++|+.+|+++|.+||+|+++||++|.++..
T Consensus        81 ~~Ai~~~~~al~l~p~~~~a~~~~~~~~~~  110 (168)
T d1kt1a1          81 TKAVECCDKALGLDSANEKGLYRRGEAQLL  110 (168)
T ss_dssp             HHHHHHHHHHHHHCTTCHHHHHHHHHHHHH
T ss_pred             ccchhhhhhhhhcccchHHHHHHHHHHHHH
Confidence            999999999999999999999999999864



>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2o02a1 a.118.7.1 (A:1-230) zeta isoform {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure