Psyllid ID: psy18110

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
VVEEGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKTKYEQGLFSSPLVPGDIHGQYYDLLRLFEYGGFPPISNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTECFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLHKHDFDLICRAHQ
ccccccccccccEEEEccccccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHcccccEEEEccccccccccccccHHHHHHHcccHHHHHHHHHHcccccccEEEcccEEEEccccccccccHHHHHccccccccccccccHHHccccccccccccccccccccEEccHHHHHHHHHHccccEEEcccc
cccccEEEEccccEEEEEccccHHHcccccEEEEEEcccccEEEEEEccccccccccccEEEcEccccHHHHHHHHHHHcccccccEEEccccccccccHHHHHHHHHHHHHHccccEEEcccccccHHHHccccHHHHHHHHccHHHHHHHHHHHcccccEEEEcccEEEEccccccccccHHHHHccccccccccccHHHHHHHcEEccccccEEEccccccEEEcHHHHHHHHHHHcccEEEEccc
VVEEGYEFFAKRQLVTLfsapnycgefdnagammsvDETLMCSFQILKTKYeqglfssplvpgdihgQYYDLLRLfeyggfppisnylflgdyvdrgKQSLETICLLLAYKikypenffllrgnHECASINRIYGFYDECKRRFNIKLWKTFTECfnclpvaaivdekifcchgglspdlqSMEQIRRimrptdvpdqgllcdllwsdpdkdtmgwgendrgvsfTFGAEVVAKFLHKHDFDLICRAHQ
VVEEGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKTKYEQGLFSSPLVPGDIHGQYYDLLRLFEYGGFPPISNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTECFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLHKHDFDLICRAHQ
VVEEGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKTKYEQGLFSSPLVPGDIHGQYYDLLRLFEYGGFPPISNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTECFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLHKHDFDLICRAHQ
****GYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKTKYEQGLFSSPLVPGDIHGQYYDLLRLFEYGGFPPISNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTECFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLHKHDFDLICR***
VVEEGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKTKYEQGLFSSPLVPGDIHGQYYDLLRLFEYGGFPPISNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTECFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLHKHDFDLICRAHQ
VVEEGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKTKYEQGLFSSPLVPGDIHGQYYDLLRLFEYGGFPPISNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTECFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLHKHDFDLICRAHQ
**EEGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKTKYEQGLFSSPLVPGDIHGQYYDLLRLFEYGGFPPISNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTECFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLHKHDFDLICRAHQ
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VVEEGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKTKYEQGLFSSPLVPGDIHGQYYDLLRLFEYGGFPPISNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTECFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLHKHDFDLICRAHQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query249 2.2.26 [Sep-21-2011]
Q6NVU2323 Serine/threonine-protein yes N/A 0.779 0.600 0.933 1e-108
P36874323 Serine/threonine-protein N/A N/A 0.779 0.600 0.933 1e-108
P63088323 Serine/threonine-protein yes N/A 0.779 0.600 0.933 1e-108
P63087323 Serine/threonine-protein yes N/A 0.779 0.600 0.933 1e-108
P61287323 Serine/threonine-protein yes N/A 0.779 0.600 0.933 1e-108
P36873323 Serine/threonine-protein yes N/A 0.779 0.600 0.933 1e-108
Q7SZ10323 Serine/threonine-protein N/A N/A 0.779 0.600 0.933 1e-107
P62138330 Serine/threonine-protein no N/A 0.779 0.587 0.933 1e-107
P62139330 Serine/threonine-protein yes N/A 0.779 0.587 0.933 1e-107
P62136330 Serine/threonine-protein no N/A 0.779 0.587 0.933 1e-107
>sp|Q6NVU2|PPIG_XENTR Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Xenopus tropicalis GN=ppp1cc PE=2 SV=1 Back     alignment and function desciption
 Score =  389 bits (1000), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 188/195 (96%), Gaps = 1/195 (0%)

Query: 56  FSSPL-VPGDIHGQYYDLLRLFEYGGFPPISNYLFLGDYVDRGKQSLETICLLLAYKIKY 114
             +PL + GDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRGKQSLETICLLLAYKIKY
Sbjct: 55  LEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKY 114

Query: 115 PENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTECFNCLPVAAIVDEKIFCCHG 174
           PENFFLLRGNHECASINRIYGFYDECKRR+NIKLWKTFT+CFNCLP+AAIVDEKIFCCHG
Sbjct: 115 PENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHG 174

Query: 175 GLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAK 234
           GLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKD +GWGENDRGVSFTFGAEVVAK
Sbjct: 175 GLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAK 234

Query: 235 FLHKHDFDLICRAHQ 249
           FLHKHD DLICRAHQ
Sbjct: 235 FLHKHDLDLICRAHQ 249
Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. Promotes nuclear envelope reassembly by targeting nuclear membrane vesicles to chromatin at the end of mitosis. Acts by dephosphorylating membrane proteins such as lamin B receptor (lbr) to regulate the binding of membrane proteins to chromatin.
Xenopus tropicalis (taxid: 8364)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 6
>sp|P36874|PP1GA_XENLA Serine/threonine-protein phosphatase PP1-gamma catalytic subunit A OS=Xenopus laevis GN=ppp1cc-a PE=1 SV=2 Back     alignment and function description
>sp|P63088|PP1G_RAT Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Rattus norvegicus GN=Ppp1cc PE=1 SV=1 Back     alignment and function description
>sp|P63087|PP1G_MOUSE Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Mus musculus GN=Ppp1cc PE=1 SV=1 Back     alignment and function description
>sp|P61287|PP1G_BOVIN Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Bos taurus GN=PPP1CC PE=2 SV=1 Back     alignment and function description
>sp|P36873|PP1G_HUMAN Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Homo sapiens GN=PPP1CC PE=1 SV=1 Back     alignment and function description
>sp|Q7SZ10|PP1GB_XENLA Serine/threonine-protein phosphatase PP1-gamma catalytic subunit B OS=Xenopus laevis GN=ppp1cc-b PE=2 SV=1 Back     alignment and function description
>sp|P62138|PP1A_RAT Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Rattus norvegicus GN=Ppp1ca PE=1 SV=1 Back     alignment and function description
>sp|P62139|PP1A_RABIT Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Oryctolagus cuniculus GN=PPP1CA PE=1 SV=1 Back     alignment and function description
>sp|P62136|PP1A_HUMAN Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens GN=PPP1CA PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query249
332018815 352 Serine/threonine-protein phosphatase alp 0.779 0.551 0.953 1e-107
307182241328 Serine/threonine-protein phosphatase alp 0.779 0.591 0.953 1e-107
340728756340 PREDICTED: serine/threonine-protein phos 0.779 0.570 0.948 1e-107
328789442340 PREDICTED: serine/threonine-protein phos 0.779 0.570 0.948 1e-107
328789444285 PREDICTED: serine/threonine-protein phos 0.763 0.666 0.968 1e-107
110751312329 PREDICTED: serine/threonine-protein phos 0.779 0.589 0.948 1e-107
383851906340 PREDICTED: serine/threonine-protein phos 0.779 0.570 0.948 1e-107
307209870300 Serine/threonine-protein phosphatase alp 0.779 0.646 0.953 1e-107
156544490328 PREDICTED: serine/threonine-protein phos 0.779 0.591 0.948 1e-107
321456768332 hypothetical protein DAPPUDRAFT_231787 [ 0.779 0.584 0.948 1e-107
>gi|332018815|gb|EGI59374.1| Serine/threonine-protein phosphatase alpha-1 isoform [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score =  395 bits (1014), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 186/195 (95%), Positives = 190/195 (97%), Gaps = 1/195 (0%)

Query: 56  FSSPL-VPGDIHGQYYDLLRLFEYGGFPPISNYLFLGDYVDRGKQSLETICLLLAYKIKY 114
             +PL + GDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRGKQSLETICLLLAYKIKY
Sbjct: 79  LEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKY 138

Query: 115 PENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTECFNCLPVAAIVDEKIFCCHG 174
           PENFFLLRGNHECASINRIYGFYDECKRR+NIKLWKTFT+CFNCLPVAAIVDEKIFCCHG
Sbjct: 139 PENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIVDEKIFCCHG 198

Query: 175 GLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAK 234
           GLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAK
Sbjct: 199 GLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAK 258

Query: 235 FLHKHDFDLICRAHQ 249
           FLHKHDFDLICRAHQ
Sbjct: 259 FLHKHDFDLICRAHQ 273

Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307182241|gb|EFN69572.1| Serine/threonine-protein phosphatase alpha-1 isoform [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340728756|ref|XP_003402682.1| PREDICTED: serine/threonine-protein phosphatase PP1-gamma catalytic subunit-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|328789442|ref|XP_003251273.1| PREDICTED: serine/threonine-protein phosphatase PP1-gamma catalytic subunit-like [Apis mellifera] gi|380026311|ref|XP_003696895.1| PREDICTED: serine/threonine-protein phosphatase PP1-gamma catalytic subunit-like isoform 2 [Apis florea] Back     alignment and taxonomy information
>gi|328789444|ref|XP_003251274.1| PREDICTED: serine/threonine-protein phosphatase PP1-gamma catalytic subunit-like [Apis mellifera] gi|340728758|ref|XP_003402683.1| PREDICTED: serine/threonine-protein phosphatase PP1-gamma catalytic subunit-like isoform 3 [Bombus terrestris] gi|380026313|ref|XP_003696896.1| PREDICTED: serine/threonine-protein phosphatase PP1-gamma catalytic subunit-like isoform 3 [Apis florea] Back     alignment and taxonomy information
>gi|110751312|ref|XP_392943.3| PREDICTED: serine/threonine-protein phosphatase PP1-gamma catalytic subunit-like isoform 1 [Apis mellifera] gi|340728754|ref|XP_003402681.1| PREDICTED: serine/threonine-protein phosphatase PP1-gamma catalytic subunit-like isoform 1 [Bombus terrestris] gi|350415732|ref|XP_003490733.1| PREDICTED: serine/threonine-protein phosphatase PP1-gamma catalytic subunit-like [Bombus impatiens] gi|380026309|ref|XP_003696894.1| PREDICTED: serine/threonine-protein phosphatase PP1-gamma catalytic subunit-like isoform 1 [Apis florea] gi|383851904|ref|XP_003701471.1| PREDICTED: serine/threonine-protein phosphatase PP1-gamma catalytic subunit-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|383851906|ref|XP_003701472.1| PREDICTED: serine/threonine-protein phosphatase PP1-gamma catalytic subunit-like isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|307209870|gb|EFN86649.1| Serine/threonine-protein phosphatase alpha-1 isoform [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|156544490|ref|XP_001602738.1| PREDICTED: serine/threonine-protein phosphatase alpha-1 isoform-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|321456768|gb|EFX67868.1| hypothetical protein DAPPUDRAFT_231787 [Daphnia pulex] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query249
UNIPROTKB|F1N0B9327 PPP1CA "Serine/threonine-prote 0.911 0.694 0.826 1.6e-102
UNIPROTKB|Q5ZL39323 LOC100858156 "Serine/threonine 0.771 0.594 0.943 2.6e-102
UNIPROTKB|P36874323 ppp1cc-a "Serine/threonine-pro 0.771 0.594 0.943 2.6e-102
UNIPROTKB|Q6NVU2323 ppp1cc "Serine/threonine-prote 0.771 0.594 0.943 2.6e-102
UNIPROTKB|Q7SZ10323 ppp1cc-b "Serine/threonine-pro 0.771 0.594 0.943 2.6e-102
UNIPROTKB|P61287323 PPP1CC "Serine/threonine-prote 0.771 0.594 0.943 2.6e-102
UNIPROTKB|E2QXE0337 PPP1CC "Serine/threonine-prote 0.771 0.569 0.943 2.6e-102
UNIPROTKB|F8W0W8332 PPP1CC "Serine/threonine-prote 0.771 0.578 0.943 2.6e-102
UNIPROTKB|P36873323 PPP1CC "Serine/threonine-prote 0.771 0.594 0.943 2.6e-102
MGI|MGI:104872323 Ppp1cc "protein phosphatase 1, 0.771 0.594 0.943 2.6e-102
UNIPROTKB|F1N0B9 PPP1CA "Serine/threonine-protein phosphatase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 1016 (362.7 bits), Expect = 1.6e-102, P = 1.6e-102
 Identities = 191/231 (82%), Positives = 200/231 (86%)

Query:    21 PNYCGEFDNAGAMMSVDETLMCSFQILKTKYEQGL-FSSPL-VPGDIHGQYYDLLRLFEY 78
             P   G+  + GA MS  E L    + +       L   +PL + GDIHGQYYDLLRLFEY
Sbjct:    18 PEVLGQ--SGGAAMSDSEKLNLDXREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEY 75

Query:    79 GGFPPISNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYD 138
             GGFPP SNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYD
Sbjct:    76 GGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYD 135

Query:   139 ECKRRFNIKLWKTFTECFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQ 198
             ECKRR+NIKLWKTFT+CFNCLP+AAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQ
Sbjct:   136 ECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQ 195

Query:   199 GLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLHKHDFDLICRAHQ 249
             GLLCDLLWSDPDKD  GWGENDRGVSFTFGAEVVAKFLHKHD DLICRAHQ
Sbjct:   196 GLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQ 246
GO:0004721 "phosphoprotein phosphatase activity" evidence=IEA
UNIPROTKB|Q5ZL39 LOC100858156 "Serine/threonine-protein phosphatase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P36874 ppp1cc-a "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q6NVU2 ppp1cc "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit" [Xenopus (Silurana) tropicalis (taxid:8364)] Back     alignment and assigned GO terms
UNIPROTKB|Q7SZ10 ppp1cc-b "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit B" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|P61287 PPP1CC "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QXE0 PPP1CC "Serine/threonine-protein phosphatase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F8W0W8 PPP1CC "Serine/threonine-protein phosphatase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P36873 PPP1CC "Serine/threonine-protein phosphatase PP1-gamma catalytic subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:104872 Ppp1cc "protein phosphatase 1, catalytic subunit, gamma isoform" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P61292PP1B_PIG3, ., 1, ., 3, ., 5, 30.90250.77910.5932noN/A
Q3T0E7PP1A_BOVIN3, ., 1, ., 3, ., 1, 60.93330.77910.5878noN/A
P36874PP1GA_XENLA3, ., 1, ., 3, ., 1, 60.93330.77910.6006N/AN/A
P36873PP1G_HUMAN3, ., 1, ., 3, ., 1, 60.93330.77910.6006yesN/A
P62143PP1B_RABIT3, ., 1, ., 3, ., 5, 30.90250.77910.5932noN/A
P62142PP1B_RAT3, ., 1, ., 3, ., 5, 30.90250.77910.5932noN/A
P62141PP1B_MOUSE3, ., 1, ., 3, ., 5, 30.90250.77910.5932noN/A
P62140PP1B_HUMAN3, ., 1, ., 3, ., 5, 30.90250.77910.5932noN/A
P12982PP12_DROME3, ., 1, ., 3, ., 1, 60.92820.77910.6423yesN/A
P62137PP1A_MOUSE3, ., 1, ., 3, ., 1, 60.92820.77910.5878noN/A
Q3SWW9PP1B_BOVIN3, ., 1, ., 3, ., 5, 30.90250.77910.5932noN/A
P20654PP1_EMENI3, ., 1, ., 3, ., 1, 60.77370.85140.6563yesN/A
Q8MJ46PP1G_CANFA3, ., 1, ., 3, ., 1, 60.92300.77910.6006yesN/A
Q8MJ47PP1B_CANFA3, ., 1, ., 3, ., 5, 30.90250.77910.5932noN/A
P48461PP11_DROME3, ., 1, ., 3, ., 1, 60.92300.77910.5932yesN/A
P48485PP15_ARATH3, ., 1, ., 3, ., 1, 60.83420.75100.5993yesN/A
P48480PP11_ACECL3, ., 1, ., 3, ., 1, 60.77140.83930.6551N/AN/A
Q6NVU2PPIG_XENTR3, ., 1, ., 3, ., 1, 60.93330.77910.6006yesN/A
Q9UW86PP1_NEUCR3, ., 1, ., 3, ., 1, 60.77370.85140.6883N/AN/A
Q5R740PP1B_PONAB3, ., 1, ., 3, ., 5, 30.90250.77910.5932noN/A
P32598PP12_YEAST3, ., 1, ., 3, ., 1, 60.88230.75100.5993yesN/A
P61287PP1G_BOVIN3, ., 1, ., 3, ., 1, 60.93330.77910.6006yesN/A
O15757PP1_DICDI3, ., 1, ., 3, ., 1, 60.85560.73490.5700yesN/A
P23880PP12_SCHPO3, ., 1, ., 3, ., 1, 60.81020.77910.6024noN/A
P62207PP1B_CHICK3, ., 1, ., 3, ., 5, 30.90250.77910.5932noN/A
Q05547PP13_DROME3, ., 1, ., 3, ., 1, 60.90250.77910.6423noN/A
Q7SZ10PP1GB_XENLA3, ., 1, ., 3, ., 1, 60.93330.77910.6006N/AN/A
Q627N3GLC7B_CAEBR3, ., 1, ., 3, ., 1, 60.92300.77910.5825N/AN/A
Q5I085PP1B_XENTR3, ., 1, ., 3, ., 1, 60.90250.77910.5932noN/A
O04857PP12_TOBAC3, ., 1, ., 3, ., 1, 60.80210.75100.6032N/AN/A
P48727GLC7B_CAEEL3, ., 1, ., 3, ., 1, 60.92300.77910.5825yesN/A
P13681PP11_SCHPO3, ., 1, ., 3, ., 1, 60.85120.77910.5932yesN/A
O04858PP13_TOBAC3, ., 1, ., 3, ., 1, 60.81280.75100.6151N/AN/A
P63088PP1G_RAT3, ., 1, ., 3, ., 1, 60.93330.77910.6006yesN/A
P62136PP1A_HUMAN3, ., 1, ., 3, ., 1, 60.93330.77910.5878noN/A
Q6GQL2PP1B_XENLA3, ., 1, ., 3, ., 1, 60.90250.77910.5932N/AN/A
P63087PP1G_MOUSE3, ., 1, ., 3, ., 1, 60.93330.77910.6006yesN/A
Q8WMS6PP1A_CANFA3, ., 1, ., 3, ., 1, 60.92300.77910.5878noN/A
P62138PP1A_RAT3, ., 1, ., 3, ., 1, 60.93330.77910.5878noN/A
P62139PP1A_RABIT3, ., 1, ., 3, ., 1, 60.93330.77910.5878yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3.160.991
3rd Layer3.1.30.976
3rd Layer3.6.1.17LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
cd07414293 cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-li 1e-160
PTZ00480320 PTZ00480, PTZ00480, serine/threonine-protein phosp 1e-125
smart00156271 smart00156, PP2Ac, Protein phosphatase 2A homologu 1e-106
PTZ00244294 PTZ00244, PTZ00244, serine/threonine-protein phosp 2e-99
cd07415285 cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phos 3e-99
PTZ00239303 PTZ00239, PTZ00239, serine/threonine protein phosp 8e-77
cd07417316 cd07417, MPP_PP5_C, PP5, C-terminal metallophospha 3e-71
cd07416305 cd07416, MPP_PP2B, PP2B, metallophosphatase domain 3e-71
cd07419311 cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 pho 3e-68
cd00144225 cd00144, MPP_PPP_family, phosphoprotein phosphatas 2e-64
cd07420321 cd07420, MPP_RdgC, Drosophila melanogaster RdgC an 1e-43
cd07418377 cd07418, MPP_PP7, PP7, metallophosphatase domain 2e-42
pfam00149185 pfam00149, Metallophos, Calcineurin-like phosphoes 1e-32
cd07414293 cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-li 5e-32
PTZ00480320 PTZ00480, PTZ00480, serine/threonine-protein phosp 4e-24
COG0639155 COG0639, ApaH, Diadenosine tetraphosphatase and re 6e-24
PTZ00244294 PTZ00244, PTZ00244, serine/threonine-protein phosp 9e-18
smart00156271 smart00156, PP2Ac, Protein phosphatase 2A homologu 1e-16
cd07424207 cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophos 1e-10
cd07415285 cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phos 1e-08
PTZ00239303 PTZ00239, PTZ00239, serine/threonine protein phosp 5e-07
cd00838131 cd00838, MPP_superfamily, metallophosphatase super 1e-06
cd07419311 cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 pho 1e-05
cd07425208 cd07425, MPP_Shelphs, Shewanella-like phosphatases 2e-05
cd07413222 cd07413, MPP_PA3087, Pseudomonas aeruginosa PA3087 2e-05
cd07417316 cd07417, MPP_PP5_C, PP5, C-terminal metallophospha 4e-05
cd07422257 cd07422, MPP_ApaH, Escherichia coli ApaH and relat 4e-05
PRK00166275 PRK00166, apaH, diadenosine tetraphosphatase; Revi 6e-05
PHA02239235 PHA02239, PHA02239, putative protein phosphatase 1e-04
PRK11439218 PRK11439, pphA, serine/threonine protein phosphata 1e-04
cd00144225 cd00144, MPP_PPP_family, phosphoprotein phosphatas 2e-04
PRK09968218 PRK09968, PRK09968, serine/threonine-specific prot 2e-04
cd07416305 cd07416, MPP_PP2B, PP2B, metallophosphatase domain 3e-04
cd07421 304 cd07421, MPP_Rhilphs, Rhilph phosphatases, metallo 0.001
cd07423234 cd07423, MPP_PrpE, Bacillus subtilis PrpE and rela 0.003
TIGR00668279 TIGR00668, apaH, bis(5'-nucleosyl)-tetraphosphatas 0.003
>gnl|CDD|163657 cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information 
 Score =  444 bits (1145), Expect = e-160
 Identities = 176/187 (94%), Positives = 181/187 (96%)

Query: 63  GDIHGQYYDLLRLFEYGGFPPISNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLR 122
           GDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLR
Sbjct: 56  GDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLR 115

Query: 123 GNHECASINRIYGFYDECKRRFNIKLWKTFTECFNCLPVAAIVDEKIFCCHGGLSPDLQS 182
           GNHECASINRIYGFYDECKRR+NIKLWKTFT+CFNCLPVAAI+DEKIFC HGGLSPDLQS
Sbjct: 116 GNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPVAAIIDEKIFCMHGGLSPDLQS 175

Query: 183 MEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLHKHDFD 242
           MEQIRRIMRPTDVPDQGLLCDLLWSDPDKD  GWGENDRGVSFTFG +VVAKFL+KHD D
Sbjct: 176 MEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGKDVVAKFLNKHDLD 235

Query: 243 LICRAHQ 249
           LICRAHQ
Sbjct: 236 LICRAHQ 242

PP1 (protein phosphatase type 1) is a serine/threonine phosphatase that regulates many cellular processes including: cell-cycle progression, protein synthesis, muscle contraction, carbohydrate metabolism, transcription and neuronal signaling, through its interaction with at least 180 known targeting proteins. PP1 occurs in all tissues and regulates many pathways, ranging from cell-cycle progression to carbohydrate metabolism. Also included here are the PPKL (PP1 and kelch-like) enzymes including the PPQ, PPZ1, and PPZ2 fungal phosphatases. These PPKLs have a large N-terminal kelch repeat in addition to a C-terminal phosphoesterase domain. The PPP (phosphoprotein phosphatase) family, to which PP1 belongs, is one of two known protein phosphatase families specific for serine and threonine. The PPP family also includes: PP2A, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-). The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes. Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes. PPPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordination. Length = 293
>gnl|CDD|185658 PTZ00480, PTZ00480, serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|197547 smart00156, PP2Ac, Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>gnl|CDD|140271 PTZ00244, PTZ00244, serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>gnl|CDD|163658 cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|173488 PTZ00239, PTZ00239, serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>gnl|CDD|163660 cd07417, MPP_PP5_C, PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163659 cd07416, MPP_PP2B, PP2B, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163662 cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163613 cd00144, MPP_PPP_family, phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163663 cd07420, MPP_RdgC, Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163661 cd07418, MPP_PP7, PP7, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|215750 pfam00149, Metallophos, Calcineurin-like phosphoesterase Back     alignment and domain information
>gnl|CDD|163657 cd07414, MPP_PP1_PPKL, PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|185658 PTZ00480, PTZ00480, serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|223712 COG0639, ApaH, Diadenosine tetraphosphatase and related serine/threonine protein phosphatases [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|140271 PTZ00244, PTZ00244, serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>gnl|CDD|197547 smart00156, PP2Ac, Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>gnl|CDD|163667 cd07424, MPP_PrpA_PrpB, PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163658 cd07415, MPP_PP2A_PP4_PP6, PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|173488 PTZ00239, PTZ00239, serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>gnl|CDD|163614 cd00838, MPP_superfamily, metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163662 cd07419, MPP_Bsu1_C, Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163668 cd07425, MPP_Shelphs, Shewanella-like phosphatases, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163656 cd07413, MPP_PA3087, Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163660 cd07417, MPP_PP5_C, PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163665 cd07422, MPP_ApaH, Escherichia coli ApaH and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|234673 PRK00166, apaH, diadenosine tetraphosphatase; Reviewed Back     alignment and domain information
>gnl|CDD|107154 PHA02239, PHA02239, putative protein phosphatase Back     alignment and domain information
>gnl|CDD|236911 PRK11439, pphA, serine/threonine protein phosphatase 1; Provisional Back     alignment and domain information
>gnl|CDD|163613 cd00144, MPP_PPP_family, phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|182173 PRK09968, PRK09968, serine/threonine-specific protein phosphatase 2; Provisional Back     alignment and domain information
>gnl|CDD|163659 cd07416, MPP_PP2B, PP2B, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163664 cd07421, MPP_Rhilphs, Rhilph phosphatases, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|163666 cd07423, MPP_PrpE, Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information
>gnl|CDD|233082 TIGR00668, apaH, bis(5'-nucleosyl)-tetraphosphatase (symmetrical) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 249
KOG0372|consensus303 100.0
PTZ00480320 serine/threonine-protein phosphatase; Provisional 100.0
KOG0374|consensus331 100.0
PTZ00244294 serine/threonine-protein phosphatase PP1; Provisio 100.0
cd07420321 MPP_RdgC Drosophila melanogaster RdgC and related 100.0
cd07414293 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzyme 100.0
smart00156271 PP2Ac Protein phosphatase 2A homologues, catalytic 100.0
cd07415285 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein 100.0
PTZ00239303 serine/threonine protein phosphatase 2A; Provision 100.0
cd07416305 MPP_PP2B PP2B, metallophosphatase domain. PP2B (ca 100.0
KOG0373|consensus306 100.0
cd07417316 MPP_PP5_C PP5, C-terminal metallophosphatase domai 100.0
cd07418377 MPP_PP7 PP7, metallophosphatase domain. PP7 is a p 100.0
cd07419311 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase a 100.0
KOG0375|consensus 517 100.0
KOG0371|consensus319 100.0
KOG0377|consensus 631 100.0
cd00144225 MPP_PPP_family phosphoprotein phosphatases of the 100.0
KOG0376|consensus476 100.0
TIGR00668279 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetric 99.96
cd07422257 MPP_ApaH Escherichia coli ApaH and related protein 99.96
PRK00166275 apaH diadenosine tetraphosphatase; Reviewed 99.95
PRK13625245 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provision 99.95
cd07413222 MPP_PA3087 Pseudomonas aeruginosa PA3087 and relat 99.94
cd07425208 MPP_Shelphs Shewanella-like phosphatases, metallop 99.94
cd07423234 MPP_PrpE Bacillus subtilis PrpE and related protei 99.92
PRK11439218 pphA serine/threonine protein phosphatase 1; Provi 99.92
PHA02239235 putative protein phosphatase 99.91
cd07421304 MPP_Rhilphs Rhilph phosphatases, metallophosphatas 99.91
cd07424207 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase do 99.89
PRK09968218 serine/threonine-specific protein phosphatase 2; P 99.88
KOG0372|consensus303 99.62
KOG0373|consensus306 99.54
PF00149200 Metallophos: Calcineurin-like phosphoesterase; Int 99.46
PRK09453182 phosphodiesterase; Provisional 99.28
KOG0374|consensus331 99.24
cd00841155 MPP_YfcE Escherichia coli YfcE and related protein 99.23
TIGR00040158 yfcE phosphoesterase, MJ0936 family. Members of th 99.21
PF12850156 Metallophos_2: Calcineurin-like phosphoesterase su 99.19
cd07417316 MPP_PP5_C PP5, C-terminal metallophosphatase domai 99.14
cd07388224 MPP_Tt1561 Thermus thermophilus Tt1561 and related 99.12
PTZ00480320 serine/threonine-protein phosphatase; Provisional 99.07
cd07379135 MPP_239FB Homo sapiens 239FB and related proteins, 99.02
PTZ00239303 serine/threonine protein phosphatase 2A; Provision 99.01
KOG0371|consensus319 99.01
cd07397238 MPP_DevT Myxococcus xanthus DevT and related prote 98.98
cd00838131 MPP_superfamily metallophosphatase superfamily, me 98.98
cd07418377 MPP_PP7 PP7, metallophosphatase domain. PP7 is a p 98.83
cd07394178 MPP_Vps29 Homo sapiens Vps29 and related proteins, 98.78
cd07403129 MPP_TTHA0053 Thermus thermophilus TTHA0053 and rel 98.76
PRK05340241 UDP-2,3-diacylglucosamine hydrolase; Provisional 98.7
cd07404166 MPP_MS158 Microscilla MS158 and related proteins, 98.66
cd07400144 MPP_YydB Bacillus subtilis YydB and related protei 98.62
cd07392188 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and rel 98.54
TIGR01854231 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase. 98.52
KOG0376|consensus476 98.47
PRK11340271 phosphodiesterase YaeI; Provisional 98.41
cd07402240 MPP_GpdQ Enterobacter aerogenes GpdQ and related p 98.36
KOG0377|consensus631 98.32
cd07399214 MPP_YvnB Bacillus subtilis YvnB and related protei 98.32
cd07385223 MPP_YkuE_C Bacillus subtilis YkuE and related prot 98.29
COG0622172 Predicted phosphoesterase [General function predic 98.25
cd07383199 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase 98.23
TIGR03729239 acc_ester putative phosphoesterase. Members of thi 98.21
COG0639155 ApaH Diadenosine tetraphosphatase and related seri 98.19
cd07398217 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and relat 98.14
PRK04036504 DNA polymerase II small subunit; Validated 98.09
cd07396267 MPP_Nbla03831 Homo sapiens Nbla03831 and related p 98.09
cd07391172 MPP_PF1019 Pyrococcus furiosus PF1019 and related 98.08
TIGR00619253 sbcd exonuclease SbcD. This family is based on the 98.05
COG2908237 Uncharacterized protein conserved in bacteria [Fun 98.03
cd07390168 MPP_AQ1575 Aquifex aeolicus AQ1575 and related pro 97.96
cd08165156 MPP_MPPE1 human MPPE1 and related proteins, metall 97.94
PHA02546 340 47 endonuclease subunit; Provisional 97.94
COG2129226 Predicted phosphoesterases, related to the Icc pro 97.85
cd07395262 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, 97.85
TIGR00024225 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11 97.84
PRK11148275 cyclic 3',5'-adenosine monophosphate phosphodieste 97.83
cd00840223 MPP_Mre11_N Mre11 nuclease, N-terminal metallophos 97.82
TIGR00583 405 mre11 DNA repair protein (mre11). All proteins in 97.69
cd07393232 MPP_DR1119 Deinococcus radiodurans DR1119 and rela 97.65
cd00844262 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-t 97.61
COG1409 301 Icc Predicted phosphohydrolases [General function 97.55
PRK10966 407 exonuclease subunit SbcD; Provisional 97.48
cd07386243 MPP_DNA_pol_II_small_archeal_C archeal DNA polymer 97.45
cd07401256 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metal 97.4
cd08166195 MPP_Cdc1_like_1 uncharacterized subgroup related t 97.34
cd07384171 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and re 97.33
cd08163257 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related 97.3
COG1408284 Predicted phosphohydrolases [General function pred 97.24
KOG0375|consensus517 97.19
cd07380150 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and re 96.96
cd00839294 MPP_PAPs purple acid phosphatases of the metalloph 96.96
cd00845252 MPP_UshA_N_like Escherichia coli UshA-like family, 96.92
PF14582255 Metallophos_3: Metallophosphoesterase, calcineurin 96.84
COG1407235 Predicted ICC-like phosphoesterases [General funct 96.77
COG0420 390 SbcD DNA repair exonuclease [DNA replication, reco 96.76
COG4186186 Predicted phosphoesterase or phosphohydrolase [Gen 96.67
cd08164193 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related 96.57
cd07410277 MPP_CpdB_N Escherichia coli CpdB and related prote 96.3
PLN02533427 probable purple acid phosphatase 95.66
cd07408257 MPP_SA0022_N Staphylococcus aureus SA0022 and rela 95.62
cd07378277 MPP_ACP5 Homo sapiens acid phosphatase 5 and relat 95.24
KOG1432|consensus 379 95.16
PF06874 640 FBPase_2: Firmicute fructose-1,6-bisphosphatase; I 95.1
cd07412288 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and 95.06
cd00842296 MPP_ASMase acid sphingomyelinase and related prote 94.93
cd07406257 MPP_CG11883_N Drosophila melanogaster CG11883 and 94.37
cd07411264 MPP_SoxB_N Thermus thermophilus SoxB and related p 94.33
COG1768230 Predicted phosphohydrolase [General function predi 94.28
KOG3662|consensus 410 93.8
cd07409281 MPP_CD73_N CD73 ecto-5'-nucleotidase and related p 93.58
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 92.68
KOG2863|consensus 456 92.18
TIGR00282266 metallophosphoesterase, MG_246/BB_0505 family. A m 90.97
COG3855 648 Fbp Uncharacterized protein conserved in bacteria 90.96
KOG3339|consensus211 90.78
cd07407282 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and 90.14
COG0737 517 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesteras 89.75
cd08162 313 MPP_PhoA_N Synechococcus sp. strain PCC 7942 PhoA 89.74
cd07405285 MPP_UshA_N Escherichia coli UshA and related prote 89.02
PF04042209 DNA_pol_E_B: DNA polymerase alpha/epsilon subunit 88.56
COG1311481 HYS2 Archaeal DNA polymerase II, small subunit/DNA 88.06
PRK09420 649 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosp 87.89
TIGR01390 626 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphod 87.64
PRK09419 1163 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 87.04
cd07382255 MPP_DR1281 Deinococcus radiodurans DR1281 and rela 86.73
TIGR01530 550 nadN NAD pyrophosphatase/5'-nucleotidase NadN. Thi 82.58
PRK11907 814 bifunctional 2',3'-cyclic nucleotide 2'-phosphodie 82.47
>KOG0372|consensus Back     alignment and domain information 
Probab=100.00  E-value=7.2e-57  Score=367.08  Aligned_cols=202  Identities=53%  Similarity=1.040  Sum_probs=189.9

Q ss_pred             hhhhhcccCCCCCC-CCcCCCCCHHHHHHHHHhCCCCCCCeEEEecccccCCCChHHHHHHHHHhHhhCCCcEEEEcCCc
Q psy18110         47 LKTKYEQGLFSSPL-VPGDIHGQYYDLLRLFEYGGFPPISNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNH  125 (249)
Q Consensus        47 f~~~~~~~~~~~~~-~igDiHG~~~~l~~ll~~~~~~~~~~~vflGD~vdrG~~s~~~l~~l~~l~~~~~~~~~~l~GNH  125 (249)
                      +-.+++-.....|+ |+|||||++.+|..+++..|-++.+.++|||||||||..|+|++.+|..||.+||+++++|||||
T Consensus        32 L~~E~NV~~i~tPvtvcGDIHGQf~Dllelf~igG~~~~t~YLFLGDyVDRG~~SvEt~lLLl~lK~rYP~ritLiRGNH  111 (303)
T KOG0372|consen   32 LVEESNVQRIDTPVTVCGDIHGQFYDLLELFRIGGDVPETNYLFLGDYVDRGYYSVETFLLLLALKVRYPDRITLIRGNH  111 (303)
T ss_pred             HhcCCCceecCCCcEEeecccchHHHHHHHHHhCCCCCCCceEeecchhccccchHHHHHHHHHHhhcCcceeEEeeccc
Confidence            33344444455666 55999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccchhhhcCcHHHHHHHhc-HHHHHHHhHHhhcCcceEEecCeEEEecCCCCCCcCCHHHHhhhcCCCCCCCcchhhHH
Q psy18110        126 ECASINRIYGFYDECKRRFN-IKLWKTFTECFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDL  204 (249)
Q Consensus       126 E~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~l~~lP~~~~i~~~~l~vHgGi~p~~~~~~~i~~~~~~~~~~~~~~~~dl  204 (249)
                      |.+.++..|||++||.++|+ ...|+.+.+.|+.||++++|+++++|||||++|+++++++|+.+.|..+.|..+..+|+
T Consensus       112 EsRqitqvYGFY~EclrKYG~~~vWr~c~eiFdyL~l~aiid~kifCVHGGlSP~i~~lDqIr~lDR~~Eiph~g~m~Dl  191 (303)
T KOG0372|consen  112 ESRQITQVYGFYDECLRKYGSANVWRYCTEIFDYLSLAAIIDGKIFCVHGGLSPSIQTLDQIRVLDRKQEVPHDGAMCDL  191 (303)
T ss_pred             hhhhhhhhhhHHHHHHHHcCChHHHHHHHHHHHhhhHhheecCcEEEEcCCCCcchhhHHHHHHhhccccCCCCCcchhe
Confidence            99999999999999999995 68999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhcCCCCCCCCCccCCCCceeecCHHHHHHHHHHCCCcEEEecCC
Q psy18110        205 LWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLHKHDFDLICRAHQ  249 (249)
Q Consensus       205 lW~dp~~~~~~~~~~~rg~~~~fg~~~~~~fl~~~~~~~iirgHe  249 (249)
                      |||||.+. ++|.-++||.|++||+++++.|++.||+.+|+|+||
T Consensus       192 lWSDPee~-~g~~~SPRGaGylFG~dvv~~F~~~N~~~~I~RaHQ  235 (303)
T KOG0372|consen  192 LWSDPEEG-PGWGLSPRGAGYLFGEDVVESFLEANGLSLICRAHQ  235 (303)
T ss_pred             eccCcccC-CCcccCCCCccccccHHHHHHHHHhCChHHHHHHHH
Confidence            99999964 599999999999999999999999999999999997

>PTZ00480 serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>KOG0374|consensus Back     alignment and domain information
>PTZ00244 serine/threonine-protein phosphatase PP1; Provisional Back     alignment and domain information
>cd07420 MPP_RdgC Drosophila melanogaster RdgC and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07414 MPP_PP1_PPKL PP1, PPKL (PP1 and kelch-like) enzymes, and related proteins, metallophosphatase domain Back     alignment and domain information
>smart00156 PP2Ac Protein phosphatase 2A homologues, catalytic domain Back     alignment and domain information
>cd07415 MPP_PP2A_PP4_PP6 PP2A, PP4, and PP6 phosphoprotein phosphatases, metallophosphatase domain Back     alignment and domain information
>PTZ00239 serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>cd07416 MPP_PP2B PP2B, metallophosphatase domain Back     alignment and domain information
>KOG0373|consensus Back     alignment and domain information
>cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>cd07418 MPP_PP7 PP7, metallophosphatase domain Back     alignment and domain information
>cd07419 MPP_Bsu1_C Arabidopsis thaliana Bsu1 phosphatase and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>KOG0375|consensus Back     alignment and domain information
>KOG0371|consensus Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>cd00144 MPP_PPP_family phosphoprotein phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>TIGR00668 apaH bis(5'-nucleosyl)-tetraphosphatase (symmetrical) Back     alignment and domain information
>cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK00166 apaH diadenosine tetraphosphatase; Reviewed Back     alignment and domain information
>PRK13625 bis(5'-nucleosyl)-tetraphosphatase PrpE; Provisional Back     alignment and domain information
>cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07425 MPP_Shelphs Shewanella-like phosphatases, metallophosphatase domain Back     alignment and domain information
>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional Back     alignment and domain information
>PHA02239 putative protein phosphatase Back     alignment and domain information
>cd07421 MPP_Rhilphs Rhilph phosphatases, metallophosphatase domain Back     alignment and domain information
>cd07424 MPP_PrpA_PrpB PrpA and PrpB, metallophosphatase domain Back     alignment and domain information
>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional Back     alignment and domain information
>KOG0372|consensus Back     alignment and domain information
>KOG0373|consensus Back     alignment and domain information
>PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11 Back     alignment and domain information
>PRK09453 phosphodiesterase; Provisional Back     alignment and domain information
>KOG0374|consensus Back     alignment and domain information
>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00040 yfcE phosphoesterase, MJ0936 family Back     alignment and domain information
>PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [] Back     alignment and domain information
>cd07417 MPP_PP5_C PP5, C-terminal metallophosphatase domain Back     alignment and domain information
>cd07388 MPP_Tt1561 Thermus thermophilus Tt1561 and related proteins, metallophosphatase domain Back     alignment and domain information
>PTZ00480 serine/threonine-protein phosphatase; Provisional Back     alignment and domain information
>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain Back     alignment and domain information
>PTZ00239 serine/threonine protein phosphatase 2A; Provisional Back     alignment and domain information
>KOG0371|consensus Back     alignment and domain information
>cd07397 MPP_DevT Myxococcus xanthus DevT and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd07418 MPP_PP7 PP7, metallophosphatase domain Back     alignment and domain information
>cd07394 MPP_Vps29 Homo sapiens Vps29 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07403 MPP_TTHA0053 Thermus thermophilus TTHA0053 and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK05340 UDP-2,3-diacylglucosamine hydrolase; Provisional Back     alignment and domain information
>cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR01854 lipid_A_lpxH UDP-2,3-diacylglucosamine hydrolase Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>PRK11340 phosphodiesterase YaeI; Provisional Back     alignment and domain information
>cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>cd07399 MPP_YvnB Bacillus subtilis YvnB and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07385 MPP_YkuE_C Bacillus subtilis YkuE and related proteins, C-terminal metallophosphatase domain Back     alignment and domain information
>COG0622 Predicted phosphoesterase [General function prediction only] Back     alignment and domain information
>cd07383 MPP_Dcr2 Saccharomyces cerevisiae DCR2 phosphatase and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR03729 acc_ester putative phosphoesterase Back     alignment and domain information
>COG0639 ApaH Diadenosine tetraphosphatase and related serine/threonine protein phosphatases [Signal transduction mechanisms] Back     alignment and domain information
>cd07398 MPP_YbbF-LpxH Escherichia coli YbbF/LpxH and related proteins, metallophosphatase domain Back     alignment and domain information
>PRK04036 DNA polymerase II small subunit; Validated Back     alignment and domain information
>cd07396 MPP_Nbla03831 Homo sapiens Nbla03831 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07391 MPP_PF1019 Pyrococcus furiosus PF1019 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00619 sbcd exonuclease SbcD Back     alignment and domain information
>COG2908 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain Back     alignment and domain information
>PHA02546 47 endonuclease subunit; Provisional Back     alignment and domain information
>COG2129 Predicted phosphoesterases, related to the Icc protein [General function prediction only] Back     alignment and domain information
>cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR00024 SbcD_rel_arch putative phosphoesterase, SbcD/Mre11-related Back     alignment and domain information
>PRK11148 cyclic 3',5'-adenosine monophosphate phosphodiesterase; Provisional Back     alignment and domain information
>cd00840 MPP_Mre11_N Mre11 nuclease, N-terminal metallophosphatase domain Back     alignment and domain information
>TIGR00583 mre11 DNA repair protein (mre11) Back     alignment and domain information
>cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd00844 MPP_Dbr1_N Dbr1 RNA lariat debranching enzyme, N-terminal metallophosphatase domain Back     alignment and domain information
>COG1409 Icc Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>PRK10966 exonuclease subunit SbcD; Provisional Back     alignment and domain information
>cd07386 MPP_DNA_pol_II_small_archeal_C archeal DNA polymerase II, small subunit, C-terminal metallophosphatase domain Back     alignment and domain information
>cd07401 MPP_TMEM62_N Homo sapiens TMEM62, N-terminal metallophosphatase domain Back     alignment and domain information
>cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain Back     alignment and domain information
>cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain Back     alignment and domain information
>COG1408 Predicted phosphohydrolases [General function prediction only] Back     alignment and domain information
>KOG0375|consensus Back     alignment and domain information
>cd07380 MPP_CWF19_N Schizosaccharomyces pombe CWF19 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd00839 MPP_PAPs purple acid phosphatases of the metallophosphatase superfamily, metallophosphatase domain Back     alignment and domain information
>cd00845 MPP_UshA_N_like Escherichia coli UshA-like family, N-terminal metallophosphatase domain Back     alignment and domain information
>PF14582 Metallophos_3: Metallophosphoesterase, calcineurin superfamily; PDB: 1UF3_B 2YVT_A Back     alignment and domain information
>COG1407 Predicted ICC-like phosphoesterases [General function prediction only] Back     alignment and domain information
>COG0420 SbcD DNA repair exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4186 Predicted phosphoesterase or phosphohydrolase [General function prediction only] Back     alignment and domain information
>cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07410 MPP_CpdB_N Escherichia coli CpdB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PLN02533 probable purple acid phosphatase Back     alignment and domain information
>cd07408 MPP_SA0022_N Staphylococcus aureus SA0022 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07378 MPP_ACP5 Homo sapiens acid phosphatase 5 and related proteins, metallophosphatase domain Back     alignment and domain information
>KOG1432|consensus Back     alignment and domain information
>PF06874 FBPase_2: Firmicute fructose-1,6-bisphosphatase; InterPro: IPR009164 Fructose 1,6-bisphosphatase catalyses the hydrolysis of fructose 1,6-bisphosphate to fructose 6-phosphate [] Back     alignment and domain information
>cd07412 MPP_YhcR_N Bacillus subtilis YhcR endonuclease and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd00842 MPP_ASMase acid sphingomyelinase and related proteins, metallophosphatase domain Back     alignment and domain information
>cd07406 MPP_CG11883_N Drosophila melanogaster CG11883 and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>cd07411 MPP_SoxB_N Thermus thermophilus SoxB and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>COG1768 Predicted phosphohydrolase [General function prediction only] Back     alignment and domain information
>KOG3662|consensus Back     alignment and domain information
>cd07409 MPP_CD73_N CD73 ecto-5'-nucleotidase and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>KOG2863|consensus Back     alignment and domain information
>TIGR00282 metallophosphoesterase, MG_246/BB_0505 family Back     alignment and domain information
>COG3855 Fbp Uncharacterized protein conserved in bacteria [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG3339|consensus Back     alignment and domain information
>cd07407 MPP_YHR202W_N Saccharomyces cerevisiae YHR202W and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>COG0737 UshA 5'-nucleotidase/2',3'-cyclic phosphodiesterase and related esterases [Nucleotide transport and metabolism] Back     alignment and domain information
>cd08162 MPP_PhoA_N Synechococcus sp Back     alignment and domain information
>cd07405 MPP_UshA_N Escherichia coli UshA and related proteins, N-terminal metallophosphatase domain Back     alignment and domain information
>PF04042 DNA_pol_E_B: DNA polymerase alpha/epsilon subunit B; InterPro: IPR007185 DNA polymerase epsilon is essential for cell viability and chromosomal DNA replication in budding yeast Back     alignment and domain information
>COG1311 HYS2 Archaeal DNA polymerase II, small subunit/DNA polymerase delta, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09420 cpdB bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase periplasmic precursor protein; Reviewed Back     alignment and domain information
>TIGR01390 CycNucDiestase 2',3'-cyclic-nucleotide 2'-phosphodiesterase Back     alignment and domain information
>PRK09419 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information
>cd07382 MPP_DR1281 Deinococcus radiodurans DR1281 and related proteins, metallophosphatase domain Back     alignment and domain information
>TIGR01530 nadN NAD pyrophosphatase/5'-nucleotidase NadN Back     alignment and domain information
>PRK11907 bifunctional 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'-nucleotidase precursor protein; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
2o8a_A329 Rat Pp1cgamma Complexed With Mouse Inhibitor-2 Leng 1e-109
1jk7_A323 Crystal Structure Of The Tumor-Promoter Okadaic Aci 1e-109
1u32_A293 Crystal Structure Of A Protein Phosphatase-1: Calci 1e-108
1fjm_A330 Protein SerineTHREONINE PHOSPHATASE-1 (Alpha Isofor 1e-108
4g9j_A331 Protein SerTHR PHOSPHATASE-1 In Complex With Cell-P 1e-108
3n5u_B300 Crystal Structure Of An Rb C-Terminal Peptide Bound 1e-108
3egg_A329 Crystal Structure Of A Complex Between Protein Phos 1e-108
3v4y_A306 Crystal Structure Of The First Nuclear Pp1 Holoenzy 1e-108
3e7a_A299 Crystal Structure Of Protein Phosphatase-1 Bound To 1e-108
1s70_A330 Complex Between Protein Ser/thr Phosphatase-1 (delt 1e-105
3p71_C304 Crystal Structure Of The Complex Of Lcmt-1 And Pp2a 2e-56
2nyl_C293 Crystal Structure Of Protein Phosphatase 2a (Pp2a) 2e-56
2ie3_C309 Structure Of The Protein Phosphatase 2a Core Enzyme 2e-56
2ie4_C309 Structure Of The Protein Phosphatase 2a Core Enzyme 3e-56
3c5w_C310 Complex Between Pp2a-Specific Methylesterase Pme-1 3e-56
3fga_C309 Structural Basis Of Pp2a And Sgo Interaction Length 8e-56
2iae_C309 Crystal Structure Of A Protein Phosphatase 2a (Pp2a 8e-56
1wao_1477 Pp5 Structure Length = 477 2e-44
1s95_A333 Structure Of SerineTHREONINE PROTEIN PHOSPHATASE 5 4e-44
3h60_A315 Catalytic Domain Of Human SerineTHREONINE PHOSPHATA 6e-44
1aui_A 521 Human Calcineurin Heterodimer Length = 521 6e-44
1m63_A372 Crystal Structure Of Calcineurin-Cyclophilin-Cyclos 9e-44
3ll8_A357 Crystal Structure Of Calcineurin In Complex With Ak 1e-43
1tco_A 375 Ternary Complex Of A Calcineurin A Fragment, Calcin 1e-43
2p6b_A383 Crystal Structure Of Human Calcineurin In Complex W 1e-43
1mf8_A 373 Crystal Structure Of Human Calcineurin Complexed Wi 1e-43
2jog_A327 Structure Of The Calcineurin-Nfat Complex Length = 1e-43
3icf_A335 Structure Of Protein SerineTHREONINE PHOSPHATASE FR 8e-37
1g5b_A221 Bacteriophage Lambda SerTHR PROTEIN PHOSPHATASE Len 3e-04
2dfj_A280 Crystal Structure Of The Diadenosine Tetraphosphate 4e-04
>pdb|2O8A|A Chain A, Rat Pp1cgamma Complexed With Mouse Inhibitor-2 Length = 329 Back     alignment and structure 
Iteration: 1

 Score =  389 bits (999), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 182/195 (93%), Positives = 188/195 (96%), Gaps = 1/195 (0%)
Query: 56  FSSPL-VPGDIHGQYYDLLRLFEYGGFPPISNYLFLGDYVDRGKQSLETICLLLAYKIKY 114
             +PL + GDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRGKQSLETICLLLAYKIKY
Sbjct: 61  LEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKY 120
Query: 115 PENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTECFNCLPVAAIVDEKIFCCHG 174
           PENFFLLRGNHECASINRIYGFYDECKRR+NIKLWKTFT+CFNCLP+AAIVDEKIFCCHG
Sbjct: 121 PENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHG 180
Query: 175 GLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAK 234
           GLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKD +GWGENDRGVSFTFGAEVVAK
Sbjct: 181 GLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAK 240
Query: 235 FLHKHDFDLICRAHQ 249
           FLHKHD DLICRAHQ
Sbjct: 241 FLHKHDLDLICRAHQ 255
>pdb|1JK7|A Chain A, Crystal Structure Of The Tumor-Promoter Okadaic Acid Bound To Protein Phosphatase-1 Length = 323 Back     alignment and structure
>pdb|1U32|A Chain A, Crystal Structure Of A Protein Phosphatase-1: Calcineurin Hybrid Bound To Okadaic Acid Length = 293 Back     alignment and structure
>pdb|1FJM|A Chain A, Protein SerineTHREONINE PHOSPHATASE-1 (Alpha Isoform, Type 1) Complexed With Microcystin-Lr Toxin Length = 330 Back     alignment and structure
>pdb|4G9J|A Chain A, Protein SerTHR PHOSPHATASE-1 In Complex With Cell-Permeable Peptide Length = 331 Back     alignment and structure
>pdb|3EGG|A Chain A, Crystal Structure Of A Complex Between Protein Phosphatase 1 Alpha (Pp1) And The Pp1 Binding And Pdz Domains Of Spinophilin Length = 329 Back     alignment and structure
>pdb|3V4Y|A Chain A, Crystal Structure Of The First Nuclear Pp1 Holoenzyme Length = 306 Back     alignment and structure
>pdb|3E7A|A Chain A, Crystal Structure Of Protein Phosphatase-1 Bound To The Natural Toxin Nodularin-R Length = 299 Back     alignment and structure
>pdb|1S70|A Chain A, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 330 Back     alignment and structure
>pdb|3P71|C Chain C, Crystal Structure Of The Complex Of Lcmt-1 And Pp2a Length = 304 Back     alignment and structure
>pdb|2NYL|C Chain C, Crystal Structure Of Protein Phosphatase 2a (Pp2a) Holoenzyme With The Catalytic Subunit Carboxyl Terminus Truncated Length = 293 Back     alignment and structure
>pdb|2IE3|C Chain C, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Tumor- Inducing Toxins Length = 309 Back     alignment and structure
>pdb|2IE4|C Chain C, Structure Of The Protein Phosphatase 2a Core Enzyme Bound To Okadaic Acid Length = 309 Back     alignment and structure
>pdb|3C5W|C Chain C, Complex Between Pp2a-Specific Methylesterase Pme-1 And Pp2a Core Enzyme Length = 310 Back     alignment and structure
>pdb|3FGA|C Chain C, Structural Basis Of Pp2a And Sgo Interaction Length = 309 Back     alignment and structure
>pdb|2IAE|C Chain C, Crystal Structure Of A Protein Phosphatase 2a (Pp2a) Holoenzyme. Length = 309 Back     alignment and structure
>pdb|1WAO|1 Chain 1, Pp5 Structure Length = 477 Back     alignment and structure
>pdb|1S95|A Chain A, Structure Of SerineTHREONINE PROTEIN PHOSPHATASE 5 Length = 333 Back     alignment and structure
>pdb|3H60|A Chain A, Catalytic Domain Of Human SerineTHREONINE PHOSPHATASE 5 (Pp5c)with Two Mn2+ Atoms Length = 315 Back     alignment and structure
>pdb|1AUI|A Chain A, Human Calcineurin Heterodimer Length = 521 Back     alignment and structure
>pdb|1M63|A Chain A, Crystal Structure Of Calcineurin-Cyclophilin-Cyclosporin Shows Common But Distinct Recognition Of Immunophilin-Drug Complexes Length = 372 Back     alignment and structure
>pdb|3LL8|A Chain A, Crystal Structure Of Calcineurin In Complex With Akap79 Peptide Length = 357 Back     alignment and structure
>pdb|1TCO|A Chain A, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 375 Back     alignment and structure
>pdb|2P6B|A Chain A, Crystal Structure Of Human Calcineurin In Complex With Pvivit Peptide Length = 383 Back     alignment and structure
>pdb|1MF8|A Chain A, Crystal Structure Of Human Calcineurin Complexed With Cyclosporin A And Human Cyclophilin Length = 373 Back     alignment and structure
>pdb|2JOG|A Chain A, Structure Of The Calcineurin-Nfat Complex Length = 327 Back     alignment and structure
>pdb|3ICF|A Chain A, Structure Of Protein SerineTHREONINE PHOSPHATASE FROM SACCHAROMYCES Cerevisiae With Similarity To Human Phosphatase Pp5 Length = 335 Back     alignment and structure
>pdb|1G5B|A Chain A, Bacteriophage Lambda SerTHR PROTEIN PHOSPHATASE Length = 221 Back     alignment and structure
>pdb|2DFJ|A Chain A, Crystal Structure Of The Diadenosine Tetraphosphate Hydrolase From Shigella Flexneri 2a Length = 280 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
1fjm_A330 Protein serine/threonine phosphatase-1 (alpha ISO 1e-155
1fjm_A330 Protein serine/threonine phosphatase-1 (alpha ISO 3e-25
3e7a_A299 PP-1A, serine/threonine-protein phosphatase PP1-al 1e-154
3e7a_A299 PP-1A, serine/threonine-protein phosphatase PP1-al 1e-25
2ie4_C309 PP2A-alpha;, serine/threonine-protein phosphatase 1e-148
2ie4_C309 PP2A-alpha;, serine/threonine-protein phosphatase 3e-27
3ll8_A357 Serine/threonine-protein phosphatase 2B catalytic 1e-141
3ll8_A357 Serine/threonine-protein phosphatase 2B catalytic 2e-18
3icf_A335 PPT, serine/threonine-protein phosphatase T; IRO m 1e-138
3icf_A335 PPT, serine/threonine-protein phosphatase T; IRO m 1e-18
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 1e-136
1aui_A521 Calcineurin, serine/threonine phosphatase 2B; hydr 6e-20
3h63_A315 Serine/threonine-protein phosphatase 5; metalloenz 1e-135
3h63_A315 Serine/threonine-protein phosphatase 5; metalloenz 7e-20
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 1e-131
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 1e-19
2z72_A342 Protein-tyrosine-phosphatase; cold-active enzyme, 1e-24
2qjc_A262 Diadenosine tetraphosphatase, putative; putative d 7e-15
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 1e-12
2dfj_A280 Diadenosinetetraphosphatase; helices and strands m 3e-12
3rqz_A246 Metallophosphoesterase; PSI-biology, midwest cente 6e-07
3qfm_A270 SAPH, putative uncharacterized protein; sandwich f 1e-05
1nnw_A252 Hypothetical protein; structural genomics, PSI, pr 3e-05
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Length = 330 Back     alignment and structure
 Score =  434 bits (1119), Expect = e-155
 Identities = 182/194 (93%), Positives = 187/194 (96%), Gaps = 1/194 (0%)

Query: 57  SSPL-VPGDIHGQYYDLLRLFEYGGFPPISNYLFLGDYVDRGKQSLETICLLLAYKIKYP 115
            +PL + GDIHGQYYDLLRLFEYGGFPP SNYLFLGDYVDRGKQSLETICLLLAYKIKYP
Sbjct: 56  EAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYP 115

Query: 116 ENFFLLRGNHECASINRIYGFYDECKRRFNIKLWKTFTECFNCLPVAAIVDEKIFCCHGG 175
           ENFFLLRGNHECASINRIYGFYDECKRR+NIKLWKTFT+CFNCLP+AAIVDEKIFCCHGG
Sbjct: 116 ENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGG 175

Query: 176 LSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKF 235
           LSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKD  GWGENDRGVSFTFGAEVVAKF
Sbjct: 176 LSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVQGWGENDRGVSFTFGAEVVAKF 235

Query: 236 LHKHDFDLICRAHQ 249
           LHKHD DLICRAHQ
Sbjct: 236 LHKHDLDLICRAHQ 249
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Length = 330 Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Length = 299 Back     alignment and structure
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Length = 299 Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Length = 309 Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Length = 309 Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Length = 357 Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Length = 357 Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Length = 335 Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Length = 335 Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Length = 521 Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Length = 521 Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Length = 315 Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Length = 315 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Length = 342 Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Length = 262 Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Length = 221 Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Length = 280 Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} Length = 246 Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Length = 270 Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Length = 252 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query249
3e7a_A299 PP-1A, serine/threonine-protein phosphatase PP1-al 100.0
3ll8_A357 Serine/threonine-protein phosphatase 2B catalytic 100.0
3h63_A315 Serine/threonine-protein phosphatase 5; metalloenz 100.0
3icf_A335 PPT, serine/threonine-protein phosphatase T; IRO m 100.0
1fjm_A330 Protein serine/threonine phosphatase-1 (alpha ISO 100.0
1aui_A 521 Calcineurin, serine/threonine phosphatase 2B; hydr 100.0
2ie4_C309 PP2A-alpha;, serine/threonine-protein phosphatase 100.0
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 100.0
2z72_A342 Protein-tyrosine-phosphatase; cold-active enzyme, 100.0
2dfj_A280 Diadenosinetetraphosphatase; helices and strands m 100.0
2qjc_A262 Diadenosine tetraphosphatase, putative; putative d 99.91
1g5b_A221 Serine/threonine protein phosphatase; bacteriophag 99.87
3rqz_A246 Metallophosphoesterase; PSI-biology, midwest cente 99.75
1nnw_A252 Hypothetical protein; structural genomics, PSI, pr 99.73
3qfm_A270 SAPH, putative uncharacterized protein; sandwich f 99.71
3icf_A335 PPT, serine/threonine-protein phosphatase T; IRO m 99.35
3h63_A315 Serine/threonine-protein phosphatase 5; metalloenz 99.35
1fjm_A330 Protein serine/threonine phosphatase-1 (alpha ISO 99.28
2ie4_C309 PP2A-alpha;, serine/threonine-protein phosphatase 99.24
1su1_A208 Hypothetical protein YFCE; structural genomics, ph 99.23
3ll8_A357 Serine/threonine-protein phosphatase 2B catalytic 99.23
1s3l_A190 Hypothetical protein MJ0936; phosphodiesterase, nu 99.16
1wao_1477 Serine/threonine protein phosphatase 5; hydrolase, 99.13
1aui_A521 Calcineurin, serine/threonine phosphatase 2B; hydr 99.03
2a22_A215 Vacuolar protein sorting 29; alpha-beta-BETA-alpha 99.03
2kkn_A178 Uncharacterized protein; protein phosphatase 2A ho 99.03
1xm7_A195 Hypothetical protein AQ_1665; structural genomics, 99.0
3ck2_A176 Conserved uncharacterized protein (predicted phosp 98.99
1z2w_A192 Vacuolar protein sorting 29; VPS29, retromer, phos 98.98
1uf3_A228 Hypothetical protein TT1561; metallo-dependent pho 98.92
3ib7_A330 ICC protein; metallophosphoesterase, alpha-beta fo 98.89
2yvt_A260 Hypothetical protein AQ_1956; structural genomics, 98.71
3d03_A274 Phosphohydrolase; glycerophosphodiesterase, metall 98.31
3rl5_A296 Metallophosphoesterase mpped2; alpha-beta fold, me 98.27
3av0_A 386 DNA double-strand break repair protein MRE11; DNA 98.23
2nxf_A 322 Putative dimetal phosphatase; dinuclear metal cent 98.15
2q8u_A 336 Exonuclease, putative; structural genomics, joint 98.15
1ii7_A 333 MRE11 nuclease; RAD50, DNA double-strand break rep 98.13
2xmo_A 443 LMO2642 protein; phosphodiesterase, hydrolase; 1.7 97.94
3tho_B 379 Exonuclease, putative; adenosine triphosphate, bac 97.75
3t1i_A 431 Double-strand break repair protein MRE11A; DNA rep 97.62
4fbw_A 417 DNA repair protein RAD32; DNA double-strand break 97.56
4fbk_A 472 DNA repair and telomere maintenance protein NBS1, 97.56
1ute_A313 Protein (II purple acid phosphatase); tartrate res 96.95
2qfp_A 424 Purple acid phosphatase; binuclear, Fe-Zn, hydrola 96.78
1xzw_A 426 Purple acid phosphatase; hydrolase; HET: NAG FUC M 96.65
3tgh_A 342 Glideosome-associated protein 50; phosphatase fold 96.0
1hp1_A 516 5'-nucleotidase; metallophosphatase, dinuclear, me 95.6
3qfk_A 527 Uncharacterized protein; structural genomics, cent 95.5
2z1a_A 552 5'-nucleotidase; metal-binding, nucleotide-binding 95.03
3ive_A 509 Nucleotidase; structural genomics, PSI-2, protein 93.91
3ztv_A 579 NAD nucleotidase, NADN; hydrolase, NAD pyrophospha 93.9
4h2g_A 546 5'-nucleotidase; dimer, hydrolase, phosphatase, ex 93.22
3gve_A 341 YFKN protein; alpha-beta-BETA-alpha sandwich, stru 92.42
3jyf_A 339 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- n 91.83
3c9f_A 557 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, p 91.62
1t71_A281 Phosphatase, conserved HYPO; crystal, X-RAY crysta 90.7
1t70_A255 Phosphatase; crystal, X-RAY crystallography, struc 88.79
4h1s_A 530 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo 88.54
2z06_A252 Putative uncharacterized protein TTHA0625; metal b 88.44
2wdc_A 562 SOXB, sulfur oxidation protein SOXB; sulfur-sulfur 84.32
>3e7a_A PP-1A, serine/threonine-protein phosphatase PP1-alpha Ca subunit; carbohydrate metabolism, cell cycle, cell division; HET: 1ZN; 1.63A {Homo sapiens} SCOP: d.159.1.3 PDB: 3e7b_A* 3egg_A* 3egh_A* 3hvq_A 3v4y_A* 3n5u_A 1jk7_A* 1it6_A* 2bcd_A* 2bdx_A* 2o8g_A 2o8a_A 1u32_A* 1s70_A* Back     alignment and structure
Probab=100.00  E-value=1.2e-54  Score=375.47  Aligned_cols=205  Identities=89%  Similarity=1.532  Sum_probs=193.1

Q ss_pred             hhhhhhhcccCCCCC-CCCcCCCCCHHHHHHHHHhCCCCCCCeEEEecccccCCCChHHHHHHHHHhHhhCCCcEEEEcC
Q psy18110         45 QILKTKYEQGLFSSP-LVPGDIHGQYYDLLRLFEYGGFPPISNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRG  123 (249)
Q Consensus        45 ~if~~~~~~~~~~~~-~~igDiHG~~~~l~~ll~~~~~~~~~~~vflGD~vdrG~~s~~~l~~l~~l~~~~~~~~~~l~G  123 (249)
                      .+|..++.......| +|||||||++++|.++|+.+++++.+.+||||||||||++|.||+.+|.++|..+|.++++|||
T Consensus        43 ~il~~ep~ll~~~~~i~viGDIHG~~~~L~~ll~~~g~~~~~~~vfLGD~VDrG~~s~evl~lL~~lk~~~p~~v~~lrG  122 (299)
T 3e7a_A           43 EIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRG  122 (299)
T ss_dssp             HHHHHSCSEEEECSSEEEECBCTTCHHHHHHHHHHHCSTTSSCEEECSCCSSSSSCHHHHHHHHHHHHHHSTTTEEECCC
T ss_pred             HHHHhCCCeeecCCCEEEEecCCCCHHHHHHHHHHhCCCCCccEEeCCcccCCCCCcHHHHHHHHHHHhhCCCcEEEEec
Confidence            456555554444444 4679999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccccchhhhcCcHHHHHHHhcHHHHHHHhHHhhcCcceEEecCeEEEecCCCCCCcCCHHHHhhhcCCCCCCCcchhhH
Q psy18110        124 NHECASINRIYGFYDECKRRFNIKLWKTFTECFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCD  203 (249)
Q Consensus       124 NHE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~lP~~~~i~~~~l~vHgGi~p~~~~~~~i~~~~~~~~~~~~~~~~d  203 (249)
                      |||.+.++..++|.+++..+|+.++|+.+.++|+.||++++++++++|||||++|++.++++|+++.||.+.+..+..+|
T Consensus       123 NHE~~~i~~~ygF~~e~~~ky~~~l~~~~~~~f~~LPlaaii~~~il~vHGGlsp~~~~l~~i~~i~R~~~~p~~~~~~d  202 (299)
T 3e7a_A          123 NHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCD  202 (299)
T ss_dssp             TTSSHHHHHHHSHHHHHHHHSCHHHHHHHHHHHTTCCCEEEETTTEEEESSCCCTTCCCTHHHHTCCSSCCCCSSSHHHH
T ss_pred             CchhhhhcccccchHHHHHHhhHHHHHHHHHHHhhCCceEEECCeEEEEcCccCcccCCHHHHHhccCCCcCCcchhhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhcCCCCCCCCCccCCCCceeecCHHHHHHHHHHCCCcEEEecCC
Q psy18110        204 LLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLHKHDFDLICRAHQ  249 (249)
Q Consensus       204 llW~dp~~~~~~~~~~~rg~~~~fg~~~~~~fl~~~~~~~iirgHe  249 (249)
                      +|||||.....+|.+++||.|+.||++++++||++|++++||||||
T Consensus       203 llWsDP~~~~~~~~~~~RG~~~~fG~~~~~~fl~~n~l~~IiR~Hq  248 (299)
T 3e7a_A          203 LLWSDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQ  248 (299)
T ss_dssp             HHHCEECTTCSSEEECTTSSSEEECHHHHHHHHHHHTCSEEEECCS
T ss_pred             hhcCCccccccCcccCCCCcceeeCHHHHHHHHHHCCCeEEEEcCe
Confidence            9999999888899999999999999999999999999999999998
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2z72_A Protein-tyrosine-phosphatase; cold-active enzyme, psychrophIle, hydrolase; 1.10A {Shewanella SP} PDB: 1v73_A 2zbm_A Back     alignment and structure
>2dfj_A Diadenosinetetraphosphatase; helices and strands mixture, hydrolase; 2.72A {Shigella flexneri 2A} Back     alignment and structure
>2qjc_A Diadenosine tetraphosphatase, putative; putative diadenosine tetraphosphatase, monomer, PSI- 2, protein structure initiative, nysgrc; 2.05A {Trypanosoma brucei} Back     alignment and structure
>1g5b_A Serine/threonine protein phosphatase; bacteriophage lambda, Ser/Thr protein phosphatase, ppase, manganese, sulfate, viral protein; 2.15A {Enterobacteria phage lambda} SCOP: d.159.1.3 Back     alignment and structure
>3rqz_A Metallophosphoesterase; PSI-biology, midwest center for structural genomics, MCSG, Zn binding, hydrolase; 1.95A {Sphaerobacter thermophilus} SCOP: d.159.1.0 Back     alignment and structure
>1nnw_A Hypothetical protein; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 1.90A {Pyrococcus furiosus} SCOP: d.159.1.5 PDB: 2gju_A Back     alignment and structure
>3qfm_A SAPH, putative uncharacterized protein; sandwich fold, asymmetric AP4A hydrolase, phosphodiesterase, binding, Mn2+ binding, hydrolase; 1.90A {Streptococcus pneumoniae} PDB: 3qfn_A 3qfo_A* Back     alignment and structure
>3icf_A PPT, serine/threonine-protein phosphatase T; IRO metalloprotein, structural genomics, PSI-2, protein structu initiative; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3h63_A Serine/threonine-protein phosphatase 5; metalloenzyme, inhibitors, drug design, cytoplasm, hydrolase, iron, manganese, metal-binding, nucleus; HET: NHC; 1.30A {Homo sapiens} SCOP: d.159.1.3 PDB: 3h60_A* 3h61_A* 3h62_C* 3h64_A* 3h66_A 3h67_A* 3h68_A* 3h69_A* 1s95_A Back     alignment and structure
>1fjm_A Protein serine/threonine phosphatase-1 (alpha ISO 1); hydrolase, toxin, hydrolase-hydrolase inhibitor complex; HET: 1ZN; 2.10A {Oryctolagus cuniculus} SCOP: d.159.1.3 Back     alignment and structure
>2ie4_C PP2A-alpha;, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform; protein-protein complex, heat repeat, signaling protein; HET: OKA; 2.60A {Homo sapiens} SCOP: d.159.1.3 PDB: 2npp_C* 3dw8_C* 3k7v_C* 3k7w_C* 3c5w_C 2ie3_C* 3fga_C* 2iae_C* 3p71_C* 2nym_C* 2nyl_C* Back     alignment and structure
>1su1_A Hypothetical protein YFCE; structural genomics, phosphoesterase, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.25A {Escherichia coli} SCOP: d.159.1.7 Back     alignment and structure
>3ll8_A Serine/threonine-protein phosphatase 2B catalytic alpha isoform; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 2p6b_A 1m63_A* 1tco_A* 1mf8_A* 2jog_A Back     alignment and structure
>1s3l_A Hypothetical protein MJ0936; phosphodiesterase, nuclease, structural genomics, BSGC struc funded by NIH; 2.40A {Methanocaldococcus jannaschii} SCOP: d.159.1.7 PDB: 1s3m_A 1s3n_A 2ahd_A Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1aui_A Calcineurin, serine/threonine phosphatase 2B; hydrolase, immunosuppression; 2.10A {Homo sapiens} SCOP: d.159.1.3 Back     alignment and structure
>2a22_A Vacuolar protein sorting 29; alpha-beta-BETA-alpha sandwich, structural genomics, structural genomics consortium, SGC, protein transport; 2.20A {Cryptosporidium parvum} SCOP: d.159.1.7 Back     alignment and structure
>2kkn_A Uncharacterized protein; protein phosphatase 2A homologue, structural genomics, PSI- 2, protein structure initiative; NMR {Thermotoga maritima} Back     alignment and structure
>1xm7_A Hypothetical protein AQ_1665; structural genomics, protein structure initi midwest center for structural genomics, PSI, MCSG, unknown; 2.40A {Aquifex aeolicus} SCOP: d.159.1.8 Back     alignment and structure
>3ck2_A Conserved uncharacterized protein (predicted phosphoesterase COG0622); structural genomics, predicted phosphodiesterase, PSI-2; HET: SRT; 2.30A {Streptococcus pneumoniae} SCOP: d.159.1.7 Back     alignment and structure
>1z2w_A Vacuolar protein sorting 29; VPS29, retromer, phosphatase, manganese, protein transport; 2.00A {Mus musculus} SCOP: d.159.1.7 PDB: 1z2x_A 3lh6_A 3lh7_A 3psn_A 3pso_A 1w24_A 2r17_A Back     alignment and structure
>1uf3_A Hypothetical protein TT1561; metallo-dependent phosphatases, structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.10A {Thermus thermophilus} SCOP: d.159.1.6 Back     alignment and structure
>3ib7_A ICC protein; metallophosphoesterase, alpha-beta fold, swapped-dimer, HYDR; HET: BTB; 1.60A {Mycobacterium tuberculosis} PDB: 3ib8_A* 2hy1_A 2hyp_A 2hyo_A Back     alignment and structure
>2yvt_A Hypothetical protein AQ_1956; structural genomics, unknown function, NPPSFA, national PROJ protein structural and functional analyses; 1.60A {Aquifex aeolicus} SCOP: d.159.1.6 Back     alignment and structure
>3d03_A Phosphohydrolase; glycerophosphodiesterase, metallohydrolase, phosphatase, metal ION; 1.90A {Enterobacter aerogenes} SCOP: d.159.1.11 PDB: 2zoa_A 2zo9_B 2dxn_A 2dxl_A Back     alignment and structure
>3rl5_A Metallophosphoesterase mpped2; alpha-beta fold, metallophosphodiesterase, active site mutan nucleotide polymorphism, hydrolase; 1.26A {Rattus norvegicus} PDB: 3rl3_A* 3rl4_A* Back     alignment and structure
>3av0_A DNA double-strand break repair protein MRE11; DNA repair, calcineurin-like phosphoesterase, ABC transporte domain-like; HET: DNA AGS; 3.10A {Methanocaldococcus jannaschii} PDB: 3auz_A* Back     alignment and structure
>2nxf_A Putative dimetal phosphatase; dinuclear metal center phosphatase, metalloprotein, metallophosphoesterase, protein structure initiative; 1.70A {Danio rerio} SCOP: d.159.1.12 Back     alignment and structure
>2q8u_A Exonuclease, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; HET: MSE; 2.20A {Thermotoga maritima MSB8} PDB: 3thn_A Back     alignment and structure
>1ii7_A MRE11 nuclease; RAD50, DNA double-strand break repair, DAMP, manganese, replication; HET: DA; 2.20A {Pyrococcus furiosus} SCOP: d.159.1.4 PDB: 3dsc_A* 3dsd_A* 1s8e_A Back     alignment and structure
>2xmo_A LMO2642 protein; phosphodiesterase, hydrolase; 1.70A {Listeria monocytogenes} Back     alignment and structure
>3tho_B Exonuclease, putative; adenosine triphosphate, bacterial proteins, DNA breaks, DOUB stranded, DNA repair, DNA repair enzymes; HET: ADP; 2.61A {Thermotoga maritima} PDB: 3qg5_C Back     alignment and structure
>3t1i_A Double-strand break repair protein MRE11A; DNA repair, MRN complex, metallophosphatase, exonuclease, endonuclease, RAD50, NBS1, hydrolase; 3.00A {Homo sapiens} Back     alignment and structure
>4fbw_A DNA repair protein RAD32; DNA double-strand break repair, nuclease, hydrolase; HET: DNA; 2.20A {Schizosaccharomyces pombe} PDB: 4fcx_B* Back     alignment and structure
>4fbk_A DNA repair and telomere maintenance protein NBS1, protein RAD32 chimeric protein; DNA double-strand break repair, nuclease; HET: DNA; 2.38A {Schizosaccharomyces pombe} PDB: 4fbq_A* Back     alignment and structure
>1ute_A Protein (II purple acid phosphatase); tartrate resistant acid phosphatase metalloenzyme, uteroferrin, hydrolase; HET: NAG; 1.55A {Sus scrofa} SCOP: d.159.1.1 PDB: 1war_A* 2bq8_X 1qfc_A* 1qhw_A* Back     alignment and structure
>2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* Back     alignment and structure
>1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 Back     alignment and structure
>3tgh_A Glideosome-associated protein 50; phosphatase fold, NOT A phosphatase, motor protein, structur protein, membrane protein; 1.70A {Plasmodium falciparum 3D7} Back     alignment and structure
>1hp1_A 5'-nucleotidase; metallophosphatase, dinuclear, metalloenzyme, hydrolase, domain movement; HET: ATP; 1.70A {Escherichia coli} SCOP: d.114.1.1 d.159.1.2 PDB: 1ush_A 2ush_A 1hpu_A* 1ho5_A* 1oi8_A 1oid_A 1oie_A Back     alignment and structure
>3qfk_A Uncharacterized protein; structural genomics, center for structural genomics of infec diseases, csgid, phosphoesterase, hydrolase; HET: MSE AKG; 2.05A {Staphylococcus aureus subsp} Back     alignment and structure
>2z1a_A 5'-nucleotidase; metal-binding, nucleotide-binding, hydrolase, structural genomics, NPPSFA; HET: THM; 1.75A {Thermus thermophilus} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>3ive_A Nucleotidase; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics, nysgxrc; HET: CTN; 1.70A {Escherichia coli O6} PDB: 3ivd_A* Back     alignment and structure
>3ztv_A NAD nucleotidase, NADN; hydrolase, NAD pyrophosphatase, NMN nucleotidase, periplasmi enzyme, CD73; HET: ADN; 1.30A {Haemophilus influenzae} PDB: 3zu0_A* Back     alignment and structure
>4h2g_A 5'-nucleotidase; dimer, hydrolase, phosphatase, extracellular; HET: ADN; 1.55A {Homo sapiens} PDB: 4h2f_A* 4h1y_P* 4h2i_A* 4h1s_A* 4h2b_A* Back     alignment and structure
>3gve_A YFKN protein; alpha-beta-BETA-alpha sandwich, structural genomics, PSI-2, structure initiative; HET: CIT; 1.25A {Bacillus subtilis subsp} Back     alignment and structure
>3jyf_A 2',3'-cyclic nucleotide 2'-phosphodiesterase/3'- nucleotidase bifunctional periplasmic...; APC63187.2; HET: EPE TAM; 2.43A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3c9f_A 5'-nucleotidase; 2',3'-cyclic phosphodiesterase, protein STR initiative, PSI-2, NEW YORK SGX research center for structu genomics, nysgxrc; 1.90A {Candida albicans} SCOP: d.114.1.1 d.159.1.2 Back     alignment and structure
>1t71_A Phosphatase, conserved HYPO; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI; 2.10A {Mycoplasma pneumoniae M129} SCOP: d.159.1.9 Back     alignment and structure
>1t70_A Phosphatase; crystal, X-RAY crystallography, structural GENO berkeley structural genomics center, BSGC, PSI, protein STR initiative; 2.30A {Deinococcus radiodurans} SCOP: d.159.1.9 Back     alignment and structure
>4h1s_A 5'-nucleotidase; hydrolase; HET: NAG; 2.20A {Homo sapiens} Back     alignment and structure
>2z06_A Putative uncharacterized protein TTHA0625; metal binding protein, structural genomics, NPPSFA; 2.20A {Thermus thermophilus} SCOP: d.159.1.10 PDB: 2cv9_A Back     alignment and structure
>2wdc_A SOXB, sulfur oxidation protein SOXB; sulfur-sulfur hydrolysis, sulfur oxidation pathway, Cys S-thiosulfonate, hydrolase; 1.50A {Thermus thermophilus} PDB: 2wdd_A* 2wde_A 2wdf_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 249
d1auia_ 473 d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calc 4e-84
d1auia_473 d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calc 3e-12
d1jk7a_294 d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human 9e-82
d1jk7a_294 d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human 1e-18
d1s95a_324 d.159.1.3 (A:) Serine/threonine protein phosphatas 2e-75
d1s95a_324 d.159.1.3 (A:) Serine/threonine protein phosphatas 7e-15
d3c5wc1288 d.159.1.3 (C:6-293) Protein phosphatase 2A catalyt 9e-74
d3c5wc1288 d.159.1.3 (C:6-293) Protein phosphatase 2A catalyt 7e-17
d1g5ba_219 d.159.1.3 (A:) lambda ser/thr protein phosphatase 2e-14
d1nnwa_251 d.159.1.5 (A:) Hypothetical protein PF1291 {Archae 1e-11
d1su1a_184 d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia 6e-08
d1uf3a_228 d.159.1.6 (A:) Hypothetical protein TT1561 {Thermu 2e-05
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 473 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Protein serine/threonine phosphatase
domain: Protein phosphatase-2B (PP-2B, calcineurin A subunit)
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  256 bits (656), Expect = 4e-84
 Identities = 82/194 (42%), Positives = 124/194 (63%), Gaps = 7/194 (3%)

Query: 63  GDIHGQYYDLLRLFEYGGFPPISNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLR 122
           GDIHGQ++DL++LFE GG P  + YLFLGDYVDRG  S+E +  L A KI YP+  FLLR
Sbjct: 76  GDIHGQFFDLMKLFEVGGSPANTRYLFLGDYVDRGYFSIECVLYLWALKILYPKTLFLLR 135

Query: 123 GNHECASINRIYGFYDECKRRFNIKLWKTFTECFNCLPVAAIVDEKIFCCHGGLSPDLQS 182
           GNHEC  +   + F  ECK +++ +++    + F+CLP+AA+++++  C HGGLSP++ +
Sbjct: 136 GNHECRHLTEYFTFKQECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEINT 195

Query: 183 MEQIRRIMRPTDVPDQGLLCDLLWSDPDKDTMGWGEND-------RGVSFTFGAEVVAKF 235
           ++ IR++ R  + P  G +CD+LWSDP +D       +       RG S+ +    V +F
Sbjct: 196 LDDIRKLDRFKEPPAYGPMCDILWSDPLEDFGNEKTQEHFTHNTVRGCSYFYSYPAVCEF 255

Query: 236 LHKHDFDLICRAHQ 249
           L  ++   I RAH+
Sbjct: 256 LQHNNLLSILRAHE 269
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 473 Back     information, alignment and structure
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Length = 219 Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 251 Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Length = 228 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query249
d1jk7a_294 Protein phosphatase-1 (PP-1) {Human (Homo sapiens) 100.0
d3c5wc1288 Protein phosphatase 2A catalytic subunit alpha iso 100.0
d1s95a_324 Serine/threonine protein phosphatase 5, PP5 {Human 100.0
d1auia_ 473 Protein phosphatase-2B (PP-2B, calcineurin A subun 100.0
d1g5ba_219 lambda ser/thr protein phosphatase {Bacteriophage 99.91
d1nnwa_251 Hypothetical protein PF1291 {Archaeon Pyrococcus f 99.78
d1uf3a_228 Hypothetical protein TT1561 {Thermus thermophilus 99.51
d1s3la_165 Putative phosphodiesterase MJ0936 {Methanococcus j 99.24
d1su1a_184 Phosphodiesterase yfcE {Escherichia coli [TaxId: 5 99.19
d1s95a_324 Serine/threonine protein phosphatase 5, PP5 {Human 99.08
d1z2wa1182 Vacuolar protein sorting 29, VPS29 {Mouse (Mus mus 99.01
d3ck2a1173 Uncharacterized protein SP1879 {Streptococcus pneu 99.0
d2a22a1193 Vacuolar protein sorting 29, VPS29 {Cryptosporidiu 98.96
d1auia_473 Protein phosphatase-2B (PP-2B, calcineurin A subun 98.79
d2yvta1257 Uncharacterized protein Aq_1956 {Aquifex aeolicus 98.62
d1ii7a_ 333 Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.21
d1xm7a_188 Hypothetical protein aq_1666 {Aquifex aeolicus [Ta 98.0
d3d03a1271 Glycerophosphodiesterase GpdQ {Enterobacter aeroge 97.88
d2hy1a1256 Rv0805 cyclic nucleotide phosphodiesterase {Mycoba 97.84
d2nxfa1 320 Uncharacterized C17orf48 homolog zgc:64213 {Zebraf 97.43
d1utea_302 Mammalian purple acid phosphatase {Pig (Sus scrofa 96.2
d2qfra2 312 Plant purple acid phosphatase, catalytic domain {K 96.12
d2z1aa2302 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 93.06
d1usha2 337 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 88.94
d3c9fa2322 5'-nucleotidase (syn. UDP-sugar hydrolase), N-term 84.03
>d1jk7a_ d.159.1.3 (A:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Metallo-dependent phosphatases
superfamily: Metallo-dependent phosphatases
family: Protein serine/threonine phosphatase
domain: Protein phosphatase-1 (PP-1)
species: Human (Homo sapiens), beta isoform [TaxId: 9606]

Probab=100.00  E-value=6.8e-57  Score=386.19  Aligned_cols=207  Identities=89%  Similarity=1.532  Sum_probs=197.5

Q ss_pred             hhhhhhhhhcccCCCCCC-CCcCCCCCHHHHHHHHHhCCCCCCCeEEEecccccCCCChHHHHHHHHHhHhhCCCcEEEE
Q psy18110         43 SFQILKTKYEQGLFSSPL-VPGDIHGQYYDLLRLFEYGGFPPISNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL  121 (249)
Q Consensus        43 ~f~if~~~~~~~~~~~~~-~igDiHG~~~~l~~ll~~~~~~~~~~~vflGD~vdrG~~s~~~l~~l~~l~~~~~~~~~~l  121 (249)
                      .-.+|+.++.....+.|+ |||||||++++|.++++..|+++..++||||||||||+.|+||+.+|.+||+++|.+|++|
T Consensus        37 a~~i~~~e~~ll~i~~pv~VvGDiHG~~~DL~~if~~~g~p~~~~ylFLGDYVDRG~~slE~i~lL~aLKi~~P~~v~lL  116 (294)
T d1jk7a_          37 SREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLL  116 (294)
T ss_dssp             HHHHHHHSCSEEEECSSEEEECBCTTCHHHHHHHHHHHCCTTSSCEEECSCCSSSSSCHHHHHHHHHHHHHHSTTTEEEC
T ss_pred             HHHHHHhCCCEEEecCCeEEEEECCCChHhHHHHHhhcCCCccceEEeeccccCCCccchHHHHHHHHHHhhCCCeEEEe
Confidence            445777777665566666 5699999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCCccccchhhhcCcHHHHHHHhcHHHHHHHhHHhhcCcceEEecCeEEEecCCCCCCcCCHHHHhhhcCCCCCCCcchh
Q psy18110        122 RGNHECASINRIYGFYDECKRRFNIKLWKTFTECFNCLPVAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLL  201 (249)
Q Consensus       122 ~GNHE~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~lP~~~~i~~~~l~vHgGi~p~~~~~~~i~~~~~~~~~~~~~~~  201 (249)
                      |||||...++..++|.+++..+|+.++|+.+.+.|+.||++|+++++++|||||++|....+++++.+.||.+.+..+.+
T Consensus       117 RGNHE~~~~~~~~gF~~e~~~~y~~~i~~~~~~~F~~LPlaalI~~~i~cvHGGi~~~~~~l~~i~~i~r~~~~~~~~~~  196 (294)
T d1jk7a_         117 RGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLL  196 (294)
T ss_dssp             CCTTSSHHHHTTSSHHHHHHHHSCHHHHHHHHHHHTTCCCEEEETTTEEEESSCCCTTCCCHHHHHTCCSSCCCCSSSHH
T ss_pred             cCCcccccccccccchhHHHhhcCHHHHHHHHHHHhhCceeeEEcCeEEEecCcccCCccchhhhhhccCCCCCCCcchh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHhcCCCCCCCCCccCCCCceeecCHHHHHHHHHHCCCcEEEecCC
Q psy18110        202 CDLLWSDPDKDTMGWGENDRGVSFTFGAEVVAKFLHKHDFDLICRAHQ  249 (249)
Q Consensus       202 ~dllW~dp~~~~~~~~~~~rg~~~~fg~~~~~~fl~~~~~~~iirgHe  249 (249)
                      .|+|||||.+...+|.+++||.|+.||++++++||++||+++||||||
T Consensus       197 ~dllWsDP~~~~~~~~~~~RG~g~~fg~~~~~~Fl~~n~l~~IIR~He  244 (294)
T d1jk7a_         197 CDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQ  244 (294)
T ss_dssp             HHHHHCEECSSCSSEEECTTSSSEEECHHHHHHHHHHTTCSEEEECCS
T ss_pred             hhhhhcCCccccCCCCCCCCCCccccCHHHHHHHHHHCCCCEEEEcCc
Confidence            999999999999999999999999999999999999999999999998
>d3c5wc1 d.159.1.3 (C:6-293) Protein phosphatase 2A catalytic subunit alpha isoform, PP2A-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g5ba_ d.159.1.3 (A:) lambda ser/thr protein phosphatase {Bacteriophage lambda [TaxId: 10710]} Back     information, alignment and structure
>d1nnwa_ d.159.1.5 (A:) Hypothetical protein PF1291 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1uf3a_ d.159.1.6 (A:) Hypothetical protein TT1561 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s3la_ d.159.1.7 (A:) Putative phosphodiesterase MJ0936 {Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1su1a_ d.159.1.7 (A:) Phosphodiesterase yfcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s95a_ d.159.1.3 (A:) Serine/threonine protein phosphatase 5, PP5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2wa1 d.159.1.7 (A:1-182) Vacuolar protein sorting 29, VPS29 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3ck2a1 d.159.1.7 (A:1-173) Uncharacterized protein SP1879 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2a22a1 d.159.1.7 (A:4-196) Vacuolar protein sorting 29, VPS29 {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1auia_ d.159.1.3 (A:) Protein phosphatase-2B (PP-2B, calcineurin A subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2yvta1 d.159.1.6 (A:4-260) Uncharacterized protein Aq_1956 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1ii7a_ d.159.1.4 (A:) Mre11 {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xm7a_ d.159.1.8 (A:) Hypothetical protein aq_1666 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d3d03a1 d.159.1.11 (A:1-271) Glycerophosphodiesterase GpdQ {Enterobacter aerogenes [TaxId: 548]} Back     information, alignment and structure
>d2hy1a1 d.159.1.11 (A:10-265) Rv0805 cyclic nucleotide phosphodiesterase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2nxfa1 d.159.1.12 (A:3-322) Uncharacterized C17orf48 homolog zgc:64213 {Zebrafish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d1utea_ d.159.1.1 (A:) Mammalian purple acid phosphatase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2qfra2 d.159.1.1 (A:121-432) Plant purple acid phosphatase, catalytic domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2z1aa2 d.159.1.2 (A:28-329) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1usha2 d.159.1.2 (A:26-362) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c9fa2 d.159.1.2 (A:16-337) 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain {Candida albicans [TaxId: 5476]} Back     information, alignment and structure