Psyllid ID: psy18137

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320
MFQEQAHDAKLKATSPEETEDLSPLPSQGQQSARRRGGISAEPVSEEDATSYVKKVVPKDYKTMAALSKAIAKNVLFSHLDENTRSDIFDAMFPVNCLPGESIITQGDEGDNFYVIDQGEVEVYVNNELVTSVGEGGSFGELALIYGTPRAATVRAKTDVKLWGLDRDSYRRILMGSTIRKRKLYEEFLSRVSILESLEKWERLTVADSLEPVSFQDKEAIVRQGQPGDDFYIIVEGTALVLQNTVEEESPVEVGKLGPSDYFGEIALLLDRPRAATVVAKGPLKCVKLDRARFERVLGPCADILKRNITQYNSFVSLSV
cccccccHHHcccccccccccccccccccccccccccEEEEcccccccccccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHccEEEEEccccEEEEccccccEEEEEEcEEEEEEEccEEEEEEcccccHHHHHHHccccccEEEEEEccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHccccEEEEccccEEEEccccccEEEEEEEcEEEEEEEcccccccEEEEEEccccccHHHHHcccccccEEEEEEccEEEEEEEHHHHHHHHccHHHHHHHHHHHHHHcccccc
cccHHHcccccccccccccccccccccccccccccEcEEEccccccccccccccccccccHHHHHHHHHHHHHccHHHcccHHHHHHHHHHHcccEcccccEEEEEcccccEEEEEEccEEEEEEccEEEEEEccccccHHHHHHcccccEEEEEEccccEEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHccHHHcccHHHHHHHHHHHcccEcccccEEEEEccccccEEEEEEcEEEEEEEcccccccEEEEEcccccccEEEEHEcccccEEEEEEEccEEEEEEcHHHHHHHHcHHHHHHHHcHHHHHHHHEccc
MFQEQahdaklkatspeetedlsplpsqgqqsarrrggisaepvseedatsyvkkvvpkDYKTMAALSKAIAKNVLfshldentrsdifdamfpvnclpgesiitqgdegdnfyvidqGEVEVYVNNELVtsvgeggsfgelaliygtpraatvraktdvklwgldrdsyRRILMGSTIRKRKLYEEFLSRVSILESLEKWERLtvadslepvsfqdkeaivrqgqpgddfyIIVEGTALVLQntveeespvevgklgpsdyfgEIALLldrpraatvvakgplkcvkLDRARFERVLGPCADILKRNITQYNSFVSLSV
mfqeqahdaklkatspeetedlsplpsqgqqsarrrggisaepvseedatsyvkkvvpKDYKTMAALSKAIAKNVLFSHLDENTRSDIFDAMFPVNCLPGESIITQGDEGDNFYVIDQGEVEVYVNNELVTSVGEGGSFGELALIygtpraatvraktdvklwgldrdsyrrilmgstirkrklYEEFLSRVSILESLEKWERLTVadslepvsfqDKEAIVRQGQPGDDFYIIVEGTALVLQNTVeeespvevgklgpSDYFGEIALLLDRPRAatvvakgplkcvkldrarFERVlgpcadilkrnitqynsfvslsv
MFQEQAHDAKLKATSPEETEDLSPLPSQGQQSARRRGGISAEPVSEEDATSYVKKVVPKDYKTMAALSKAIAKNVLFSHLDENTRSDIFDAMFPVNCLPGESIITQGDEGDNFYVIDQGEVEVYVNNELVTSVGEGGSFGELALIYGTPRAATVRAKTDVKLWGLDRDSYRRILMGSTIRKRKLYEEFLSRVSILESLEKWERLTVADSLEPVSFQDKEAIVRQGQPGDDFYIIVEGTALVLQNTVEEESPVEVGKLGPSDYFGEIALLLDRPRAATVVAKGPLKCVKLDRARFERVLGPCADILKRNITQYNSFVSLSV
***************************************************YVKKVVPKDYKTMAALSKAIAKNVLFSHLDENTRSDIFDAMFPVNCLPGESIITQGDEGDNFYVIDQGEVEVYVNNELVTSVGEGGSFGELALIYGTPRAATVRAKTDVKLWGLDRDSYRRILMGSTIRKRKLYEEFLSRVSILESLEKWERLTVADSLEPVSFQDKEAIVRQGQPGDDFYIIVEGTALVLQNTVEEESPVEVGKLGPSDYFGEIALLLDRPRAATVVAKGPLKCVKLDRARFERVLGPCADILKRNITQYNSFV****
*******************************************VSEEDATSY***VV**DYKTMAALSKAIAKNVLFSHLDENTRSDIFDAMFPVNCLPGESIITQGDEGDNFYVIDQGEVEVYVNNELVTSVGEGGSFGELALIYGTPRAATVRAKTDVKLWGLDRDSYRRILMGSTIRKRKLYEEFLSRVSILESLEKWERLTVADSLEPVSFQDKEAIVRQGQPGDDFYIIVEGTALVLQN*******VEVGKLGPSDYFGEIALLLDRPRAATVVAKGPLKCVKLDRARFERVLGPCADILKRNITQYNSFVSLSV
***************************************************YVKKVVPKDYKTMAALSKAIAKNVLFSHLDENTRSDIFDAMFPVNCLPGESIITQGDEGDNFYVIDQGEVEVYVNNELVTSVGEGGSFGELALIYGTPRAATVRAKTDVKLWGLDRDSYRRILMGSTIRKRKLYEEFLSRVSILESLEKWERLTVADSLEPVSFQDKEAIVRQGQPGDDFYIIVEGTALVLQNTVEEESPVEVGKLGPSDYFGEIALLLDRPRAATVVAKGPLKCVKLDRARFERVLGPCADILKRNITQYNSFVSLSV
*******************************SARRRGGISAEPVSEEDATSYVKKVVPKDYKTMAALSKAIAKNVLFSHLDENTRSDIFDAMFPVNCLPGESIITQGDEGDNFYVIDQGEVEVYVNNELVTSVGEGGSFGELALIYGTPRAATVRAKTDVKLWGLDRDSYRRILMGSTIRKRKLYEEFLSRVSILESLEKWERLTVADSLEPVSFQDKEAIVRQGQPGDDFYIIVEGTALVLQNTVEEESPVEVGKLGPSDYFGEIALLLDRPRAATVVAKGPLKCVKLDRARFERVLGPCADILKRNITQYNSFVSLS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFQEQAHDAKLKATSPEETEDLSPLPSQGQQSARRRGGISAEPVSEEDATSYVKKVVPKDYKTMAALSKAIAKNVLFSHLDENTRSDIFDAMFPVNCLPGESIITQGDEGDNFYVIDQGEVEVYVNNELVTSVGEGGSFGELALIYGTPRAATVRAKTDVKLWGLDRDSYRRILMGSTIRKRKLYEEFLSRVSILESLEKWERLTVADSLEPVSFQDKEAIVRQGQPGDDFYIIVEGTALVLQNTVEEESPVEVGKLGPSDYFGEIALLLDRPRAATVVAKGPLKCVKLDRARFERVLGPCADILKRNITQYNSFVSLSV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query320 2.2.26 [Sep-21-2011]
P16905376 cAMP-dependent protein ki no N/A 0.978 0.832 0.817 1e-149
P31319378 cAMP-dependent protein ki N/A N/A 0.993 0.841 0.774 1e-144
P09456381 cAMP-dependent protein ki yes N/A 0.959 0.805 0.775 1e-139
Q9DBC7381 cAMP-dependent protein ki yes N/A 0.959 0.805 0.775 1e-139
P00514380 cAMP-dependent protein ki yes N/A 0.946 0.797 0.778 1e-138
P07802380 cAMP-dependent protein ki yes N/A 0.946 0.797 0.778 1e-138
Q5REL1381 cAMP-dependent protein ki yes N/A 0.959 0.805 0.768 1e-137
P10644381 cAMP-dependent protein ki yes N/A 0.959 0.805 0.768 1e-137
P81377381 cAMP-dependent protein ki no N/A 0.940 0.790 0.774 1e-137
P12849381 cAMP-dependent protein ki no N/A 0.940 0.790 0.774 1e-136
>sp|P16905|KAPR1_DROME cAMP-dependent protein kinase type I regulatory subunit OS=Drosophila melanogaster GN=Pka-R1 PE=2 SV=2 Back     alignment and function desciption
 Score =  528 bits (1361), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 256/313 (81%), Positives = 279/313 (89%)

Query: 8   DAKLKATSPEETEDLSPLPSQGQQSARRRGGISAEPVSEEDATSYVKKVVPKDYKTMAAL 67
           DA  +  SP++ EDLSP+P       RRRGGISAEPV+EEDAT+YVKKVVPKDYKTM AL
Sbjct: 64  DASRQVISPDDCEDLSPMPQTAAPPVRRRGGISAEPVTEEDATNYVKKVVPKDYKTMNAL 123

Query: 68  SKAIAKNVLFSHLDENTRSDIFDAMFPVNCLPGESIITQGDEGDNFYVIDQGEVEVYVNN 127
           SKAIAKNVLF+HLDE+ RSDIFDAMFPVN + GE+II QGDEGDNFYVID GEV+V+VN+
Sbjct: 124 SKAIAKNVLFAHLDESERSDIFDAMFPVNHIAGENIIQQGDEGDNFYVIDVGEVDVFVNS 183

Query: 128 ELVTSVGEGGSFGELALIYGTPRAATVRAKTDVKLWGLDRDSYRRILMGSTIRKRKLYEE 187
           ELVT++ EGGSFGELALIYGTPRAATVRAKTDVKLWG+DRDSYRRILMGSTIRKRK+YEE
Sbjct: 184 ELVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEE 243

Query: 188 FLSRVSILESLEKWERLTVADSLEPVSFQDKEAIVRQGQPGDDFYIIVEGTALVLQNTVE 247
           FLSRVSILESL+KWERLTVADSLE  SF D E IV+QG  GDDFYII+EG A+VLQ   E
Sbjct: 244 FLSRVSILESLDKWERLTVADSLETCSFDDGETIVKQGAAGDDFYIILEGCAVVLQQRSE 303

Query: 248 EESPVEVGKLGPSDYFGEIALLLDRPRAATVVAKGPLKCVKLDRARFERVLGPCADILKR 307
            E P EVG+LG SDYFGEIALLLDRPRAATVVA+GPLKCVKLDRARFERVLGPCADILKR
Sbjct: 304 GEDPAEVGRLGSSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPCADILKR 363

Query: 308 NITQYNSFVSLSV 320
           NITQYNSFVSLSV
Sbjct: 364 NITQYNSFVSLSV 376

Drosophila melanogaster (taxid: 7227)
>sp|P31319|KAPR_APLCA cAMP-dependent protein kinase regulatory subunit OS=Aplysia californica PE=2 SV=2 Back     alignment and function description
>sp|P09456|KAP0_RAT cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Rattus norvegicus GN=Prkar1a PE=2 SV=2 Back     alignment and function description
>sp|Q9DBC7|KAP0_MOUSE cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Mus musculus GN=Prkar1a PE=1 SV=3 Back     alignment and function description
>sp|P00514|KAP0_BOVIN cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Bos taurus GN=PRKAR1A PE=1 SV=2 Back     alignment and function description
>sp|P07802|KAP0_PIG cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Sus scrofa GN=PRKAR1A PE=1 SV=2 Back     alignment and function description
>sp|Q5REL1|KAP0_PONAB cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Pongo abelii GN=PRKAR1A PE=2 SV=2 Back     alignment and function description
>sp|P10644|KAP0_HUMAN cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Homo sapiens GN=PRKAR1A PE=1 SV=1 Back     alignment and function description
>sp|P81377|KAP1_RAT cAMP-dependent protein kinase type I-beta regulatory subunit OS=Rattus norvegicus GN=Prkar1b PE=2 SV=2 Back     alignment and function description
>sp|P12849|KAP1_MOUSE cAMP-dependent protein kinase type I-beta regulatory subunit OS=Mus musculus GN=Prkar1b PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query320
189235535372 PREDICTED: similar to AGAP006448-PB [Tri 0.993 0.854 0.877 1e-162
383864374372 PREDICTED: cAMP-dependent protein kinase 0.990 0.852 0.865 1e-157
48106841372 PREDICTED: cAMP-dependent protein kinase 0.990 0.852 0.862 1e-157
307180059372 cAMP-dependent protein kinase type I reg 0.990 0.852 0.858 1e-157
332021487372 cAMP-dependent protein kinase type I reg 0.990 0.852 0.858 1e-156
340717935372 PREDICTED: cAMP-dependent protein kinase 0.990 0.852 0.858 1e-156
289740607349 CAMP-dependent protein kinase [Glossina 0.978 0.896 0.840 1e-153
157127765334 camp-dependent protein kinase type i-bet 0.990 0.949 0.839 1e-152
158295858373 AGAP006448-PB [Anopheles gambiae str. PE 0.993 0.852 0.824 1e-151
347965228 516 AGAP006448-PD [Anopheles gambiae str. PE 0.993 0.616 0.824 1e-150
>gi|189235535|ref|XP_972604.2| PREDICTED: similar to AGAP006448-PB [Tribolium castaneum] gi|270003022|gb|EEZ99469.1| hypothetical protein TcasGA2_TC000040 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  577 bits (1487), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 279/318 (87%), Positives = 297/318 (93%)

Query: 3   QEQAHDAKLKATSPEETEDLSPLPSQGQQSARRRGGISAEPVSEEDATSYVKKVVPKDYK 62
           +EQA DAK + TSPE+TEDLSPLP+  QQ  RRRGGISAEPVSEEDATSYVKKVVPKDYK
Sbjct: 55  REQALDAKQQVTSPEDTEDLSPLPTHTQQPVRRRGGISAEPVSEEDATSYVKKVVPKDYK 114

Query: 63  TMAALSKAIAKNVLFSHLDENTRSDIFDAMFPVNCLPGESIITQGDEGDNFYVIDQGEVE 122
           TMAALSKAIAKNVLFSHLDEN RSDIFDAMFPV CLPGE+II QGDEGDNFYVIDQGEVE
Sbjct: 115 TMAALSKAIAKNVLFSHLDENERSDIFDAMFPVTCLPGEAIIQQGDEGDNFYVIDQGEVE 174

Query: 123 VYVNNELVTSVGEGGSFGELALIYGTPRAATVRAKTDVKLWGLDRDSYRRILMGSTIRKR 182
           VYVNNELVT++G+GGSFGELALIYGTPRAATV+AKTDVKLWG+DRDSYRRILMGSTIRKR
Sbjct: 175 VYVNNELVTTIGDGGSFGELALIYGTPRAATVKAKTDVKLWGIDRDSYRRILMGSTIRKR 234

Query: 183 KLYEEFLSRVSILESLEKWERLTVADSLEPVSFQDKEAIVRQGQPGDDFYIIVEGTALVL 242
           K+YEEFLSRVSILE+L+KWERLTVAD+LEPV F+D E IVRQG+PGDDFYIIVEGTA+V 
Sbjct: 235 KMYEEFLSRVSILENLDKWERLTVADALEPVGFEDGETIVRQGEPGDDFYIIVEGTAIVK 294

Query: 243 QNTVEEESPVEVGKLGPSDYFGEIALLLDRPRAATVVAKGPLKCVKLDRARFERVLGPCA 302
           QN  E E P EVG+LGPSDYFGEIALLLDRPRAATVVA GPLKCVKLDRARFERVLG CA
Sbjct: 295 QNRAEGEEPTEVGRLGPSDYFGEIALLLDRPRAATVVACGPLKCVKLDRARFERVLGLCA 354

Query: 303 DILKRNITQYNSFVSLSV 320
           DILKRNITQYNSFVSLSV
Sbjct: 355 DILKRNITQYNSFVSLSV 372

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383864374|ref|XP_003707654.1| PREDICTED: cAMP-dependent protein kinase type I regulatory subunit-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|48106841|ref|XP_396167.1| PREDICTED: cAMP-dependent protein kinase type I regulatory subunit isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|307180059|gb|EFN68135.1| cAMP-dependent protein kinase type I regulatory subunit [Camponotus floridanus] gi|307193131|gb|EFN76048.1| cAMP-dependent protein kinase type I regulatory subunit [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332021487|gb|EGI61852.1| cAMP-dependent protein kinase type I regulatory subunit [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340717935|ref|XP_003397429.1| PREDICTED: cAMP-dependent protein kinase type I regulatory subunit-like [Bombus terrestris] gi|350400345|ref|XP_003485804.1| PREDICTED: cAMP-dependent protein kinase type I regulatory subunit-like [Bombus impatiens] gi|380012519|ref|XP_003690327.1| PREDICTED: cAMP-dependent protein kinase type I regulatory subunit-like [Apis florea] Back     alignment and taxonomy information
>gi|289740607|gb|ADD19051.1| CAMP-dependent protein kinase [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|157127765|ref|XP_001661170.1| camp-dependent protein kinase type i-beta regulatory subunit [Aedes aegypti] gi|108882344|gb|EAT46569.1| AAEL002277-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|158295858|ref|XP_001688871.1| AGAP006448-PB [Anopheles gambiae str. PEST] gi|157016234|gb|EDO63877.1| AGAP006448-PB [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|347965228|ref|XP_003435733.1| AGAP006448-PD [Anopheles gambiae str. PEST] gi|333469391|gb|EGK97285.1| AGAP006448-PD [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query320
FB|FBgn0259243376 Pka-R1 "cAMP-dependent protein 0.993 0.845 0.808 1.4e-133
MGI|MGI:104878381 Prkar1a "protein kinase, cAMP 0.959 0.805 0.775 5.5e-125
RGD|3391381 Prkar1a "protein kinase, cAMP- 0.959 0.805 0.775 5.5e-125
UNIPROTKB|E1C2U6381 PRKAR1B "Uncharacterized prote 0.975 0.818 0.752 1.1e-124
UNIPROTKB|F1RV23380 PRKAR1A "cAMP-dependent protei 0.971 0.818 0.759 1.5e-124
UNIPROTKB|E2QZV5515 PRKAR1A "Uncharacterized prote 0.971 0.603 0.766 1.9e-124
ZFIN|ZDB-GENE-060929-580380 prkar1b "protein kinase, cAMP- 0.975 0.821 0.752 1.9e-124
UNIPROTKB|P00514380 PRKAR1A "cAMP-dependent protei 0.962 0.810 0.770 3e-124
UNIPROTKB|P07802380 PRKAR1A "cAMP-dependent protei 0.971 0.818 0.759 4.9e-124
UNIPROTKB|F1Q3L1420 PRKAR1B "Uncharacterized prote 0.993 0.757 0.736 8e-124
FB|FBgn0259243 Pka-R1 "cAMP-dependent protein kinase R1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1309 (465.8 bits), Expect = 1.4e-133, P = 1.4e-133
 Identities = 258/319 (80%), Positives = 282/319 (88%)

Query:     3 QEQAH-DAKLKATSPEETEDLSPLPSQGQQSARRRGGISAEPVSEEDATSYVKKVVPKDY 61
             +EQ   DA  +  SP++ EDLSP+P       RRRGGISAEPV+EEDAT+YVKKVVPKDY
Sbjct:    58 REQVKLDASRQVISPDDCEDLSPMPQTAAPPVRRRGGISAEPVTEEDATNYVKKVVPKDY 117

Query:    62 KTMAALSKAIAKNVLFSHLDENTRSDIFDAMFPVNCLPGESIITQGDEGDNFYVIDQGEV 121
             KTM ALSKAIAKNVLF+HLDE+ RSDIFDAMFPVN + GE+II QGDEGDNFYVID GEV
Sbjct:   118 KTMNALSKAIAKNVLFAHLDESERSDIFDAMFPVNHIAGENIIQQGDEGDNFYVIDVGEV 177

Query:   122 EVYVNNELVTSVGEGGSFGELALIYGTPRAATVRAKTDVKLWGLDRDSYRRILMGSTIRK 181
             +V+VN+ELVT++ EGGSFGELALIYGTPRAATVRAKTDVKLWG+DRDSYRRILMGSTIRK
Sbjct:   178 DVFVNSELVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRK 237

Query:   182 RKLYEEFLSRVSILESLEKWERLTVADSLEPVSFQDKEAIVRQGQPGDDFYIIVEGTALV 241
             RK+YEEFLSRVSILESL+KWERLTVADSLE  SF D E IV+QG  GDDFYII+EG A+V
Sbjct:   238 RKMYEEFLSRVSILESLDKWERLTVADSLETCSFDDGETIVKQGAAGDDFYIILEGCAVV 297

Query:   242 LQNTVEEESPVEVGKLGPSDYFGEIALLLDRPRAATVVAKGPLKCVKLDRARFERVLGPC 301
             LQ   E E P EVG+LG SDYFGEIALLLDRPRAATVVA+GPLKCVKLDRARFERVLGPC
Sbjct:   298 LQQRSEGEDPAEVGRLGSSDYFGEIALLLDRPRAATVVARGPLKCVKLDRARFERVLGPC 357

Query:   302 ADILKRNITQYNSFVSLSV 320
             ADILKRNITQYNSFVSLSV
Sbjct:   358 ADILKRNITQYNSFVSLSV 376
GO:0008603 "cAMP-dependent protein kinase regulator activity" evidence=ISS;NAS;IMP
GO:0005952 "cAMP-dependent protein kinase complex" evidence=IEA;ISS
GO:0008355 "olfactory learning" evidence=NAS;IMP
GO:0030551 "cyclic nucleotide binding" evidence=NAS
GO:0007015 "actin filament organization" evidence=IMP
GO:0008103 "oocyte microtubule cytoskeleton polarization" evidence=IMP
GO:0007591 "molting cycle, chitin-based cuticle" evidence=IMP
GO:0019933 "cAMP-mediated signaling" evidence=NAS
GO:0007165 "signal transduction" evidence=IEA
GO:0001932 "regulation of protein phosphorylation" evidence=IEA
GO:0007274 "neuromuscular synaptic transmission" evidence=IMP
GO:0045471 "response to ethanol" evidence=IDA
MGI|MGI:104878 Prkar1a "protein kinase, cAMP dependent regulatory, type I, alpha" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|3391 Prkar1a "protein kinase, cAMP-dependent, regulatory, type I, alpha" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C2U6 PRKAR1B "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RV23 PRKAR1A "cAMP-dependent protein kinase type I-alpha regulatory subunit" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZV5 PRKAR1A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060929-580 prkar1b "protein kinase, cAMP-dependent, regulatory, type I, beta" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P00514 PRKAR1A "cAMP-dependent protein kinase type I-alpha regulatory subunit" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P07802 PRKAR1A "cAMP-dependent protein kinase type I-alpha regulatory subunit" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q3L1 PRKAR1B "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P07802KAP0_PIGNo assigned EC number0.77880.94680.7973yesN/A
Q9DBC7KAP0_MOUSENo assigned EC number0.77520.95930.8057yesN/A
P31321KAP1_HUMANNo assigned EC number0.750.97180.8162noN/A
P00514KAP0_BOVINNo assigned EC number0.77880.94680.7973yesN/A
Q6CPK7KAPR_KLULANo assigned EC number0.40620.88120.6051yesN/A
P16905KAPR1_DROMENo assigned EC number0.81780.97810.8324noN/A
P81377KAP1_RATNo assigned EC number0.77480.94060.7900noN/A
P36600KAPR_SCHPONo assigned EC number0.36890.83430.6480yesN/A
Q6FQL6KAPR_CANGANo assigned EC number0.40330.88430.7004yesN/A
P09456KAP0_RATNo assigned EC number0.77520.95930.8057yesN/A
O59922KAPR_EMENINo assigned EC number0.42080.85310.6626yesN/A
Q9C196KAPR_ASPNGNo assigned EC number0.41580.83430.6496yesN/A
P07278KAPR_YEASTNo assigned EC number0.39650.85620.6586yesN/A
P10644KAP0_HUMANNo assigned EC number0.76870.95930.8057yesN/A
P30625KAPR_CAEELNo assigned EC number0.62620.90.7868yesN/A
P31319KAPR_APLCANo assigned EC number0.77460.99370.8412N/AN/A
P12849KAP1_MOUSENo assigned EC number0.77480.94060.7900noN/A
Q5ZM91KAP0_CHICKNo assigned EC number0.76560.94060.7879noN/A
Q75AM2KAPR_ASHGONo assigned EC number0.37060.86870.6069yesN/A
P05987KAPR_DICDINo assigned EC number0.56010.88120.8623yesN/A
Q96UX3KAPR_ASPFUNo assigned EC number0.41030.83750.6489yesN/A
Q6C2X0KAPR_YARLINo assigned EC number0.39280.93750.8yesN/A
Q5REL1KAP0_PONABNo assigned EC number0.76870.95930.8057yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query320
cd00038115 cd00038, CAP_ED, effector domain of the CAP family 5e-31
cd00038115 cd00038, CAP_ED, effector domain of the CAP family 3e-30
smart00100120 smart00100, cNMP, Cyclic nucleotide-monophosphate 2e-26
smart00100120 smart00100, cNMP, Cyclic nucleotide-monophosphate 9e-26
pfam0002791 pfam00027, cNMP_binding, Cyclic nucleotide-binding 8e-20
pfam0002791 pfam00027, cNMP_binding, Cyclic nucleotide-binding 3e-19
COG0664214 COG0664, Crp, cAMP-binding proteins - catabolite g 1e-15
COG0664214 COG0664, Crp, cAMP-binding proteins - catabolite g 2e-15
PLN02868 413 PLN02868, PLN02868, acyl-CoA thioesterase family p 4e-08
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 3e-05
PRK11753211 PRK11753, PRK11753, DNA-binding transcriptional du 1e-04
PRK11753211 PRK11753, PRK11753, DNA-binding transcriptional du 2e-04
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 9e-04
TIGR03896 317 TIGR03896, cyc_nuc_ocin, bacteriocin-type transpor 9e-04
>gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information 
 Score =  112 bits (283), Expect = 5e-31
 Identities = 48/115 (41%), Positives = 64/115 (55%), Gaps = 5/115 (4%)

Query: 76  LFSHLDENTRSDIFDAMFPVNCLPGESIITQGDEGDNFYVIDQGEVEVYVNNE-----LV 130
           LFS LD+    ++ DA+       GE II QGD  D+ Y++  G VEVY  +E     +V
Sbjct: 1   LFSGLDDEELEELADALEERRFPAGEVIIRQGDPADSLYIVLSGSVEVYKLDEDGREQIV 60

Query: 131 TSVGEGGSFGELALIYGTPRAATVRAKTDVKLWGLDRDSYRRILMGSTIRKRKLY 185
             +G G  FGELAL+   PR+ATVRA TD +L  L R  +RR+L       R+L 
Sbjct: 61  GFLGPGDLFGELALLGNGPRSATVRALTDSELLVLPRSDFRRLLQEYPELARRLL 115

In all cases binding of the effector leads to conformational changes and the ability to activate transcription. Cyclic nucleotide-binding domain similar to CAP are also present in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) and vertebrate cyclic nucleotide-gated ion-channels. Cyclic nucleotide-monophosphate binding domain; proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues; the best studied is the prokaryotic catabolite gene activator, CAP, where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure; three conserved glycine residues are thought to be essential for maintenance of the structural integrity of the beta-barrel; CooA is a homodimeric transcription factor that belongs to CAP family; cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain; cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain; cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section; also found in vertebrate cyclic nucleotide-gated ion-channels. Length = 115
>gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>gnl|CDD|215664 pfam00027, cNMP_binding, Cyclic nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|215664 pfam00027, cNMP_binding, Cyclic nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|223736 COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|223736 COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|178459 PLN02868, PLN02868, acyl-CoA thioesterase family protein Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|236969 PRK11753, PRK11753, DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>gnl|CDD|236969 PRK11753, PRK11753, DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|234384 TIGR03896, cyc_nuc_ocin, bacteriocin-type transport-associated protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 320
KOG1113|consensus368 100.0
KOG0614|consensus 732 100.0
KOG2968|consensus 1158 99.82
PRK09392236 ftrB transcriptional activator FtrB; Provisional 99.72
KOG1113|consensus 368 99.69
PRK09392236 ftrB transcriptional activator FtrB; Provisional 99.67
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.67
KOG0498|consensus727 99.66
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 99.64
cd00038115 CAP_ED effector domain of the CAP family of transc 99.64
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 99.62
cd00038115 CAP_ED effector domain of the CAP family of transc 99.62
KOG0614|consensus 732 99.61
PRK11753211 DNA-binding transcriptional dual regulator Crp; Pr 99.6
smart00100120 cNMP Cyclic nucleotide-monophosphate binding domai 99.59
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.59
KOG0500|consensus536 99.57
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 99.57
smart00100120 cNMP Cyclic nucleotide-monophosphate binding domai 99.56
KOG0498|consensus 727 99.56
COG2905 610 Predicted signal-transduction protein containing c 99.56
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 99.55
COG0664214 Crp cAMP-binding proteins - catabolite gene activa 99.55
COG0664214 Crp cAMP-binding proteins - catabolite gene activa 99.55
KOG0500|consensus536 99.53
PLN02868 413 acyl-CoA thioesterase family protein 99.52
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 99.51
PRK11161235 fumarate/nitrate reduction transcriptional regulat 99.5
PRK11161235 fumarate/nitrate reduction transcriptional regulat 99.5
KOG3542|consensus 1283 99.47
KOG0499|consensus815 99.46
PLN02868 413 acyl-CoA thioesterase family protein 99.42
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 99.41
PRK09391230 fixK transcriptional regulator FixK; Provisional 99.41
KOG2968|consensus 1158 99.35
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 99.33
KOG0499|consensus 815 99.31
TIGR03697193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 99.29
PRK09391230 fixK transcriptional regulator FixK; Provisional 99.29
KOG3542|consensus 1283 99.27
COG2905 610 Predicted signal-transduction protein containing c 99.25
PRK13918202 CRP/FNR family transcriptional regulator; Provisio 99.22
KOG0501|consensus 971 99.05
KOG0501|consensus 971 98.33
PF04831153 Popeye: Popeye protein conserved region; InterPro: 98.28
PRK11832207 putative DNA-binding transcriptional regulator; Pr 97.91
PRK11832207 putative DNA-binding transcriptional regulator; Pr 97.47
PF04831153 Popeye: Popeye protein conserved region; InterPro: 96.51
PRK11171266 hypothetical protein; Provisional 94.04
PRK13290125 ectC L-ectoine synthase; Reviewed 92.79
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 92.18
KOG2378|consensus 573 90.81
TIGR03214260 ura-cupin putative allantoin catabolism protein. T 88.77
PF0589974 Cupin_3: Protein of unknown function (DUF861); Int 86.31
KOG2378|consensus 573 86.23
COG0662127 {ManC} Mannose-6-phosphate isomerase [Carbohydrate 86.19
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 84.94
COG3718270 IolB Uncharacterized enzyme involved in inositol m 84.7
TIGR03037159 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase 83.78
COG1917131 Uncharacterized conserved protein, contains double 82.18
PRK13290125 ectC L-ectoine synthase; Reviewed 82.1
>KOG1113|consensus Back     alignment and domain information 
Probab=100.00  E-value=8.1e-52  Score=346.25  Aligned_cols=284  Identities=57%  Similarity=0.909  Sum_probs=272.8

Q ss_pred             CCCccceeEeeccCCCcccccccccccCCCHHHHHHHHHHHhcCccCCCCCHHHHHHHHhcceeEEeCCCCeEEecCCCC
Q psy18137         31 QSARRRGGISAEPVSEEDATSYVKKVVPKDYKTMAALSKAIAKNVLFSHLDENTRSDIFDAMFPVNCLPGESIITQGDEG  110 (320)
Q Consensus        31 ~~~~r~~~is~e~~~~~~~~~~~~~~~~k~~~~~~~i~~~l~~~~~f~~l~~~~~~~l~~~~~~~~~~~g~~I~~~G~~~  110 (320)
                      ....||++||+|.+.+.. ..+....+||++++++.+.++++++.+|.+|+++++..+..+|..+.+++|+.|++||+.+
T Consensus        85 ~~~~RRssV~aE~~tp~~-d~~~~~~~pKd~e~~~~L~~a~r~~~LF~~Ld~eq~~~v~dam~~~~v~~G~~Vi~qGdeG  163 (368)
T KOG1113|consen   85 VLFVRRSSVSAEEITPDD-DEFKRKYIPKDDETRRRLEEAFRKNLLFANLDDEQLSQVLDAMFEKRVKAGETVIKQGDEG  163 (368)
T ss_pred             ccccccceeeeeecCccc-hhhhhcCCCCCHHHHHHHHHHHHhccccccCCHHHHHHHHHhhceeeecCCcEEEecCCcC
Confidence            344899999999999877 7788899999999999999999999999999999999999999999999999999999999


Q ss_pred             CeEEEEEeeEEEEEEcCEEEEecCCCCeeehhhhhcCCCcceEEeeeceEEEEEEchhhHHHHhhhhhHHHhhHHHHHhh
Q psy18137        111 DNFYVIDQGEVEVYVNNELVTSVGEGGSFGELALIYGTPRAATVRAKTDVKLWGLDRDSYRRILMGSTIRKRKLYEEFLS  190 (320)
Q Consensus       111 ~~~yiI~~G~v~v~~~~~~~~~~~~G~~fGe~~ll~~~~~~~tv~a~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~l~  190 (320)
                      ++||||-+|+++|++++..+..+.+|.+|||++|+++.||++|+.|.+++.+|.|++.+|++++..+....+.++..+++
T Consensus       164 d~fYvI~kGt~dVyv~~~~v~~~~~g~sFGElALmyn~PRaATv~a~t~~klWgldr~SFrrIi~~s~~kkrkMy~~~l~  243 (368)
T KOG1113|consen  164 DNFYVIDKGTFDVYVNGTYVTTYSPGGSFGELALMYNPPRAATVVAKSLKKLWGLDRTSFRRIIMKSCIKKRKMYEPFLE  243 (368)
T ss_pred             CcEEEEecceEEEEECCeEEeeeCCCCchhhhHhhhCCCcccceeeccccceEEEeeceeEEEeeccchhhhhhhhhhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhcccCcHHHHhhhhcccceeEeCCCCeEEccCCCCCeEEEEEecEEEEEEeccCCCccEEEEEeCCCCeecHHhHhc
Q psy18137        191 RVSILESLEKWERLTVADSLEPVSFQDKEAIVRQGQPGDDFYIIVEGTALVLQNTVEEESPVEVGKLGPSDYFGEIALLL  270 (320)
Q Consensus       191 ~~~~~~~l~~~~~~~l~~~~~~~~~~~g~~I~~~g~~~~~~yiI~~G~v~v~~~~~~~~~~~~~~~l~~G~~fGe~~ll~  270 (320)
                      .+|++..+...++.++++.+..+.|.+|+.|+.+|+.++.||+|.+|+|.+.+..  ++  +.+ .++.|++|||.+++.
T Consensus       244 s~pil~~l~k~er~kv~dal~~k~y~~G~~Vi~qg~~ge~f~~i~eGEvdv~~~~--~~--v~v-kl~~~dyfge~al~~  318 (368)
T KOG1113|consen  244 SVPILESLEKLERAKVADALGTKSYKDGERVIVQGDQGEHFYIIEEGEVDVLKKR--DG--VEV-KLKKGDYFGELALLK  318 (368)
T ss_pred             cchhhHHHHHHHHHhhhcccceeeccCCceEEeccCCcceEEEecccccchhhcc--CC--eEE-EechhhhcchHHHHh
Confidence            9999999999999999999999999999999999999999999999999998665  22  566 899999999999999


Q ss_pred             CCCceeEEEEecCeEEEEEehHHHHHhhcCHHHHHHHHHHhhhhcccccC
Q psy18137        271 DRPRAATVVAKGPLKCVKLDRARFERVLGPCADILKRNITQYNSFVSLSV  320 (320)
Q Consensus       271 ~~~~~~tv~a~~~~~v~~i~~~~f~~ll~~~~~~~~~~~~~~~~~~~~~~  320 (320)
                      +.||.++|.|..+..|+++++..|.+++++..++|+|++..|+.++.+++
T Consensus       319 ~~pr~Atv~a~~~~kc~~~dk~~ferllgpc~dilkr~~~~y~~~v~l~~  368 (368)
T KOG1113|consen  319 NLPRAATVVAKGRLKCAKLDKPRFERLLGPCQDILKRNRSTYNSYVKLSL  368 (368)
T ss_pred             hchhhceeeccCCceeeeeChHHHHHHhhHHHHHHHhhhhhccccccccC
Confidence            99999999999999999999999999999999999999999999887764

>KOG0614|consensus Back     alignment and domain information
>KOG2968|consensus Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>KOG1113|consensus Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>smart00100 cNMP Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0500|consensus Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>smart00100 cNMP Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>KOG0500|consensus Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>KOG0499|consensus Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>KOG2968|consensus Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>KOG0499|consensus Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>KOG0501|consensus Back     alignment and domain information
>KOG0501|consensus Back     alignment and domain information
>PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle Back     alignment and domain information
>PRK11832 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PRK11832 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle Back     alignment and domain information
>PRK11171 hypothetical protein; Provisional Back     alignment and domain information
>PRK13290 ectC L-ectoine synthase; Reviewed Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>KOG2378|consensus Back     alignment and domain information
>TIGR03214 ura-cupin putative allantoin catabolism protein Back     alignment and domain information
>PF05899 Cupin_3: Protein of unknown function (DUF861); InterPro: IPR008579 The function of the proteins in this entry are unknown Back     alignment and domain information
>KOG2378|consensus Back     alignment and domain information
>COG0662 {ManC} Mannose-6-phosphate isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>COG3718 IolB Uncharacterized enzyme involved in inositol metabolism [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03037 anthran_nbaC 3-hydroxyanthranilate 3,4-dioxygenase Back     alignment and domain information
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PRK13290 ectC L-ectoine synthase; Reviewed Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query320
1rl3_A288 Crystal Structure Of Camp-free R1a Subunit Of Pka L 1e-139
2qcs_B291 A Complex Structure Between The Catalytic And Regul 1e-138
4din_B381 Novel Localization And Quaternary Structure Of The 1e-137
1ne4_A283 Crystal Structure Of Rp-Camp Binding R1a Subunit Of 1e-136
3fhi_B154 Crystal Structure Of A Complex Between The Catalyti 1e-72
3fhi_B154 Crystal Structure Of A Complex Between The Catalyti 1e-12
3pvb_B160 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 2e-71
3pvb_B160 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 2e-12
3tnp_B416 Structure And Allostery Of The Pka Riib Tetrameric 2e-57
3tnq_A416 Structure And Allostery Of The Pka Riib Tetrameric 3e-57
1cx4_A305 Crystal Structure Of A Deletion Mutant Of The Type 4e-57
2qvs_B310 Crystal Structure Of Type Iia Holoenzyme Of Camp-De 2e-56
3of1_A246 Crystal Structure Of Bcy1, The Yeast Regulatory Sub 6e-54
3shr_A299 Crystal Structure Of Cgmp-Dependent Protein Kinase 3e-37
3idb_B161 Crystal Structure Of (108-268)riib:c Holoenzyme Of 4e-29
3idb_B161 Crystal Structure Of (108-268)riib:c Holoenzyme Of 2e-09
3idc_B164 Crystal Structure Of (102-265)riib:c Holoenzyme Of 9e-28
3idc_B164 Crystal Structure Of (102-265)riib:c Holoenzyme Of 2e-09
3ocp_A139 Crystal Structure Of Camp Bound Cgmp-Dependent Prot 7e-17
3ocp_A139 Crystal Structure Of Camp Bound Cgmp-Dependent Prot 7e-06
3d0s_A227 Camp Receptor Protein From M.Tuberculosis, Camp-Fre 2e-08
3i54_A249 Crystal Structure Of Mtbcrp In Complex With Camp Le 2e-08
3u11_A210 Tetramerization Dynamics Of The C-Terminus Underlie 2e-08
3mzh_A225 Crystal Structure Of Camp Receptor Protein From Myc 2e-08
3h3u_A224 Crystal Structure Of Crp (Camp Receptor Protein) Fr 2e-08
3otf_A220 Structural Basis For The Camp-Dependent Gating In H 3e-08
4hbn_A205 Crystal Structure Of The Human Hcn4 Channel C-termi 4e-08
3cf6_E 694 Structure Of Epac2 In Complex With Cyclic-Amp And R 4e-08
2byv_E 999 Structure Of The Camp Responsive Exchange Factor Ep 5e-08
3beh_A355 Structure Of A Bacterial Cyclic Nucleotide Regulate 5e-08
3i59_A249 Crystal Structure Of Mtbcrp In Complex With N6-Camp 5e-08
1o7f_A469 Crystal Structure Of The Regulatory Domain Of Epac2 6e-08
3cl1_A140 M. Loti Cyclic-Nucleotide Binding Domain, Cyclic-Gm 7e-08
3cl1_A140 M. Loti Cyclic-Nucleotide Binding Domain, Cyclic-Gm 1e-07
1u12_A138 M. Loti Cyclic Nucleotide Binding Domain Mutant Len 7e-08
1u12_A138 M. Loti Cyclic Nucleotide Binding Domain Mutant Len 1e-07
1vp6_A138 M.Loti Ion Channel Cylic Nucleotide Binding Domain 7e-08
1vp6_A138 M.Loti Ion Channel Cylic Nucleotide Binding Domain 1e-07
2k0g_A142 Solution Structure Of A Bacterial Cyclic Nucleotide 8e-08
2k0g_A142 Solution Structure Of A Bacterial Cyclic Nucleotide 1e-07
3u10_A210 Tetramerization Dynamics Of The C-Terminus Underlie 2e-07
3bpz_A202 Hcn2-I 443-460 E502k In The Presence Of Camp Length 2e-07
1q3e_A207 Hcn2j 443-645 In The Presence Of Cgmp Length = 207 2e-07
3ffq_A202 Hcn2i 443-640 Apo-State Length = 202 2e-07
2q0a_A200 Structure And Rearrangements In The Carboxy-Termina 3e-07
4f7z_A 999 Conformational Dynamics Of Exchange Protein Directl 3e-07
3etq_A204 X-Ray Structure Of Cysteine-Free Fragment Of Mhcn2 3e-07
3clp_A140 M. Loti Cyclic-Nucleotide Binding Domain Mutant 2 L 4e-07
3clp_A140 M. Loti Cyclic-Nucleotide Binding Domain Mutant 2 L 7e-07
3co2_A140 Mlotik1 Ion Channel Cyclic-Nucleotide Binding Domai 7e-07
3co2_A140 Mlotik1 Ion Channel Cyclic-Nucleotide Binding Domai 8e-07
1q43_A207 Hcn2i 443-640 In The Presence Of Camp, Selenomethio 7e-07
3u0z_A210 Tetramerization Dynamics Of The C-Terminus Underlie 7e-07
3u0z_A210 Tetramerization Dynamics Of The C-Terminus Underlie 6e-04
2pqq_A149 Structural Genomics, The Crystal Structure Of The N 7e-07
2pqq_A149 Structural Genomics, The Crystal Structure Of The N 3e-04
2ptm_A198 Structure And Rearrangements In The Carboxy-Termina 3e-06
4avc_A 333 Crystal Structure Of Protein Lysine Acetyltransfera 6e-06
3r6s_A247 Crystal Structure Of Glxr Transcription Factor From 6e-06
4ava_A 333 Crystal Structure Of Protein Lysine Acetyltransfera 6e-06
4f8a_A160 Cyclic Nucleotide Binding-Homology Domain From Mous 5e-05
3e97_A231 Crystal Structure Of Transcriptional Regulator Of C 8e-04
>pdb|1RL3|A Chain A, Crystal Structure Of Camp-free R1a Subunit Of Pka Length = 288 Back     alignment and structure 
Iteration: 1

 Score =  489 bits (1258), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 232/287 (80%), Positives = 263/287 (91%)
Query: 34  RRRGGISAEPVSEEDATSYVKKVVPKDYKTMAALSKAIAKNVLFSHLDENTRSDIFDAMF 93
           RRRG ISAE  +EEDA SYV+KV+PKDYKTMAAL+KAI KNVLFSHLD+N RSDIFDAMF
Sbjct: 2   RRRGAISAEVYTEEDAASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMF 61
Query: 94  PVNCLPGESIITQGDEGDNFYVIDQGEVEVYVNNELVTSVGEGGSFGELALIYGTPRAAT 153
           PV+ + GE++I QGDEGDNFYVIDQGE++VYVNNE  TSVGEGGSFGELALIYGTPRAAT
Sbjct: 62  PVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAAT 121
Query: 154 VRAKTDVKLWGLDRDSYRRILMGSTIRKRKLYEEFLSRVSILESLEKWERLTVADSLEPV 213
           V+AKT+VKLWG+DRDSYRRILMGST+RKRK+YEEFLS+VSILESL+KWERLTVAD+LEPV
Sbjct: 122 VKAKTNVKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPV 181
Query: 214 SFQDKEAIVRQGQPGDDFYIIVEGTALVLQNTVEEESPVEVGKLGPSDYFGEIALLLDRP 273
            F+D + IV QG+PGD+F+II+EG+A VLQ   E E  VEVG+LGPSDYFGEIALL++RP
Sbjct: 182 QFEDGQKIVVQGEPGDEFFIILEGSAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRP 241
Query: 274 RAATVVAKGPLKCVKLDRARFERVLGPCADILKRNITQYNSFVSLSV 320
           RAATVVA+GPLKCVKLDR RFERVLGPC+DILKRNI QYNSFVSLSV
Sbjct: 242 RAATVVARGPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFVSLSV 288
>pdb|2QCS|B Chain B, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 291 Back     alignment and structure
>pdb|4DIN|B Chain B, Novel Localization And Quaternary Structure Of The Pka Ri Beta Holoenzyme Length = 381 Back     alignment and structure
>pdb|1NE4|A Chain A, Crystal Structure Of Rp-Camp Binding R1a Subunit Of Camp- Dependent Protein Kinase Length = 283 Back     alignment and structure
>pdb|3FHI|B Chain B, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 154 Back     alignment and structure
>pdb|3FHI|B Chain B, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 154 Back     alignment and structure
>pdb|3PVB|B Chain B, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 160 Back     alignment and structure
>pdb|3PVB|B Chain B, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 160 Back     alignment and structure
>pdb|3TNP|B Chain B, Structure And Allostery Of The Pka Riib Tetrameric Holoenzyme Length = 416 Back     alignment and structure
>pdb|3TNQ|A Chain A, Structure And Allostery Of The Pka Riib Tetrameric Holoenzyme Length = 416 Back     alignment and structure
>pdb|1CX4|A Chain A, Crystal Structure Of A Deletion Mutant Of The Type Ii Beta Regulatory Subunit Of Camp-Dependent Protein Kinase Length = 305 Back     alignment and structure
>pdb|2QVS|B Chain B, Crystal Structure Of Type Iia Holoenzyme Of Camp-Dependent Protein Kinase Length = 310 Back     alignment and structure
>pdb|3OF1|A Chain A, Crystal Structure Of Bcy1, The Yeast Regulatory Subunit Of Pka Length = 246 Back     alignment and structure
>pdb|3SHR|A Chain A, Crystal Structure Of Cgmp-Dependent Protein Kinase Reveals Novel Site Of Interchain Communication Length = 299 Back     alignment and structure
>pdb|3IDB|B Chain B, Crystal Structure Of (108-268)riib:c Holoenzyme Of Camp- Dependent Protein Kinase Length = 161 Back     alignment and structure
>pdb|3IDB|B Chain B, Crystal Structure Of (108-268)riib:c Holoenzyme Of Camp- Dependent Protein Kinase Length = 161 Back     alignment and structure
>pdb|3IDC|B Chain B, Crystal Structure Of (102-265)riib:c Holoenzyme Of Camp- Dependent Protein Kinase Length = 164 Back     alignment and structure
>pdb|3IDC|B Chain B, Crystal Structure Of (102-265)riib:c Holoenzyme Of Camp- Dependent Protein Kinase Length = 164 Back     alignment and structure
>pdb|3OCP|A Chain A, Crystal Structure Of Camp Bound Cgmp-Dependent Protein Kinase(92-227) Length = 139 Back     alignment and structure
>pdb|3OCP|A Chain A, Crystal Structure Of Camp Bound Cgmp-Dependent Protein Kinase(92-227) Length = 139 Back     alignment and structure
>pdb|3D0S|A Chain A, Camp Receptor Protein From M.Tuberculosis, Camp-Free Form Length = 227 Back     alignment and structure
>pdb|3I54|A Chain A, Crystal Structure Of Mtbcrp In Complex With Camp Length = 249 Back     alignment and structure
>pdb|3U11|A Chain A, Tetramerization Dynamics Of The C-Terminus Underlies Isoform-Specific Camp-Gating In Hcn Channels Length = 210 Back     alignment and structure
>pdb|3MZH|A Chain A, Crystal Structure Of Camp Receptor Protein From Mycobacterium Tuberculosis In Complex With Camp And Its Dna Binding Element Length = 225 Back     alignment and structure
>pdb|3H3U|A Chain A, Crystal Structure Of Crp (Camp Receptor Protein) From Mycoba Tuberculosis Length = 224 Back     alignment and structure
>pdb|3OTF|A Chain A, Structural Basis For The Camp-Dependent Gating In Human Hcn4 Channel Length = 220 Back     alignment and structure
>pdb|4HBN|A Chain A, Crystal Structure Of The Human Hcn4 Channel C-terminus Carrying The S672r Mutation Length = 205 Back     alignment and structure
>pdb|3CF6|E Chain E, Structure Of Epac2 In Complex With Cyclic-Amp And Rap Length = 694 Back     alignment and structure
>pdb|2BYV|E Chain E, Structure Of The Camp Responsive Exchange Factor Epac2 In Its Auto-Inhibited State Length = 999 Back     alignment and structure
>pdb|3BEH|A Chain A, Structure Of A Bacterial Cyclic Nucleotide Regulated Ion Channel Length = 355 Back     alignment and structure
>pdb|3I59|A Chain A, Crystal Structure Of Mtbcrp In Complex With N6-Camp Length = 249 Back     alignment and structure
>pdb|1O7F|A Chain A, Crystal Structure Of The Regulatory Domain Of Epac2 Length = 469 Back     alignment and structure
>pdb|3CL1|A Chain A, M. Loti Cyclic-Nucleotide Binding Domain, Cyclic-Gmp Bound Length = 140 Back     alignment and structure
>pdb|3CL1|A Chain A, M. Loti Cyclic-Nucleotide Binding Domain, Cyclic-Gmp Bound Length = 140 Back     alignment and structure
>pdb|1U12|A Chain A, M. Loti Cyclic Nucleotide Binding Domain Mutant Length = 138 Back     alignment and structure
>pdb|1U12|A Chain A, M. Loti Cyclic Nucleotide Binding Domain Mutant Length = 138 Back     alignment and structure
>pdb|1VP6|A Chain A, M.Loti Ion Channel Cylic Nucleotide Binding Domain Length = 138 Back     alignment and structure
>pdb|1VP6|A Chain A, M.Loti Ion Channel Cylic Nucleotide Binding Domain Length = 138 Back     alignment and structure
>pdb|2K0G|A Chain A, Solution Structure Of A Bacterial Cyclic Nucleotide- Activated K+ Channel Binding Domain In Complex With Camp Length = 142 Back     alignment and structure
>pdb|2K0G|A Chain A, Solution Structure Of A Bacterial Cyclic Nucleotide- Activated K+ Channel Binding Domain In Complex With Camp Length = 142 Back     alignment and structure
>pdb|3U10|A Chain A, Tetramerization Dynamics Of The C-Terminus Underlies Isoform-Specific Camp-Gating In Hcn Channels Length = 210 Back     alignment and structure
>pdb|3BPZ|A Chain A, Hcn2-I 443-460 E502k In The Presence Of Camp Length = 202 Back     alignment and structure
>pdb|1Q3E|A Chain A, Hcn2j 443-645 In The Presence Of Cgmp Length = 207 Back     alignment and structure
>pdb|3FFQ|A Chain A, Hcn2i 443-640 Apo-State Length = 202 Back     alignment and structure
>pdb|2Q0A|A Chain A, Structure And Rearrangements In The Carboxy-Terminal Region Of Spih Channels Length = 200 Back     alignment and structure
>pdb|4F7Z|A Chain A, Conformational Dynamics Of Exchange Protein Directly Activated By Camp Length = 999 Back     alignment and structure
>pdb|3ETQ|A Chain A, X-Ray Structure Of Cysteine-Free Fragment Of Mhcn2 C- Terminal Region From Amino Acids 443-630 Including C508n, C584s, And C601s Mutations Length = 204 Back     alignment and structure
>pdb|3CLP|A Chain A, M. Loti Cyclic-Nucleotide Binding Domain Mutant 2 Length = 140 Back     alignment and structure
>pdb|3CLP|A Chain A, M. Loti Cyclic-Nucleotide Binding Domain Mutant 2 Length = 140 Back     alignment and structure
>pdb|3CO2|A Chain A, Mlotik1 Ion Channel Cyclic-Nucleotide Binding Domain Mutant Length = 140 Back     alignment and structure
>pdb|3CO2|A Chain A, Mlotik1 Ion Channel Cyclic-Nucleotide Binding Domain Mutant Length = 140 Back     alignment and structure
>pdb|1Q43|A Chain A, Hcn2i 443-640 In The Presence Of Camp, Selenomethionine Derivative Length = 207 Back     alignment and structure
>pdb|3U0Z|A Chain A, Tetramerization Dynamics Of The C-Terminus Underlies Isoform-Specific Camp-Gating In Hcn Channels Length = 210 Back     alignment and structure
>pdb|3U0Z|A Chain A, Tetramerization Dynamics Of The C-Terminus Underlies Isoform-Specific Camp-Gating In Hcn Channels Length = 210 Back     alignment and structure
>pdb|2PQQ|A Chain A, Structural Genomics, The Crystal Structure Of The N-Terminal Domain Of A Transcriptional Regulator From Streptomyces Coelicolor A3(2) Length = 149 Back     alignment and structure
>pdb|2PQQ|A Chain A, Structural Genomics, The Crystal Structure Of The N-Terminal Domain Of A Transcriptional Regulator From Streptomyces Coelicolor A3(2) Length = 149 Back     alignment and structure
>pdb|2PTM|A Chain A, Structure And Rearrangements In The Carboxy-Terminal Region Of Spih Channels Length = 198 Back     alignment and structure
>pdb|4AVC|A Chain A, Crystal Structure Of Protein Lysine Acetyltransferase Rv0998 In Complex With Acetyl Coa And Camp Length = 333 Back     alignment and structure
>pdb|3R6S|A Chain A, Crystal Structure Of Glxr Transcription Factor From Corynebacterium Glutamicum With Camp Length = 247 Back     alignment and structure
>pdb|4AVA|A Chain A, Crystal Structure Of Protein Lysine Acetyltransferase Rv0998 From Mycobacterium Tuberculosis Length = 333 Back     alignment and structure
>pdb|4F8A|A Chain A, Cyclic Nucleotide Binding-Homology Domain From Mouse Eag1 Potassium Channel Length = 160 Back     alignment and structure
>pdb|3E97|A Chain A, Crystal Structure Of Transcriptional Regulator Of CrpFNR Family (Yp_604437.1) From Deinococcus Geothermalis Dsm 11300 At 1.86 A Resolution Length = 231 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query320
4din_B381 CAMP-dependent protein kinase type I-beta regulat 1e-122
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 1e-120
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 1e-111
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 3e-38
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 1e-109
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 2e-30
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 2e-30
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 1e-105
3of1_A 246 CAMP-dependent protein kinase regulatory subunit; 7e-26
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 2e-73
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 6e-38
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 3e-68
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 2e-38
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 7e-64
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 1e-31
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 1e-42
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 4e-32
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 5e-27
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 2e-24
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 3e-40
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 5e-34
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 6e-38
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 1e-27
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 3e-34
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 3e-32
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 4e-30
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 3e-28
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 5e-27
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 1e-26
2pqq_A149 Putative transcriptional regulator; APC7345, strep 1e-24
2pqq_A149 Putative transcriptional regulator; APC7345, strep 4e-24
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 8e-24
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 1e-20
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 1e-23
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 2e-20
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 2e-23
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 7e-19
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 1e-22
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 5e-21
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 3e-22
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 2e-21
3ukn_A212 Novel protein similar to vertebrate potassium VOL 6e-22
3ukn_A212 Novel protein similar to vertebrate potassium VOL 6e-15
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 8e-19
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 1e-17
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 1e-18
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 4e-18
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 2e-18
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 2e-18
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 3e-17
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 2e-16
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 3e-17
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 2e-15
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 4e-17
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 4e-14
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 1e-16
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 4e-16
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 8e-16
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 1e-15
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 1e-15
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 6e-15
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 2e-15
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 6e-13
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 2e-15
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 6e-11
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 4e-15
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 5e-13
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 8e-15
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 3e-11
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 2e-13
3e6c_C 250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 6e-11
2byv_E 999 RAP guanine nucleotide exchange factor 4; EPAC2, C 2e-13
2byv_E 999 RAP guanine nucleotide exchange factor 4; EPAC2, C 6e-13
2byv_E 999 RAP guanine nucleotide exchange factor 4; EPAC2, C 3e-08
2byv_E 999 RAP guanine nucleotide exchange factor 4; EPAC2, C 1e-06
1ft9_A222 Carbon monoxide oxidation system transcription reg 2e-13
1ft9_A222 Carbon monoxide oxidation system transcription reg 1e-10
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 5e-13
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 8e-12
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 1e-12
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 1e-06
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 2e-12
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 3e-10
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 3e-12
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 9e-11
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 2e-10
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 5e-09
3b02_A195 Transcriptional regulator, CRP family; structural 5e-10
3b02_A195 Transcriptional regulator, CRP family; structural 8e-09
2bgc_A 238 PRFA; bacterial infection, human pathogen, transcr 4e-09
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 3e-08
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 5e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
 Score =  356 bits (914), Expect = e-122
 Identities = 230/316 (72%), Positives = 268/316 (84%)

Query: 5   QAHDAKLKATSPEETEDLSPLPSQGQQSARRRGGISAEPVSEEDATSYVKKVVPKDYKTM 64
            A       +   + E     P+   ++ RRRGG+SAE  +EEDA SYV+KV+PKDYKTM
Sbjct: 66  LARQKSNSQSDSHDEEVSPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTM 125

Query: 65  AALSKAIAKNVLFSHLDENTRSDIFDAMFPVNCLPGESIITQGDEGDNFYVIDQGEVEVY 124
            AL+KAI+KNVLF+HLD+N RSDIFDAMFPV  + GE++I QG+EGDNFYV+DQGEV+VY
Sbjct: 126 TALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGNEGDNFYVVDQGEVDVY 185

Query: 125 VNNELVTSVGEGGSFGELALIYGTPRAATVRAKTDVKLWGLDRDSYRRILMGSTIRKRKL 184
           VN E VT++ EGGSFGELALIYGTPRAATV+AKTD+KLWG+DRDSYRRILMGST+RKRK+
Sbjct: 186 VNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKM 245

Query: 185 YEEFLSRVSILESLEKWERLTVADSLEPVSFQDKEAIVRQGQPGDDFYIIVEGTALVLQN 244
           YEEFLS+VSILESLEKWERLTVAD+LEPV F+D E IV QG+PGDDFYII EGTA VLQ 
Sbjct: 246 YEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTASVLQR 305

Query: 245 TVEEESPVEVGKLGPSDYFGEIALLLDRPRAATVVAKGPLKCVKLDRARFERVLGPCADI 304
               E  VEVG+LGPSDYFGEIALLL+RPRAATVVA+GPLKCVKLDR RFERVLGPC++I
Sbjct: 306 RSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEI 365

Query: 305 LKRNITQYNSFVSLSV 320
           LKRNI +YNSF+SL+V
Sbjct: 366 LKRNIQRYNSFISLTV 381
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Length = 154 Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Length = 154 Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Length = 161 Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Length = 161 Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Length = 139 Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Length = 139 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Length = 138 Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Length = 138 Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Length = 333 Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Length = 333 Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Length = 142 Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Length = 142 Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Length = 149 Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Length = 149 Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Length = 154 Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Length = 154 Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Length = 202 Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Length = 202 Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Length = 160 Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Length = 160 Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Length = 198 Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Length = 198 Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Length = 137 Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Length = 137 Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Length = 212 Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Length = 212 Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Length = 216 Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Length = 216 Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Length = 231 Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Length = 231 Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Length = 227 Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Length = 227 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Length = 237 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Length = 237 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Length = 260 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Length = 260 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Length = 210 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Length = 210 Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Length = 227 Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Length = 227 Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Length = 230 Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Length = 230 Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Length = 213 Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Length = 213 Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Length = 220 Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Length = 220 Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Length = 250 Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Length = 250 Back     alignment and structure
>2byv_E RAP guanine nucleotide exchange factor 4; EPAC2, CAMP-GEF2, CAMP, cyclic nucleotide, regulation, auto-inhibition, CDC25 homology domain; 2.7A {Mus musculus} Length = 999 Back     alignment and structure
>2byv_E RAP guanine nucleotide exchange factor 4; EPAC2, CAMP-GEF2, CAMP, cyclic nucleotide, regulation, auto-inhibition, CDC25 homology domain; 2.7A {Mus musculus} Length = 999 Back     alignment and structure
>2byv_E RAP guanine nucleotide exchange factor 4; EPAC2, CAMP-GEF2, CAMP, cyclic nucleotide, regulation, auto-inhibition, CDC25 homology domain; 2.7A {Mus musculus} Length = 999 Back     alignment and structure
>2byv_E RAP guanine nucleotide exchange factor 4; EPAC2, CAMP-GEF2, CAMP, cyclic nucleotide, regulation, auto-inhibition, CDC25 homology domain; 2.7A {Mus musculus} Length = 999 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Length = 222 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Length = 222 Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Length = 207 Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Length = 207 Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Length = 694 Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Length = 694 Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Length = 243 Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Length = 243 Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Length = 220 Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Length = 220 Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Length = 202 Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Length = 202 Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Length = 195 Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Length = 195 Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Length = 238 Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Length = 238 Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Length = 194 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query320
4din_B381 CAMP-dependent protein kinase type I-beta regulat 100.0
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 100.0
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 100.0
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 100.0
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 100.0
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 100.0
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 100.0
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 99.95
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 99.93
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 99.9
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 99.85
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 99.84
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 99.84
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 99.84
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 99.84
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 99.83
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 99.83
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 99.82
2pqq_A149 Putative transcriptional regulator; APC7345, strep 99.82
3ukn_A212 Novel protein similar to vertebrate potassium VOL 99.82
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 99.82
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 99.82
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 99.8
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 99.8
2pqq_A149 Putative transcriptional regulator; APC7345, strep 99.8
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 99.8
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 99.79
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.78
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 99.78
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 99.78
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 99.78
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 99.78
4ava_A333 Lysine acetyltransferase; allosteric regulation, d 99.78
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 99.78
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 99.77
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 99.77
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 99.77
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.77
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 99.77
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 99.77
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 99.77
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 99.76
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 99.76
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.76
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 99.76
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 99.75
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 99.75
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 99.75
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 99.75
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 99.75
4din_B381 CAMP-dependent protein kinase type I-beta regulat 99.75
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 99.75
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 99.75
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 99.74
3ukn_A212 Novel protein similar to vertebrate potassium VOL 99.73
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 99.73
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.73
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 99.73
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 99.73
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 99.73
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 99.73
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 99.72
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 99.72
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 99.69
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 99.69
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 99.69
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 99.69
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 99.69
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 99.68
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 99.67
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 99.67
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 99.66
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 99.65
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 99.65
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 99.65
1ft9_A222 Carbon monoxide oxidation system transcription reg 99.63
1ft9_A222 Carbon monoxide oxidation system transcription reg 99.63
3e6c_C 250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 99.62
3e6c_C250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 99.6
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 99.6
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 99.57
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 99.56
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 99.54
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 99.54
2bgc_A 238 PRFA; bacterial infection, human pathogen, transcr 99.54
3b02_A195 Transcriptional regulator, CRP family; structural 99.5
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 99.49
3b02_A195 Transcriptional regulator, CRP family; structural 99.42
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 99.41
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 99.29
3rns_A227 Cupin 2 conserved barrel domain protein; structura 97.71
1sfn_A246 Conserved hypothetical protein; structural genomic 95.08
4e2q_A266 Ureidoglycine aminohydrolase; BI-cupin, manganese 93.93
3h7j_A243 Bacilysin biosynthesis protein BACB; YWFC, bacilys 93.59
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 93.52
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 93.03
2qnk_A286 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fol 92.64
3bu7_A394 Gentisate 1,2-dioxygenase; cupin domain, oxidoredu 92.1
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 90.61
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 90.09
1sq4_A278 GLXB, glyoxylate-induced protein; structural genom 89.85
3es1_A172 Cupin 2, conserved barrel domain protein; YP_00116 89.28
2fqp_A97 Hypothetical protein BP2299; double-stranded beta- 89.06
4e2g_A126 Cupin 2 conserved barrel domain protein; MCSG, PSI 88.96
3lwc_A119 Uncharacterized protein; structural genomics, unkn 88.78
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 88.65
2pyt_A133 Ethanolamine utilization protein EUTQ; structural 88.17
3rns_A227 Cupin 2 conserved barrel domain protein; structura 87.62
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 87.61
3d0j_A140 Uncharacterized protein CA_C3497; beta-barrel, str 86.51
1o5u_A101 Novel thermotoga maritima enzyme TM1112; cupin, st 85.61
2i45_A107 Hypothetical protein; neisseria meningitidis cupin 85.27
3h8u_A125 Uncharacterized conserved protein with double-STR 84.64
2bnm_A198 Epoxidase; oxidoreductase, cupin, HTH, cation-depe 83.65
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 83.45
3l2h_A162 Putative sugar phosphate isomerase; AFE_0303, stru 83.08
1v70_A105 Probable antibiotics synthesis protein; structural 82.65
2qjv_A270 Uncharacterized IOLB-like protein; structural geno 82.51
2f4p_A147 Hypothetical protein TM1010; double-stranded beta- 82.14
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 81.39
3bcw_A123 Uncharacterized protein; structural genomics, join 81.36
3ibm_A167 Cupin 2, conserved barrel domain protein; cupin 2 81.24
3i7d_A163 Sugar phosphate isomerase; YP_168127.1, structural 80.84
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=1.5e-54  Score=391.31  Aligned_cols=307  Identities=76%  Similarity=1.208  Sum_probs=283.1

Q ss_pred             CCCCccCCCCCCC-CCCcCCCccceeEeeccCCCcccccccccccCCCHHHHHHHHHHHhcCccCCCCCHHHHHHHHhcc
Q psy18137         14 TSPEETEDLSPLP-SQGQQSARRRGGISAEPVSEEDATSYVKKVVPKDYKTMAALSKAIAKNVLFSHLDENTRSDIFDAM   92 (320)
Q Consensus        14 ~~~~~~~~~~~~~-~~~~~~~~r~~~is~e~~~~~~~~~~~~~~~~k~~~~~~~i~~~l~~~~~f~~l~~~~~~~l~~~~   92 (320)
                      +++++|||.+|.| .|...++.||++||||++.+....++.++..+|+.++++.+.++|+++++|++|+++++..|+..+
T Consensus        74 ~~~~~~~~~~~~~~~~~~~~~~~r~~vsae~~~~~~~~~~~~~~~~ks~~~~~~i~~~l~~~~lF~~L~~~~l~~l~~~~  153 (381)
T 4din_B           74 QSDSHDEEVSPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAM  153 (381)
T ss_dssp             ---------CCCCCCCCCCSSCCCCCCBCCCCCHHHHHTCCCCCCCCCHHHHHHHHHHHTTCTTSSSCCHHHHHHHHHHC
T ss_pred             CCCCcccccccccCccccccCCCCCeEecccCCccccccccCCCCCCCHHHHHHHHHHHhCChhhhcCCHHHHHHHHHhc
Confidence            3444445555555 566777889999999999976666888999999999999999999999999999999999999999


Q ss_pred             eeEEeCCCCeEEecCCCCCeEEEEEeeEEEEEEcCEEEEecCCCCeeehhhhhcCCCcceEEeeeceEEEEEEchhhHHH
Q psy18137         93 FPVNCLPGESIITQGDEGDNFYVIDQGEVEVYVNNELVTSVGEGGSFGELALIYGTPRAATVRAKTDVKLWGLDRDSYRR  172 (320)
Q Consensus        93 ~~~~~~~g~~I~~~G~~~~~~yiI~~G~v~v~~~~~~~~~~~~G~~fGe~~ll~~~~~~~tv~a~~~~~~~~i~~~~~~~  172 (320)
                      ..+.|++|++|+++|+.++++|||++|.|+++.+++.+..+++|++||+.+++.+.++.++++|.++|.+|.|+++.|..
T Consensus       154 ~~~~~~~ge~I~~~Gd~~~~~yiI~~G~v~v~~~~~~v~~l~~G~~fGe~all~~~~r~atv~A~~~~~l~~i~~~~f~~  233 (381)
T 4din_B          154 FPVTHIAGETVIQQGNEGDNFYVVDQGEVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRR  233 (381)
T ss_dssp             EEEECCTTCBSSCTTSBCCEEEECSSSEEEEEETTEEEEEEESSCCBCGGGGTSCCBCSSEEEESSSCEEEEEEHHHHHH
T ss_pred             eEEEECCCCEEEeCCCCCCeEEEEEeeEEEEEECCeEeeeCCCCCEEEchHHhcCCCcceEEEECCCEEEEEEchHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HhhhhhHHHhhHHHHHhhhhhhcccCcHHHHhhhhcccceeEeCCCCeEEccCCCCCeEEEEEecEEEEEEeccCCCccE
Q psy18137        173 ILMGSTIRKRKLYEEFLSRVSILESLEKWERLTVADSLEPVSFQDKEAIVRQGQPGDDFYIIVEGTALVLQNTVEEESPV  252 (320)
Q Consensus       173 ~~~~~~~~~~~~~~~~l~~~~~~~~l~~~~~~~l~~~~~~~~~~~g~~I~~~g~~~~~~yiI~~G~v~v~~~~~~~~~~~  252 (320)
                      ++..++.....++..+++++++|..++...+..++..+....|.+|++|+++|+.++++|||.+|.|++++....+++..
T Consensus       234 ll~~~~~~~~~~~~~~L~~v~~f~~Ls~~el~~l~~~~~~~~~~~ge~I~~eGd~~~~~yiI~~G~v~v~~~~~~~~~~~  313 (381)
T 4din_B          234 ILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTASVLQRRSPNEEYV  313 (381)
T ss_dssp             HHHHHHHHHHHHHHHHHHHCSTTTTCCTTHHHHHHTTCBCCCBCSSCBSSCTTSBCCEEEEEEESCEEEECCSSSSSCCC
T ss_pred             hhhhhhHHHHHHHHHHhhhhHHHHhccHHHHHHHHHhhhhccCCCCCEEEeCCCcCCEEEEEEeCEEEEEEecCCCCceE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999997655556567


Q ss_pred             EEEEeCCCCeecHHhHhcCCCceeEEEEecCeEEEEEehHHHHHhhcCHHHHHHHHHHhhhhcccccC
Q psy18137        253 EVGKLGPSDYFGEIALLLDRPRAATVVAKGPLKCVKLDRARFERVLGPCADILKRNITQYNSFVSLSV  320 (320)
Q Consensus       253 ~~~~l~~G~~fGe~~ll~~~~~~~tv~a~~~~~v~~i~~~~f~~ll~~~~~~~~~~~~~~~~~~~~~~  320 (320)
                      .+..+++|++|||.+++.+.||+++|+|.++|.|+.|++++|.++++++|++++++++.|+++++++|
T Consensus       314 ~v~~l~~Gd~fGe~all~~~~r~~tv~A~~~~~ll~i~~~~f~~ll~~~~~i~~~~~~~~~~~l~l~~  381 (381)
T 4din_B          314 EVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFISLTV  381 (381)
T ss_dssp             EEEEECTTCEECTTGGGSCCBCSSEEEESSCBEEEEEEHHHHHHHHCCHHHHHHTTHHHHHHHHTTC-
T ss_pred             EEEEeCCCCEechHHHhCCCCceeEEEEcCCEEEEEEeHHHHHHHHhhhHHHHHHHHHHHHHHHhhcC
Confidence            89999999999999999999999999999999999999999999999999999999999999999875
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>1sfn_A Conserved hypothetical protein; structural genomics, nysgxrc target T1583, PSI, protein STRU initiative; 2.46A {Deinococcus radiodurans} SCOP: b.82.1.11 Back     alignment and structure
>4e2q_A Ureidoglycine aminohydrolase; BI-cupin, manganese binding, endoplasmic RET hydrolase; 2.50A {Arabidopsis thaliana} PDB: 4e2s_A Back     alignment and structure
>3h7j_A Bacilysin biosynthesis protein BACB; YWFC, bacilysin synthesis, anticapsin synthesis, BI-Cu double stranded beta helix, antibiotic biosynthesis; HET: PPY; 1.87A {Bacillus subtilis} PDB: 3h7y_A* 3h9a_A* Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>2qnk_A 3-hydroxyanthranilate 3,4-dioxygenase; bicupin fold, cupin barrel, extradiol dioxygenase, metalloen trytophan catabolism, NAD+ synthesis; HET: MSE; 1.60A {Homo sapiens} PDB: 3fe5_A Back     alignment and structure
>3bu7_A Gentisate 1,2-dioxygenase; cupin domain, oxidoreductase, plasmid; 2.80A {Silicibacter pomeroyi} SCOP: b.82.1.23 Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Back     alignment and structure
>1sq4_A GLXB, glyoxylate-induced protein; structural genomics, double beta barrel protein, PSI, protei structure initiative; 2.70A {Pseudomonas aeruginosa} SCOP: b.82.1.11 Back     alignment and structure
>3es1_A Cupin 2, conserved barrel domain protein; YP_001165807.1; HET: MSE; 1.91A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Back     alignment and structure
>4e2g_A Cupin 2 conserved barrel domain protein; MCSG, PSI-biology, structural genomics, GEBA, midwest center structural genomics; HET: MSE; 1.86A {Sphaerobacter thermophilus} Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>2pyt_A Ethanolamine utilization protein EUTQ; structural genomics, joint center for structural genomics, J protein structure initiative; 1.90A {Salmonella typhimurium LT2} SCOP: b.82.1.24 Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Back     alignment and structure
>3d0j_A Uncharacterized protein CA_C3497; beta-barrel, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.53A {Clostridium acetobutylicum atcc 824} Back     alignment and structure
>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A Back     alignment and structure
>2i45_A Hypothetical protein; neisseria meningitidis cupin domain, structural genomics, PS protein structure initiative; 2.50A {Neisseria meningitidis} Back     alignment and structure
>3h8u_A Uncharacterized conserved protein with double-STR beta-helix domain; YP_001338853.1; HET: 2PE; 1.80A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2bnm_A Epoxidase; oxidoreductase, cupin, HTH, cation-dependant, zinc, fosfomycin; 1.7A {Streptomyces wedmorensis} SCOP: a.35.1.3 b.82.1.10 PDB: 1zz7_A 1zz8_A 1zz9_A 1zzb_A 1zz6_A 1zzc_A 2bnn_A 2bno_A 3scf_A 3scg_A 3sch_A Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Back     alignment and structure
>3l2h_A Putative sugar phosphate isomerase; AFE_0303, structural GEN joint center for structural genomics, JCSG; HET: MSE CXS; 1.85A {Acidithiobacillus ferrooxidans} Back     alignment and structure
>1v70_A Probable antibiotics synthesis protein; structural genomics, thermus thermophilus HB8, riken structu genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: b.82.1.9 PDB: 2dct_A Back     alignment and structure
>2qjv_A Uncharacterized IOLB-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MLY MSE; 1.90A {Salmonella typhimurium LT2} Back     alignment and structure
>2f4p_A Hypothetical protein TM1010; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: UNL; 1.90A {Thermotoga maritima} SCOP: b.82.1.9 Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Back     alignment and structure
>3bcw_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.60A {Bordetella bronchiseptica RB50} Back     alignment and structure
>3ibm_A Cupin 2, conserved barrel domain protein; cupin 2 family, metal-binding site, beta barrel, PSI-2, NYSG structural genomics; 2.00A {Halorhodospira halophila SL1} Back     alignment and structure
>3i7d_A Sugar phosphate isomerase; YP_168127.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.30A {Ruegeria pomeroyi dss-3} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 320
d1ne6a1136 b.82.3.2 (A:109-244) Regulatory subunit of Protein 2e-44
d1ne6a1136 b.82.3.2 (A:109-244) Regulatory subunit of Protein 3e-21
d1ne6a2132 b.82.3.2 (A:245-376) Regulatory subunit of Protein 1e-32
d1ne6a2132 b.82.3.2 (A:245-376) Regulatory subunit of Protein 4e-19
d1cx4a1136 b.82.3.2 (A:130-265) Regulatory subunit of Protein 4e-32
d1cx4a1136 b.82.3.2 (A:130-265) Regulatory subunit of Protein 8e-19
d1cx4a2147 b.82.3.2 (A:266-412) Regulatory subunit of Protein 4e-26
d1cx4a2147 b.82.3.2 (A:266-412) Regulatory subunit of Protein 1e-19
d1o7fa3124 b.82.3.2 (A:322-445) Regulatory domain of Epac2, d 3e-17
d1o7fa3124 b.82.3.2 (A:322-445) Regulatory domain of Epac2, d 8e-15
d1vp6a_133 b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizo 2e-15
d1vp6a_133 b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizo 4e-13
d2gaua2142 b.82.3.2 (A:10-151) Transcriptional regulator PG03 4e-15
d2gaua2142 b.82.3.2 (A:10-151) Transcriptional regulator PG03 6e-11
d1o7fa2155 b.82.3.2 (A:13-167) Regulatory domain of Epac2, do 1e-14
d1o7fa2155 b.82.3.2 (A:13-167) Regulatory domain of Epac2, do 1e-12
d1wgpa_137 b.82.3.2 (A:) Probable cyclic nucleotide-gated ion 1e-13
d1wgpa_137 b.82.3.2 (A:) Probable cyclic nucleotide-gated ion 2e-10
d1i5za2132 b.82.3.2 (A:6-137) Catabolite gene activator prote 4e-13
d1i5za2132 b.82.3.2 (A:6-137) Catabolite gene activator prote 2e-12
d1q3ea_193 b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus mu 5e-12
d1q3ea_193 b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus mu 1e-07
d2oz6a2134 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protei 1e-09
d2oz6a2134 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protei 8e-09
d1o5la1129 b.82.3.2 (A:1-129) CRP-like transcriptional regula 1e-07
d2zcwa2112 b.82.3.2 (A:6-117) Transcriptional regulator TTHA1 1e-07
d2zcwa2112 b.82.3.2 (A:6-117) Transcriptional regulator TTHA1 2e-07
d1zyba2147 b.82.3.2 (A:1-147) Probable transcription regulato 1e-05
d1ft9a2132 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-term 2e-05
d1ft9a2132 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-term 2e-04
d3e5ua2139 b.82.3.2 (A:9-147) Chlorophenol reduction protein 0.003
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 136 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Regulatory subunit of Protein kinase A
species: Cow (Bos taurus) [TaxId: 9913]

 Score =  146 bits (369), Expect = 2e-44
 Identities = 113/135 (83%), Positives = 128/135 (94%)

Query: 51  SYVKKVVPKDYKTMAALSKAIAKNVLFSHLDENTRSDIFDAMFPVNCLPGESIITQGDEG 110
           SYV+KV+PKDYKTMAAL+KAI KNVLFSHLD+N RSDIFDAMFPV+ + GE++I QGDEG
Sbjct: 2   SYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEG 61

Query: 111 DNFYVIDQGEVEVYVNNELVTSVGEGGSFGELALIYGTPRAATVRAKTDVKLWGLDRDSY 170
           DNFYVIDQGE++VYVNNE  TSVGEGGSFGELALIYGTPRAATV+AKT+VKLWG+DRDSY
Sbjct: 62  DNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSY 121

Query: 171 RRILMGSTIRKRKLY 185
           RRILMGST+RKRK+Y
Sbjct: 122 RRILMGSTLRKRKMY 136
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 136 Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 132 Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 132 Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 147 Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 147 Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 124 Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 124 Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Length = 133 Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Length = 133 Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Length = 142 Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Length = 142 Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 155 Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 155 Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 137 Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 137 Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Length = 193 Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Length = 193 Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Length = 134 Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 129 Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Length = 147 Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Length = 132 Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Length = 132 Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Length = 139 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query320
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 99.94
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 99.93
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 99.91
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 99.9
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.9
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.89
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 99.88
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 99.87
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 99.86
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 99.85
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 99.84
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 99.84
d1zyba2147 Probable transcription regulator BT4300, N-termina 99.84
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 99.82
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.82
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 99.8
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 99.8
d1zyba2147 Probable transcription regulator BT4300, N-termina 99.8
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.8
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 99.79
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 99.78
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 99.78
d1i5za2132 Catabolite gene activator protein, N-terminal doma 99.74
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 99.74
d1i5za2132 Catabolite gene activator protein, N-terminal doma 99.74
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 99.73
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 99.72
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 99.72
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 99.71
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 99.7
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 99.69
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 99.68
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 99.67
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 99.6
d2bgca2131 Listeriolysin regulatory protein PrfA, N-terminal 95.84
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 95.22
d2d40a1308 Gentisate 1,2-dioxygenase {Escherichia coli [TaxId 94.47
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 93.48
d2bgca2131 Listeriolysin regulatory protein PrfA, N-terminal 92.25
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 92.11
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 91.64
d1sefa_250 Hypothetical protein EF2996 {Enterococcus faecalis 90.04
d1y9qa299 Probable transcriptional regulator VC1968, C-termi 89.54
d1o5ua_88 Hypothetical protein TM1112 {Thermotoga maritima [ 88.07
d1rc6a_253 Hypothetical protein YlbA {Escherichia coli [TaxId 87.92
d1sfna_245 Hypothetical protein DR1152 {Deinococcus radiodura 86.75
d2f4pa1134 Hypothetical protein TM1010 {Thermotoga maritima [ 85.95
d1sq4a_273 Glyoxylate-induced protein PA1140 {Pseudomonas aer 85.92
d1vj2a_114 Hypothetical protein TM1459 {Thermotoga maritima [ 85.1
d1o4ta_115 Hypothetical protein TM1287 {Thermotoga maritima [ 84.58
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 80.74
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Regulatory subunit of Protein kinase A
species: Cow (Bos taurus) [TaxId: 9913]

Probab=99.94  E-value=7.1e-26  Score=172.13  Aligned_cols=134  Identities=84%  Similarity=1.317  Sum_probs=128.3

Q ss_pred             cccccccCCCHHHHHHHHHHHhcCccCCCCCHHHHHHHHhcceeEEeCCCCeEEecCCCCCeEEEEEeeEEEEEEcCEEE
Q psy18137         51 SYVKKVVPKDYKTMAALSKAIAKNVLFSHLDENTRSDIFDAMFPVNCLPGESIITQGDEGDNFYVIDQGEVEVYVNNELV  130 (320)
Q Consensus        51 ~~~~~~~~k~~~~~~~i~~~l~~~~~f~~l~~~~~~~l~~~~~~~~~~~g~~I~~~G~~~~~~yiI~~G~v~v~~~~~~~  130 (320)
                      ++.+...||+.+.+..+.++|+++++|++|+++++..|+..+..+.|++|++|+++||.++.+|||.+|.+.+...+..+
T Consensus         2 ~~~~~~~~~~~~~~~~l~~~l~~~~lF~~l~~~~l~~l~~~~~~~~~~~ge~I~~~gd~~~~~yiI~~G~v~v~~~~~~~   81 (136)
T d1ne6a1           2 SYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWA   81 (136)
T ss_dssp             CCCCCCCCCCHHHHHHHHHHHHHCGGGTSCCHHHHHHHHHHCEEEEECTTCEEECTTSCCCEEEEEEESCEEEEETTEEE
T ss_pred             CcccccCCCCHHHHHHHHHHHhCCHhhhhCCHHHHHHHhcceEEEEECCCCEEEeCCCCcceeeeecCCceeeecccccc
Confidence            45678889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EecCCCCeeehhhhhcCCCcceEEeeeceEEEEEEchhhHHHHhhhhhHHHhhH
Q psy18137        131 TSVGEGGSFGELALIYGTPRAATVRAKTDVKLWGLDRDSYRRILMGSTIRKRKL  184 (320)
Q Consensus       131 ~~~~~G~~fGe~~ll~~~~~~~tv~a~~~~~~~~i~~~~~~~~~~~~~~~~~~~  184 (320)
                      ..+++|++||+.+++.+.++.++++|.++|.+|.|+++.|.+++++++..++.+
T Consensus        82 ~~l~~G~~fGe~~ll~~~~~~~tv~a~~~~~l~~i~~~~f~~ll~~~~~~~r~~  135 (136)
T d1ne6a1          82 TSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKM  135 (136)
T ss_dssp             EEECTTCEECCHHHHHCCCCCSEEEESSCEEEEEEEHHHHHHHTHHHHHHHHHH
T ss_pred             ceeccccccccHHHcCCCcceEEEEEccCEEEEEEEHHHHHHHHhhCHHHHHhh
Confidence            999999999999999999999999999999999999999999999998776654
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d2bgca2 b.82.3.3 (A:7-137) Listeriolysin regulatory protein PrfA, N-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2d40a1 b.82.1.23 (A:35-342) Gentisate 1,2-dioxygenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2bgca2 b.82.3.3 (A:7-137) Listeriolysin regulatory protein PrfA, N-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sefa_ b.82.1.11 (A:) Hypothetical protein EF2996 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rc6a_ b.82.1.11 (A:) Hypothetical protein YlbA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sfna_ b.82.1.11 (A:) Hypothetical protein DR1152 {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1sq4a_ b.82.1.11 (A:) Glyoxylate-induced protein PA1140 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o4ta_ b.82.1.9 (A:) Hypothetical protein TM1287 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure