Psyllid ID: psy18101

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120------
MFHPFEIVDKADVEENPVIPDKPEEEVEDEWVDILGSGHIKKKITKHGEPDTRPQRGDLCVISGFGKLEDDTLVETFDNLEICVGDLELVHGMDYVLPLMEMGEECQIEITARFGYGDKGEPIFKT
ccccccccccccccccccccccccccccccEEEEcccccEEEEEEEccccccccccccEEEEEEEEEEccccEEEccccEEEEEccccccccHHHHHcccccccEEEEEEcccccccccccccccc
cccccccccHcccccccccccccHHcccHHHHHHcccccEEEEEEEccccccccccccEEEEEEEEEEccccEEcccccEEEEEccccHHHHHHHHHHHHccccEEEEEEccHccccccccccccc
mfhpfeivdkadveenpvipdkpeeevEDEWVDILgsghikkkitkhgepdtrpqrgdlcvisgfgkleddtlvetfdnleicvgdlelvhgmdyVLPLMEMGEECQIEITArfgygdkgepifkt
mfhpfeivdkadveenpvipdkpeeevedEWVDILGSGHIKKKitkhgepdtrpqrgDLCVISGFGKLEDDTLVETFDNLEICVGDLELVHGMDYVLPLMEMGEECQIEITArfgygdkgepifkt
MFHPFEIVDKADVEENPVIPDKPEEEVEDEWVDILGSGHIKKKITKHGEPDTRPQRGDLCVISGFGKLEDDTLVETFDNLEICVGDLELVHGMDYVLPLMEMGEECQIEITARFGYGDKGEPIFKT
*****************************EWVDILGSGHI****************GDLCVISGFGKLEDDTLVETFDNLEICVGDLELVHGMDYVLPLMEMGEECQIEITARFGYG*********
**********************************LGSGHIKKKITKHGEPDTRPQRGDLCVISGFGKLEDDTLVETFDNLEICVGDLELVHGMDYVLPLMEMGEECQIEITARFGYGDKGEP****
MFHPFEIVDKADVEENPVIPDKPEEEVEDEWVDILGSGHIKKKITKHGEPDTRPQRGDLCVISGFGKLEDDTLVETFDNLEICVGDLELVHGMDYVLPLMEMGEECQIEITARFGYGDKGEPIFKT
****************PVIPDKP*EEVEDEWVDILGSGHIKKKITKHGEPDTRPQRGDLCVISGFGKLEDDTLVETFDNLEICVGDLELVHGMDYVLPLMEMGEECQIEITARFGYGDKGE*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFHPFEIVDKADVEENPVIPDKPEEEVEDEWVDILGSGHIKKKITKHGEPDTRPQRGDLCVISGFGKLEDDTLVETFDNLEICVGDLELVHGMDYVLPLMEMGEECQIEITARFGYGDKGEPIFKT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query126 2.2.26 [Sep-21-2011]
Q14318 412 Peptidyl-prolyl cis-trans yes N/A 0.714 0.218 0.318 4e-09
Q3B7U9 403 Peptidyl-prolyl cis-trans yes N/A 0.714 0.223 0.307 5e-08
O35465 402 Peptidyl-prolyl cis-trans yes N/A 0.714 0.223 0.296 2e-07
P26884224 Peptidyl-prolyl cis-trans no N/A 0.801 0.450 0.309 2e-05
Q00688224 Peptidyl-prolyl cis-trans no N/A 0.801 0.450 0.300 2e-05
Q38931 551 Peptidyl-prolyl cis-trans yes N/A 0.714 0.163 0.308 4e-05
O46638224 Peptidyl-prolyl cis-trans yes N/A 0.801 0.450 0.309 5e-05
Q9FJL3 578 Peptidyl-prolyl cis-trans no N/A 0.658 0.143 0.288 5e-05
Q43207 559 70 kDa peptidyl-prolyl is N/A N/A 0.674 0.152 0.3 5e-05
Q62446224 Peptidyl-prolyl cis-trans no N/A 0.801 0.450 0.309 6e-05
>sp|Q14318|FKBP8_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP8 OS=Homo sapiens GN=FKBP8 PE=1 SV=2 Back     alignment and function desciption
 Score = 60.1 bits (144), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 29/91 (31%), Positives = 52/91 (57%), Gaps = 1/91 (1%)

Query: 31  WVDILGSGHIKKKITKHGEP-DTRPQRGDLCVISGFGKLEDDTLVETFDNLEICVGDLEL 89
           W+DILG+G ++KK    G P  +RP +G +  +     LE+ T V+    L   +GD ++
Sbjct: 93  WLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDV 152

Query: 90  VHGMDYVLPLMEMGEECQIEITARFGYGDKG 120
           +  +D  +PLM++GE   +   +++ YG +G
Sbjct: 153 IQALDLSVPLMDVGETAMVTADSKYCYGPQG 183
Constitutively inactive PPiase, which becomes active when bound to calmodulin and calcium. Seems to act as a chaperone for BCL2, targets it to the mitochondria and modulates its phosphorylation state. The BCL2/FKBP8/calmodulin/calcium complex probably interferes with the binding of BCL2 to its targets. The active form of FKBP8 may therefore play a role in the regulation of apoptosis.
Homo sapiens (taxid: 9606)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q3B7U9|FKBP8_RAT Peptidyl-prolyl cis-trans isomerase FKBP8 OS=Rattus norvegicus GN=Fkbp8 PE=2 SV=1 Back     alignment and function description
>sp|O35465|FKBP8_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP8 OS=Mus musculus GN=Fkbp8 PE=1 SV=2 Back     alignment and function description
>sp|P26884|FKBP3_BOVIN Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Bos taurus GN=FKBP3 PE=1 SV=2 Back     alignment and function description
>sp|Q00688|FKBP3_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens GN=FKBP3 PE=1 SV=1 Back     alignment and function description
>sp|Q38931|FKB62_ARATH Peptidyl-prolyl cis-trans isomerase FKBP62 OS=Arabidopsis thaliana GN=FKBP62 PE=1 SV=2 Back     alignment and function description
>sp|O46638|FKBP3_RABIT Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Oryctolagus cuniculus GN=FKBP3 PE=2 SV=2 Back     alignment and function description
>sp|Q9FJL3|FKB65_ARATH Peptidyl-prolyl cis-trans isomerase FKBP65 OS=Arabidopsis thaliana GN=FKBP65 PE=1 SV=1 Back     alignment and function description
>sp|Q43207|FKB70_WHEAT 70 kDa peptidyl-prolyl isomerase OS=Triticum aestivum GN=FKBP70 PE=1 SV=1 Back     alignment and function description
>sp|Q62446|FKBP3_MOUSE Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Mus musculus GN=Fkbp3 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query126
66547995 382 PREDICTED: peptidyl-prolyl cis-trans iso 0.865 0.285 0.441 3e-21
242009345 385 fk506 binding protein, putative [Pedicul 0.761 0.249 0.5 5e-21
322790610 355 hypothetical protein SINV_13234 [Solenop 0.809 0.287 0.466 3e-20
350404336 382 PREDICTED: peptidyl-prolyl cis-trans iso 0.873 0.287 0.438 4e-20
380016753 382 PREDICTED: peptidyl-prolyl cis-trans iso 0.865 0.285 0.433 4e-20
340716647 383 PREDICTED: LOW QUALITY PROTEIN: peptidyl 0.873 0.287 0.429 5e-20
345494458 383 PREDICTED: peptidyl-prolyl cis-trans iso 0.849 0.279 0.384 9e-19
383849390 384 PREDICTED: peptidyl-prolyl cis-trans iso 0.849 0.278 0.383 8e-18
357614088 404 hypothetical protein KGM_11437 [Danaus p 0.920 0.287 0.434 9e-18
193718465 394 PREDICTED: peptidyl-prolyl cis-trans iso 0.865 0.276 0.442 1e-17
>gi|66547995|ref|XP_623097.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP8-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
 Score =  106 bits (265), Expect = 3e-21,   Method: Composition-based stats.
 Identities = 53/120 (44%), Positives = 80/120 (66%), Gaps = 11/120 (9%)

Query: 4   PFEIVDKADVEENPVIPDKPEEEVEDEWVDILGSGHIKKKITKHGEPDTRPQRGDLCVIS 63
           P E + KA + E+P     PEE     W+DILG+G +KKK+ K+G+  TRP R D+C + 
Sbjct: 36  PNEPMTKATLNEHP-----PEE-----WIDILGNGQLKKKVIKNGKNGTRPNRSDICTLK 85

Query: 64  GFGKLEDDTLVETFDNLEICVGDLELVHGMDYVLPLMEMGEECQIEITARFGYGDKG-EP 122
             GKL+D+T+VE +++L+I +GD+EL+ G+D  + LM++ E  +IE+  RF YG  G EP
Sbjct: 86  IIGKLKDNTIVEKYEDLKIQLGDVELIQGLDLAIALMDVNEIAEIEVDPRFAYGSLGKEP 145

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|242009345|ref|XP_002425448.1| fk506 binding protein, putative [Pediculus humanus corporis] gi|212509284|gb|EEB12710.1| fk506 binding protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|322790610|gb|EFZ15418.1| hypothetical protein SINV_13234 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|350404336|ref|XP_003487073.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP8-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|380016753|ref|XP_003692338.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP8-like [Apis florea] Back     alignment and taxonomy information
>gi|340716647|ref|XP_003396807.1| PREDICTED: LOW QUALITY PROTEIN: peptidyl-prolyl cis-trans isomerase FKBP8-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|345494458|ref|XP_003427294.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP8-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383849390|ref|XP_003700328.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP8-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|357614088|gb|EHJ68900.1| hypothetical protein KGM_11437 [Danaus plexippus] Back     alignment and taxonomy information
>gi|193718465|ref|XP_001951673.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP8-like [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query126
FB|FBgn0034368 397 CG5482 [Drosophila melanogaste 0.785 0.249 0.415 6.4e-16
ZFIN|ZDB-GENE-040426-1849 406 fkbp8 "FK506 binding protein 8 0.880 0.273 0.347 3.1e-14
UNIPROTKB|F1S912 414 FKBP8 "Uncharacterized protein 0.785 0.239 0.330 5.7e-13
UNIPROTKB|E2RNZ0 441 FKBP8 "Uncharacterized protein 0.785 0.224 0.330 5.9e-13
UNIPROTKB|J9NV07 450 FKBP8 "Uncharacterized protein 0.785 0.22 0.330 6.3e-13
UNIPROTKB|J9P6P2 473 FKBP8 "Uncharacterized protein 0.785 0.209 0.330 7.7e-13
UNIPROTKB|Q14318 412 FKBP8 "Peptidyl-prolyl cis-tra 0.801 0.245 0.303 9.8e-13
UNIPROTKB|J3KQ73 441 FKBP8 "Peptidyl-prolyl cis-tra 0.801 0.229 0.303 1.3e-12
UNIPROTKB|E1C6R4 335 E1C6R4 "Uncharacterized protei 0.928 0.349 0.349 2.9e-12
UNIPROTKB|F1N2P6 411 FKBP8 "Uncharacterized protein 0.785 0.240 0.330 1.7e-11
FB|FBgn0034368 CG5482 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 204 (76.9 bits), Expect = 6.4e-16, P = 6.4e-16
 Identities = 42/101 (41%), Positives = 64/101 (63%)

Query:    22 KPEEEVEDEWVDILGSGHIKKKITKHGEPDT--RPQRGDLCVISGFGKLEDDTLVETFDN 79
             K EEE  +E  DILG+  + K+  K    D+  RP RG+L  ++  GKL++ T+VE   N
Sbjct:    48 KAEEEDAEEECDILGNKQLIKRTIKKAPQDSFRRPIRGELVTVNFTGKLDNGTVVENELN 107

Query:    80 LEICVGDLELVHGMDYVLPLMEMGEECQIEITARFGYGDKG 120
              +  VGD E++ G+D VLP++++GE  Q+ + +RFGYG  G
Sbjct:   108 FQCHVGDYEVIQGLDMVLPMLQVGEVSQVSVDSRFGYGSLG 148
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS;IBA
GO:0005528 "FK506 binding" evidence=ISS;IBA
GO:0006457 "protein folding" evidence=IEA
GO:0018208 "peptidyl-proline modification" evidence=IBA
GO:0016020 "membrane" evidence=IBA
ZFIN|ZDB-GENE-040426-1849 fkbp8 "FK506 binding protein 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1S912 FKBP8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RNZ0 FKBP8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NV07 FKBP8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P6P2 FKBP8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q14318 FKBP8 "Peptidyl-prolyl cis-trans isomerase FKBP8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KQ73 FKBP8 "Peptidyl-prolyl cis-trans isomerase FKBP8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1C6R4 E1C6R4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N2P6 FKBP8 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.2.1LOW CONFIDENCE prediction!
4th Layer5.2.1.8LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query126
pfam0025494 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-t 3e-05
cd09994 313 cd09994, HDAC_AcuC_like, Class I histone deacetyla 0.002
>gnl|CDD|215821 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information 
 Score = 39.5 bits (93), Expect = 3e-05
 Identities = 20/76 (26%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 51  DTRPQRGDLCVISGFGKLEDDTLVET----FDNLEICVGDLELVHGMDYVLPLMEMGEEC 106
             + ++GD   +   GKLED T+ ++        E  +G  +++ G D  L  M++GE+ 
Sbjct: 2   PEKAKKGDTVTVHYTGKLEDGTVFDSSKDRGKPFEFTLGSGQVIPGWDEGLLGMKVGEKR 61

Query: 107 QIEITARFGYGDKGEP 122
           ++ I     YG++G  
Sbjct: 62  KLTIPPELAYGEEGLA 77

Length = 94
>gnl|CDD|212520 cd09994, HDAC_AcuC_like, Class I histone deacetylase AcuC (Acetoin utilization protein)-like enzymes Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 126
KOG0544|consensus108 99.93
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.9
KOG0549|consensus188 99.87
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.82
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 99.82
KOG0552|consensus226 99.81
PF0025494 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomer 99.78
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.76
PRK15095156 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.69
KOG0543|consensus 397 99.64
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.61
PRK10737 196 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 99.6
TIGR00115 408 tig trigger factor. Trigger factor is a ribosome-a 98.86
KOG0543|consensus 397 98.81
PRK01490 435 tig trigger factor; Provisional 98.79
COG0544 441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase 98.5
KOG0545|consensus 329 98.36
KOG0549|consensus 188 97.66
>KOG0544|consensus Back     alignment and domain information 
Probab=99.93  E-value=1.9e-25  Score=143.99  Aligned_cols=87  Identities=23%  Similarity=0.453  Sum_probs=81.9

Q ss_pred             CEEEEEEEcCCCCCCCCCCCEEEEEEEEEecCCcEEec----cccEEEEeCCCCcHHHHHHHhcCcCCCcEEEEEEcCCC
Q psy18101         39 HIKKKITKHGEPDTRPQRGDLCVISGFGKLEDDTLVET----FDNLEICVGDLELVHGMDYVLPLMEMGEECQIEITARF  114 (126)
Q Consensus        39 ~v~k~il~~G~g~~~p~~gd~V~v~y~~~~~dG~v~d~----~~p~~f~lG~~~li~gle~al~~M~~Ge~~~~~ip~~~  114 (126)
                      ++.++++++|+|...|+.||+|++||++.+.||+.||+    ++|+.|.+|.+++|+||++++..|.+||++.++|.|++
T Consensus         2 Gv~~~~i~~Gdg~tfpK~Gqtvt~hYtg~L~dG~kfDSs~dr~kPfkf~IGkgeVIkGwdegv~qmsvGekakLti~pd~   81 (108)
T KOG0544|consen    2 GVEKQVISPGDGRTFPKKGQTVTVHYTGTLQDGKKFDSSRDRGKPFKFKIGKGEVIKGWDEGVAQMSVGEKAKLTISPDY   81 (108)
T ss_pred             CceeEEeeCCCCcccCCCCCEEEEEEEeEecCCcEeecccccCCCeeEEecCcceeechhhcchhccccccceeeecccc
Confidence            58899999999988999999999999999999999985    47999999999999999999999999999999999999


Q ss_pred             CcCCCCCCCCC
Q psy18101        115 GYGDKGEPIFK  125 (126)
Q Consensus       115 ayG~~G~~~~~  125 (126)
                      |||..|.|+.+
T Consensus        82 aYG~~G~p~~I   92 (108)
T KOG0544|consen   82 AYGPRGHPGGI   92 (108)
T ss_pred             ccCCCCCCCcc
Confidence            99999977643

>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0549|consensus Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>KOG0552|consensus Back     alignment and domain information
>PF00254 FKBP_C: FKBP-type peptidyl-prolyl cis-trans isomerase; InterPro: IPR001179 Synonym(s): Peptidylprolyl cis-trans isomerase FKBP-type peptidylprolyl isomerases (5 Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PRK15095 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>TIGR00115 tig trigger factor Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>KOG0549|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query126
2awg_A118 Structure Of The Ppiase Domain Of The Human Fk506-B 6e-11
2d9f_A135 Solution Structure Of Ruh-047, An Fkbp Domain From 9e-11
2f2d_A121 Solution Structure Of The Fk506-Binding Domain Of H 9e-11
2jwx_A157 Solution Structure Of The N-Terminal Domain Of Huma 2e-10
3jym_A 377 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 3e-06
3jxv_A 356 Crystal Structure Of The 3 Fkbp Domains Of Wheat Fk 4e-06
1pbk_A116 Homologous Domain Of Human Fkbp25 Length = 116 2e-05
1yat_A113 Improved Calcineurin Inhibition By Yeast Fkbp12-Dru 3e-05
3kz7_A119 C-Terminal Domain Of Murine Fkbp25 Rapamycin Comple 3e-05
1r9h_A135 Structural Genomics Of C.Elegans: Fkbp-Type Peptidy 8e-05
1bl4_A107 Fkbp Mutant F36v Complexed With Remodeled Synthetic 8e-05
2dg9_A107 Fk506-Binding Protein Mutant Wl59 Complexed With Ra 9e-05
1fkk_A107 Atomic Structure Of Fkbp12, An Immunophilin Binding 1e-04
1fkb_A107 Atomic Structure Of The Rapamycin Human Immunophili 1e-04
2dg4_A107 Fk506-Binding Protein Mutant Wf59 Complexed With Ra 1e-04
2fap_A107 The Structure Of The Immunophilin-Immunosuppressant 2e-04
3h9r_B109 Crystal Structure Of The Kinase Domain Of Type I Ac 2e-04
1eym_A107 Fk506 Binding Protein Mutant, Homodimeric Complex L 2e-04
2ppp_A107 Crystal Structure Of E60q Mutant Of Fkbp12 Length = 2e-04
2ki3_A126 Structural And Biochemical Characterization Of Fk50 2e-04
2ppo_A107 Crystal Structure Of E60a Mutant Of Fkbp12 Length = 3e-04
2vn1_A129 Crystal Structure Of The Fk506-Binding Domain Of Pl 3e-04
2ofn_A135 Solution Structure Of Fk506-Binding Domain (Fkbd)of 3e-04
1bkf_A107 Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX 3e-04
2lgo_A130 Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prol 5e-04
>pdb|2AWG|A Chain A, Structure Of The Ppiase Domain Of The Human Fk506-Binding Protein 8 Length = 118 Back     alignment and structure 
Iteration: 1

 Score = 62.4 bits (150), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
Query: 29  DEWVDILGSGHIKKKITKHGEP-DTRPQRGDLCVISGFGKLEDDTLVETFDNLEICVGDL 87
           +EW+DILG+G ++KK    G P  +RP +G +  +     LE+ T V+    L   +GD 
Sbjct: 4   EEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDC 63
Query: 88  ELVHGMDYVLPLMEMGEECQIEITARFGYGDKGE 121
           +++  +D  +PLM++GE   +   +++ YG +G 
Sbjct: 64  DVIQALDLSVPLMDVGETAMVTADSKYCYGPQGR 97
>pdb|2D9F|A Chain A, Solution Structure Of Ruh-047, An Fkbp Domain From Human Cdna Length = 135 Back     alignment and structure
>pdb|2F2D|A Chain A, Solution Structure Of The Fk506-Binding Domain Of Human Fkbp38 Length = 121 Back     alignment and structure
>pdb|2JWX|A Chain A, Solution Structure Of The N-Terminal Domain Of Human Fkbp38 (Fkbp38ntd) Length = 157 Back     alignment and structure
>pdb|3JYM|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 377 Back     alignment and structure
>pdb|3JXV|A Chain A, Crystal Structure Of The 3 Fkbp Domains Of Wheat Fkbp73 Length = 356 Back     alignment and structure
>pdb|1PBK|A Chain A, Homologous Domain Of Human Fkbp25 Length = 116 Back     alignment and structure
>pdb|1YAT|A Chain A, Improved Calcineurin Inhibition By Yeast Fkbp12-Drug Complexes. Crystallographic And Functional Analysis Length = 113 Back     alignment and structure
>pdb|3KZ7|A Chain A, C-Terminal Domain Of Murine Fkbp25 Rapamycin Complex Length = 119 Back     alignment and structure
>pdb|1R9H|A Chain A, Structural Genomics Of C.Elegans: Fkbp-Type Peptidylprolyl Isomerase Length = 135 Back     alignment and structure
>pdb|1BL4|A Chain A, Fkbp Mutant F36v Complexed With Remodeled Synthetic Ligand Length = 107 Back     alignment and structure
>pdb|2DG9|A Chain A, Fk506-Binding Protein Mutant Wl59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|1FKK|A Chain A, Atomic Structure Of Fkbp12, An Immunophilin Binding Protein Length = 107 Back     alignment and structure
>pdb|1FKB|A Chain A, Atomic Structure Of The Rapamycin Human Immunophilin Fkbp- 12 Complex Length = 107 Back     alignment and structure
>pdb|2DG4|A Chain A, Fk506-Binding Protein Mutant Wf59 Complexed With Rapamycin Length = 107 Back     alignment and structure
>pdb|2FAP|A Chain A, The Structure Of The Immunophilin-Immunosuppressant Fkbp12- (C16)-Ethoxy Rapamycin Complex Interacting With Huma Length = 107 Back     alignment and structure
>pdb|3H9R|B Chain B, Crystal Structure Of The Kinase Domain Of Type I Activin Receptor (Acvr1) In Complex With Fkbp12 And Dorsomorphin Length = 109 Back     alignment and structure
>pdb|1EYM|A Chain A, Fk506 Binding Protein Mutant, Homodimeric Complex Length = 107 Back     alignment and structure
>pdb|2PPP|A Chain A, Crystal Structure Of E60q Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|2KI3|A Chain A, Structural And Biochemical Characterization Of Fk506 Binding Domain From Plasmodium Vivax Length = 126 Back     alignment and structure
>pdb|2PPO|A Chain A, Crystal Structure Of E60a Mutant Of Fkbp12 Length = 107 Back     alignment and structure
>pdb|2VN1|A Chain A, Crystal Structure Of The Fk506-Binding Domain Of Plasmodium Falciparum Fkbp35 In Complex With Fk506 Length = 129 Back     alignment and structure
>pdb|2OFN|A Chain A, Solution Structure Of Fk506-Binding Domain (Fkbd)of Fkbp35 From Plasmodium Falciparum Length = 135 Back     alignment and structure
>pdb|1BKF|A Chain A, Fk506 Binding Protein Fkbp Mutant R42kH87V COMPLEX WITH Immunosuppressant Fk506 Length = 107 Back     alignment and structure
>pdb|2LGO|A Chain A, Solution Nmr Structure Of A Fkbp-Type Peptidyl-Prolyl Cis-Trans Isomerase From Giardia Lamblia, Seattle Structural Genomics Center For Infectious Disease Target Gilaa.00840.A Length = 130 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query126
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 5e-22
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 1e-21
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 3e-21
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 2e-19
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 6e-18
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 4e-09
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 6e-15
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 6e-10
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 6e-06
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 3e-09
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 1e-08
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 3e-07
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 7e-09
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 3e-08
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 1e-07
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 5e-07
2ppn_A107 FK506-binding protein 1A; high resolution protein 8e-07
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 8e-07
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 1e-06
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 1e-06
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 1e-06
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 3e-06
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Length = 118 Back     alignment and structure
 Score = 83.1 bits (206), Expect = 5e-22
 Identities = 29/96 (30%), Positives = 53/96 (55%), Gaps = 1/96 (1%)

Query: 28  EDEWVDILGSGHIKKKITKHGE-PDTRPQRGDLCVISGFGKLEDDTLVETFDNLEICVGD 86
            +EW+DILG+G ++KK    G    +RP +G +  +     LE+ T V+    L   +GD
Sbjct: 3   PEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGD 62

Query: 87  LELVHGMDYVLPLMEMGEECQIEITARFGYGDKGEP 122
            +++  +D  +PLM++GE   +   +++ YG +G  
Sbjct: 63  CDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGRS 98
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 135 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Length = 157 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Length = 457 Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Length = 338 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Length = 280 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Length = 356 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Length = 129 Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Length = 135 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Length = 107 Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Length = 144 Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Length = 130 Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Length = 113 Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Length = 128 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} PDB: 1pbk_A* Length = 119 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query126
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 99.93
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 99.92
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 99.92
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 99.92
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 99.91
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.91
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 99.91
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 99.9
2ppn_A107 FK506-binding protein 1A; high resolution protein 99.9
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 99.9
2lkn_A165 AH receptor-interacting protein; FKBP-type domain, 99.89
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 99.89
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 99.88
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 99.87
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 99.87
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.87
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 99.86
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 99.85
1jvw_A167 Macrophage infectivity potentiator; chagas disease 99.85
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 99.85
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 99.84
1fd9_A213 Protein (macrophage infectivity potentiator prote; 99.84
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.83
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.83
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 99.82
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 99.82
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.79
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, is 99.79
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.78
3pr9_A157 FKBP-type peptidyl-prolyl CIS-trans isomerase; FKB 99.75
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.75
4dt4_A169 FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; 99.74
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcust 99.72
2kr7_A151 FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; 99.71
3prb_A 231 FKBP-type peptidyl-prolyl CIS-trans isomerase; cha 99.7
2kfw_A 196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 99.69
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 99.69
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 99.67
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 99.64
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.53
1w26_A 432 Trigger factor, TF; chaperone, protein folding, ri 99.33
1t11_A 392 Trigger factor, TF; helix-turn-helix, four-helix-b 99.18
3gty_X 433 Trigger factor, TF; chaperone-client complex, cell 97.89
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 80.87
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
Probab=99.93  E-value=5.8e-26  Score=152.46  Aligned_cols=95  Identities=32%  Similarity=0.673  Sum_probs=90.1

Q ss_pred             ccceeeecCCCCEEEEEEEcCCCC-CCCCCCCEEEEEEEEEecCCcEEeccccEEEEeCCCCcHHHHHHHhcCcCCCcEE
Q psy18101         28 EDEWVDILGSGHIKKKITKHGEPD-TRPQRGDLCVISGFGKLEDDTLVETFDNLEICVGDLELVHGMDYVLPLMEMGEEC  106 (126)
Q Consensus        28 ~~~~~~~~~~g~v~k~il~~G~g~-~~p~~gd~V~v~y~~~~~dG~v~d~~~p~~f~lG~~~li~gle~al~~M~~Ge~~  106 (126)
                      .++|++++.+|+++++++++|+|. ..|+.||.|++||++++.||++|++++|+.|.+|.+++++||+++|.+|++|+++
T Consensus         3 ~~~~~~~~~~g~~~~~vl~~G~G~~~~~~~gd~V~v~y~g~~~dG~~~ds~~p~~f~lG~~~~i~g~e~~l~gm~~Ge~~   82 (118)
T 2awg_A            3 PEEWLDILGNGLLRKKTLVPGPPGSSRPVKGQVVTVHLQTSLENGTRVQEEPELVFTLGDCDVIQALDLSVPLMDVGETA   82 (118)
T ss_dssp             TTCEEESSSSSSEEEEEEECCCTTCCCCCTTSEEEEEEEEECTTSCEEEEEEEEEEETTSSCSCHHHHHHGGGSCTTCEE
T ss_pred             cccceEECCCCCEEEEEEEcCCCCCccCCCCCEEEEEEEEEECCCCEEECCCCEEEEECCCChhHHHHHHHhCCCCCCEE
Confidence            678999999999999999999985 3799999999999999899999999899999999999999999999999999999


Q ss_pred             EEEEcCCCCcCCCCCC
Q psy18101        107 QIEITARFGYGDKGEP  122 (126)
Q Consensus       107 ~~~ip~~~ayG~~G~~  122 (126)
                      +|.|||++|||..+++
T Consensus        83 ~~~ip~~~ayG~~~~~   98 (118)
T 2awg_A           83 MVTADSKYCYGPQGRS   98 (118)
T ss_dssp             EEEECGGGTTTTTCBT
T ss_pred             EEEEChHHccCCCCCC
Confidence            9999999999999864
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3pr9_A FKBP-type peptidyl-prolyl CIS-trans isomerase; FKBP protein, chaperone; 1.95A {Methanocaldococcus jannaschii} SCOP: d.26.1.0 PDB: 3pra_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>4dt4_A FKBP-type 16 kDa peptidyl-prolyl CIS-trans isomer; FKBP domain, IF domain, chaperone, peptidyl-prolyl isomerase isomerase; 1.35A {Escherichia coli} Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>2kr7_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLY; protein, rotamase; NMR {Helicobacter pylori} Back     alignment and structure
>3prb_A FKBP-type peptidyl-prolyl CIS-trans isomerase; chaperone; 2.20A {Methanocaldococcus jannaschii} PDB: 3prd_A Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chapero isomerase, rotamase, ribonucleoprotein, binding; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 126
d1kt1a3115 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {M 3e-09
d1q1ca1120 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Hu 3e-08
d1r9ha_118 d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabd 7e-08
d1kt1a2111 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Mo 6e-06
d1pbka_116 d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 1e-05
d1q1ca2117 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {H 2e-05
d1fd9a_204 d.26.1.1 (A:) Macrophage infectivity potentiator p 0.004
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 115 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKBP51, N-terminal domains
species: Monkey (Saimiri boliviensis) [TaxId: 27679]

 Score = 48.9 bits (116), Expect = 3e-09
 Identities = 22/91 (24%), Positives = 40/91 (43%), Gaps = 1/91 (1%)

Query: 33  DILGSGHIKKKITKHGEPDTRPQRGDLCVISGFGKLEDDTLVETFDNLEICVGDLELV-H 91
           D+L  G I ++  + GE  + P  G    I   G+              +  G+   +  
Sbjct: 3   DLLEDGGIIRRTKRRGEGYSNPNEGARVQIHLEGRCGGRVFDCRDVAFTVGEGEDHDIPI 62

Query: 92  GMDYVLPLMEMGEECQIEITARFGYGDKGEP 122
           G+D  L  M+  E+C + +  R+G+G+ G+P
Sbjct: 63  GIDKALEKMQREEQCILHLGPRYGFGEAGKP 93
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Length = 118 Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Length = 111 Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Length = 204 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query126
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.93
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 99.93
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 99.91
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 99.91
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.91
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 99.9
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.87
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.86
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 99.86
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 99.85
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.85
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithot 99.7
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitaliu 99.52
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [Ta 98.93
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [Tax 98.87
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKBP52, N-terminal domains
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.93  E-value=4.7e-26  Score=152.26  Aligned_cols=94  Identities=29%  Similarity=0.456  Sum_probs=86.6

Q ss_pred             ceeeec--CCCCEEEEEEEcCCCCCCCCCCCEEEEEEEEEecCCcEEec----cccEEEEeCCCCcHHHHHHHhcCcCCC
Q psy18101         30 EWVDIL--GSGHIKKKITKHGEPDTRPQRGDLCVISGFGKLEDDTLVET----FDNLEICVGDLELVHGMDYVLPLMEMG  103 (126)
Q Consensus        30 ~~~~~~--~~g~v~k~il~~G~g~~~p~~gd~V~v~y~~~~~dG~v~d~----~~p~~f~lG~~~li~gle~al~~M~~G  103 (126)
                      +++|++  .|++++|+++++|+|...|..||.|++||++++.||++|++    .+|+.|.+|.+++++||+++|.+|++|
T Consensus         1 ~~~d~t~~~d~gv~~~i~~~G~G~~~P~~gd~V~v~y~~~l~dG~~fdss~~~~~p~~f~~g~~~~i~G~~~~l~~M~~G   80 (120)
T d1q1ca1           1 EGVDISPKQDEGVLKVIKREGTGTEMPMIGDRVFVHYTGWLLDGTKFDSSLDRKDKFSFDLGKGEVIKAWDIAIATMKVG   80 (120)
T ss_dssp             CCEECCSSCSSSEEEEEEECCSSSCCCCTTCEEEEEEEEEETTSCEEEESTTSSSCEEEETTTTSSCHHHHHHHTTCCTT
T ss_pred             CceeccCCCCCCEEEEEEEcccCCcCCCCCCEEEEEEEEEEcCCCEEEeccccccceeeecCCCceeeeeeeeeccccCC
Confidence            466776  58999999999999976799999999999999999999985    379999999999999999999999999


Q ss_pred             cEEEEEEcCCCCcCCCCCCC
Q psy18101        104 EECQIEITARFGYGDKGEPI  123 (126)
Q Consensus       104 e~~~~~ip~~~ayG~~G~~~  123 (126)
                      |+++|.|||++|||+.|+++
T Consensus        81 e~~~~~ip~~laYG~~g~~~  100 (120)
T d1q1ca1          81 EVCHITCKPEYAYGSAGSPP  100 (120)
T ss_dssp             CEEEEEECGGGTTTTTCBTT
T ss_pred             cEEEEEECHHHhCCCcCCCC
Confidence            99999999999999998765
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure