Psyllid ID: psy18197

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140----
MLFINCCVNGVPVKAFVDSGAQTTIMSAECAERCAIMRLIDTRWAGVAKGVGIQRIIGRIHMVQVVIEKDFLTTSLSILEEQPMDMLLGLDMLRRHQCCIDLKRNVLRIGTTGTETRFLSESELPVCARLTNGVDNALSFGALY
cEEEEEEEccEEEEEEEcccccEEEccHHHHHHccccEEEEccEEEEEEcccccEEEEEEEEEEEEEEEEEEEEEEEEEEcccccEEEEHHHHHHccEEEEccccEEEEccccEEEEccccccccccccccccccccccccccc
cEEEEEEEccEEEEEEEcccccHEEccHHHHHHcccHHHHHHHHcccEEEccccEEEEEEEEEEEEEcccEccEEEEEEccccccEEEEHHHHHHccEEEEccccEEEEcccccEEccccHHHccHHHHHccccccHHHccccc
mlfinccvngvpvkafvdsgaqtTIMSAECAERCAIMRLIDTRWAGVAKGVGIQRIIGRIHMVQVVIEKDFLTTSLSILEEQPMDMLLGLDMLRRHQCCIdlkrnvlrigttgtetrflseselpvcarltngvdnalsfgaly
MLFINCCVNGVPVKAFVDSGAQTTIMSAECAERCAIMRLIDTRWAGVAKGVGIQRIIGRIHMVQVVIEKDFLTTSLSILEEQPMDMLLGLDMLRRHQCCIDlkrnvlrigttgtetrflseselpvcarltngvdnalsfgaly
MLFINCCVNGVPVKAFVDSGAQTTIMSAECAERCAIMRLIDTRWAGVAKGVGIQRIIGRIHMVQVVIEKDFLTTSLSILEEQPmdmllgldmlRRHQCCIDLKRNVLRIGTTGTETRFLSESELPVCARLTNGVDNALSFGALY
*LFINCCVNGVPVKAFVDSGAQTTIMSAECAERCAIMRLIDTRWAGVAKGVGIQRIIGRIHMVQVVIEKDFLTTSLSILEEQPMDMLLGLDMLRRHQCCIDLKRNVLRIGTTGTETRFLSESELPVCARLTNGVDNALSF****
MLFINCCVNGVPVKAFVDSGAQTTIMSAECAERCAIMRLID*************RIIGRIHMVQVVIEKDFLTTSLSILEEQPMDMLLGLDMLRRHQCCIDLKRNVLRIGTTGTETRF**************************
MLFINCCVNGVPVKAFVDSGAQTTIMSAECAERCAIMRLIDTRWAGVAKGVGIQRIIGRIHMVQVVIEKDFLTTSLSILEEQPMDMLLGLDMLRRHQCCIDLKRNVLRIGTTGTETRFLSESELPVCARLTNGVDNALSFGALY
MLFINCCVNGVPVKAFVDSGAQTTIMSAECAERCAIMRLIDTRWAGVAKGVGIQRIIGRIHMVQVVIEKDFLTTSLSILEEQPMDMLLGLDMLRRHQCCIDLKRNVLRIGTTGTETRFLSESELPVCARLTN************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLFINCCVNGVPVKAFVDSGAQTTIMSAECAERCAIMRLIDTRWAGVAKGVGIQRIIGRIHMVQVVIEKDFLTTSLSILEEQPMDMLLGLDMLRRHQCCIDLKRNVLRIGTTGTETRFLSESELPVCARLTNGVDNALSFGALY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query144 2.2.26 [Sep-21-2011]
Q95JI3396 Protein DDI1 homolog 1 OS N/A N/A 0.951 0.345 0.744 1e-57
Q6TH22411 Protein DDI1 homolog 2 OS yes N/A 0.937 0.328 0.762 1e-57
Q8WTU0396 Protein DDI1 homolog 1 OS yes N/A 0.951 0.345 0.737 6e-57
Q5TDH0399 Protein DDI1 homolog 2 OS no N/A 0.930 0.335 0.753 2e-56
A2ADY9399 Protein DDI1 homolog 2 OS yes N/A 0.930 0.335 0.753 2e-56
Q7ZYA7393 Protein DDI1 homolog 2 OS N/A N/A 0.923 0.338 0.759 3e-56
Q497D6394 Protein DDI1 homolog 2 OS yes N/A 0.923 0.337 0.759 3e-56
A0JPP7408 Protein DDI1 homolog 1 OS yes N/A 0.930 0.328 0.738 9e-56
Q2T9Z1396 Protein DDI1 homolog 1 OS no N/A 0.930 0.338 0.746 1e-55
Q9DAF3408 Protein DDI1 homolog 1 OS no N/A 0.930 0.328 0.731 4e-55
>sp|Q95JI3|DDI1_MACFA Protein DDI1 homolog 1 OS=Macaca fascicularis GN=DDI1 PE=2 SV=1 Back     alignment and function desciption
 Score =  221 bits (563), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 115/137 (83%)

Query: 1   MLFINCCVNGVPVKAFVDSGAQTTIMSAECAERCAIMRLIDTRWAGVAKGVGIQRIIGRI 60
           ML+INC VNG P+KAFVDSGAQ TIMS  CAERC IMRL+D RWAGVAKGVG QRIIGR+
Sbjct: 243 MLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGVAKGVGTQRIIGRV 302

Query: 61  HMVQVVIEKDFLTTSLSILEEQPMDMLLGLDMLRRHQCCIDLKRNVLRIGTTGTETRFLS 120
           H+ Q+ IE DFL  S SILE+QPMDMLLGLDMLRRHQC IDLK+NVL IGTTGT+T FL 
Sbjct: 303 HLAQIQIEGDFLQCSFSILEDQPMDMLLGLDMLRRHQCSIDLKKNVLVIGTTGTQTYFLP 362

Query: 121 ESELPVCARLTNGVDNA 137
           E ELP+C+R+ NG D +
Sbjct: 363 EGELPLCSRMVNGKDES 379

Macaca fascicularis (taxid: 9541)
>sp|Q6TH22|DDI2_DANRE Protein DDI1 homolog 2 OS=Danio rerio GN=ddi2 PE=2 SV=1 Back     alignment and function description
>sp|Q8WTU0|DDI1_HUMAN Protein DDI1 homolog 1 OS=Homo sapiens GN=DDI1 PE=1 SV=1 Back     alignment and function description
>sp|Q5TDH0|DDI2_HUMAN Protein DDI1 homolog 2 OS=Homo sapiens GN=DDI2 PE=1 SV=1 Back     alignment and function description
>sp|A2ADY9|DDI2_MOUSE Protein DDI1 homolog 2 OS=Mus musculus GN=Ddi2 PE=1 SV=1 Back     alignment and function description
>sp|Q7ZYA7|DDI2_XENLA Protein DDI1 homolog 2 OS=Xenopus laevis GN=ddi2 PE=2 SV=1 Back     alignment and function description
>sp|Q497D6|DDI2_XENTR Protein DDI1 homolog 2 OS=Xenopus tropicalis GN=ddi2 PE=2 SV=1 Back     alignment and function description
>sp|A0JPP7|DDI1_RAT Protein DDI1 homolog 1 OS=Rattus norvegicus GN=Ddi1 PE=2 SV=1 Back     alignment and function description
>sp|Q2T9Z1|DDI1_BOVIN Protein DDI1 homolog 1 OS=Bos taurus GN=DDI1 PE=2 SV=1 Back     alignment and function description
>sp|Q9DAF3|DDI1_MOUSE Protein DDI1 homolog 1 OS=Mus musculus GN=Ddi1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query144
357605437 460 DNA-damage inducible protein [Danaus ple 0.958 0.3 0.804 1e-61
307188581 456 Protein DDI1-like protein 2 [Camponotus 0.965 0.304 0.784 4e-61
307191967 399 Protein DDI1-like protein 2 [Harpegnatho 0.965 0.348 0.791 5e-61
322799330 459 hypothetical protein SINV_11449 [Solenop 0.958 0.300 0.782 7e-61
332021102 453 Protein DDI1-like protein 2 [Acromyrmex 0.965 0.306 0.784 8e-61
189237227 452 PREDICTED: similar to DNA-damage inducib 0.909 0.289 0.801 1e-60
114051417 389 DNA-damage inducible protein [Bombyx mor 0.909 0.336 0.832 1e-60
270007166 448 hypothetical protein TcasGA2_TC013702 [T 0.909 0.292 0.801 1e-60
328724599 453 PREDICTED: protein DDI1 homolog 2-like i 0.944 0.300 0.772 3e-60
328724597 434 PREDICTED: protein DDI1 homolog 2-like i 0.944 0.313 0.772 4e-60
>gi|357605437|gb|EHJ64625.1| DNA-damage inducible protein [Danaus plexippus] Back     alignment and taxonomy information
 Score =  240 bits (613), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 123/138 (89%)

Query: 1   MLFINCCVNGVPVKAFVDSGAQTTIMSAECAERCAIMRLIDTRWAGVAKGVGIQRIIGRI 60
           ML+INC VNG PVKAF+DSGAQTTIMSA CAERC IMRL+DTRWAG+AKGVG+QRIIGRI
Sbjct: 226 MLYINCHVNGFPVKAFIDSGAQTTIMSAACAERCNIMRLVDTRWAGIAKGVGVQRIIGRI 285

Query: 61  HMVQVVIEKDFLTTSLSILEEQPMDMLLGLDMLRRHQCCIDLKRNVLRIGTTGTETRFLS 120
           HMVQ+ IEKDFLTTS S+LEEQPMDMLLGLDML+RHQC IDLKRNVL IGTTGTET FL 
Sbjct: 286 HMVQMRIEKDFLTTSFSVLEEQPMDMLLGLDMLKRHQCNIDLKRNVLHIGTTGTETPFLP 345

Query: 121 ESELPVCARLTNGVDNAL 138
           E+ELP CARL+   ++ L
Sbjct: 346 EAELPECARLSGFSEDEL 363

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307188581|gb|EFN73309.1| Protein DDI1-like protein 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307191967|gb|EFN75357.1| Protein DDI1-like protein 2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|322799330|gb|EFZ20718.1| hypothetical protein SINV_11449 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332021102|gb|EGI61489.1| Protein DDI1-like protein 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|189237227|ref|XP_969775.2| PREDICTED: similar to DNA-damage inducible protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|114051417|ref|NP_001040314.1| DNA-damage inducible protein [Bombyx mori] gi|87248309|gb|ABD36207.1| DNA-damage inducible protein [Bombyx mori] Back     alignment and taxonomy information
>gi|270007166|gb|EFA03614.1| hypothetical protein TcasGA2_TC013702 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328724599|ref|XP_003248194.1| PREDICTED: protein DDI1 homolog 2-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328724597|ref|XP_001948469.2| PREDICTED: protein DDI1 homolog 2-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query144
ZFIN|ZDB-GENE-031030-15411 ddi2 "DNA-damage inducible pro 0.923 0.323 0.699 4.4e-45
UNIPROTKB|Q8WTU0396 DDI1 "Protein DDI1 homolog 1" 0.951 0.345 0.664 9.1e-45
RGD|1559430408 Ddi1 "DNA-damage inducible 1 h 0.923 0.325 0.676 3.9e-44
UNIPROTKB|F1MG01396 DDI1 "Protein DDI1 homolog 1" 0.930 0.338 0.671 6.4e-44
UNIPROTKB|Q2T9Z1396 DDI1 "Protein DDI1 homolog 1" 0.930 0.338 0.671 6.4e-44
UNIPROTKB|E2QUJ5399 DDI2 "Uncharacterized protein" 0.923 0.333 0.684 6.4e-44
UNIPROTKB|F1SUU7399 DDI2 "Uncharacterized protein" 0.923 0.333 0.684 6.4e-44
UNIPROTKB|F1SV49401 DDI1 "Uncharacterized protein" 0.923 0.331 0.676 6.4e-44
MGI|MGI:1917244399 Ddi2 "DNA-damage inducible pro 0.923 0.333 0.684 6.4e-44
UNIPROTKB|F1MAK5399 Ddi2 "Protein Ddi2" [Rattus no 0.923 0.333 0.684 6.4e-44
ZFIN|ZDB-GENE-031030-15 ddi2 "DNA-damage inducible protein 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 474 (171.9 bits), Expect = 4.4e-45, P = 4.4e-45
 Identities = 93/133 (69%), Positives = 103/133 (77%)

Query:     1 MLFINCCVNGVPVKAFVDSGAQTTIMSAECAERCAIMRLIDTRWAGVAKGVGIQRIIGRI 60
             ML+INC VNG PVKAFVDSGAQ TIMS  CAERC IMRL+D RWAG+AKGVG Q+IIGR+
Sbjct:   245 MLYINCKVNGHPVKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGIAKGVGTQKIIGRV 304

Query:    61 HMVQVVIEKDFLTTSLSILEEQPXXXXXXXXXXRRHQCCIDLKRNVLRIGTTGTETRFLS 120
             H+ QV IE DFL  S SILE+QP          +RHQC IDLK+NVL IGTTGTETRFL 
Sbjct:   305 HLAQVQIEGDFLPCSFSILEDQPMDMLLGLDMLKRHQCSIDLKKNVLLIGTTGTETRFLP 364

Query:   121 ESELPVCARLTNG 133
             E+ELP CARL  G
Sbjct:   365 EAELPECARLAYG 377
GO:0006508 "proteolysis" evidence=IEA
GO:0004190 "aspartic-type endopeptidase activity" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
UNIPROTKB|Q8WTU0 DDI1 "Protein DDI1 homolog 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1559430 Ddi1 "DNA-damage inducible 1 homolog 1 (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MG01 DDI1 "Protein DDI1 homolog 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q2T9Z1 DDI1 "Protein DDI1 homolog 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUJ5 DDI2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SUU7 DDI2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1SV49 DDI1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1917244 Ddi2 "DNA-damage inducible protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAK5 Ddi2 "Protein Ddi2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q54JB0DDI1_DICDINo assigned EC number0.54030.84720.2711yesN/A
P0CS14DDI1_CRYNJNo assigned EC number0.62790.88190.2926yesN/A
Q6TH22DDI2_DANRENo assigned EC number0.76290.93750.3284yesN/A
Q6BK42DDI1_DEBHANo assigned EC number0.5280.85410.2745yesN/A
A0JPP7DDI1_RATNo assigned EC number0.73880.93050.3284yesN/A
Q6CNS3DDI1_KLULANo assigned EC number0.5920.84720.2946yesN/A
Q4WGS4DDI1_ASPFUNo assigned EC number0.5360.85410.3037yesN/A
A2ADY9DDI2_MOUSENo assigned EC number0.75370.93050.3358yesN/A
Q8WTU0DDI1_HUMANNo assigned EC number0.73720.95130.3459yesN/A
Q2USD7DDI1_ASPORNo assigned EC number0.5360.85410.3059yesN/A
Q754R2DDI1_ASHGONo assigned EC number0.5680.84720.2584yesN/A
Q497D6DDI2_XENTRNo assigned EC number0.75930.92360.3375yesN/A
P40087DDI1_YEASTNo assigned EC number0.5440.84720.2850yesN/A
Q6FQE9DDI1_CANGANo assigned EC number0.5760.84720.2863yesN/A
Q5AY89DDI1_EMENINo assigned EC number0.5280.85410.2942yesN/A
Q10256MUD1_SCHPONo assigned EC number0.5680.85410.3704yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
cd05479124 cd05479, RP_DDI, RP_DDI; retropepsin-like domain o 1e-67
pfam09668124 pfam09668, Asp_protease, Aspartyl protease 6e-63
cd0030392 cd00303, retropepsin_like, Retropepsins; pepsin-li 3e-11
cd05480103 cd05480, NRIP_C, NRIP_C; putative nuclear receptor 4e-06
pfam1365089 pfam13650, Asp_protease_2, Aspartyl protease 2e-05
cd0548396 cd05483, retropepsin_like_bacteria, Bacterial aspa 5e-04
TIGR02281121 TIGR02281, clan_AA_DTGA, clan AA aspartic protease 0.002
pfam1397572 pfam13975, gag-asp_proteas, gag-polyprotein putati 0.003
>gnl|CDD|133146 cd05479, RP_DDI, RP_DDI; retropepsin-like domain of DNA damage inducible protein Back     alignment and domain information 
 Score =  200 bits (510), Expect = 1e-67
 Identities = 72/109 (66%), Positives = 87/109 (79%)

Query: 1   MLFINCCVNGVPVKAFVDSGAQTTIMSAECAERCAIMRLIDTRWAGVAKGVGIQRIIGRI 60
           ML+IN  +NGVPVKAFVDSGAQ TIMS  CAE+C +MRLID R+ G+AKGVG Q+I+GRI
Sbjct: 16  MLYINVEINGVPVKAFVDSGAQMTIMSKACAEKCGLMRLIDKRFQGIAKGVGTQKILGRI 75

Query: 61  HMVQVVIEKDFLTTSLSILEEQPMDMLLGLDMLRRHQCCIDLKRNVLRI 109
           H+ QV I   FL  S ++LE+  +D L+GLDML+RHQC IDLK NVLRI
Sbjct: 76  HLAQVKIGNLFLPCSFTVLEDDDVDFLIGLDMLKRHQCVIDLKENVLRI 124

The family represents the retropepsin-like domain of DNA damage inducible protein. DNA damage inducible protein has a retropepsin-like domain and an amino-terminal ubiquitin-like domain and/or a UBA (ubiquitin-associated) domain. This CD represents the retropepsin-like domain of DDI. Length = 124
>gnl|CDD|118200 pfam09668, Asp_protease, Aspartyl protease Back     alignment and domain information
>gnl|CDD|133136 cd00303, retropepsin_like, Retropepsins; pepsin-like aspartate proteases Back     alignment and domain information
>gnl|CDD|133147 cd05480, NRIP_C, NRIP_C; putative nuclear receptor interacting protein Back     alignment and domain information
>gnl|CDD|222288 pfam13650, Asp_protease_2, Aspartyl protease Back     alignment and domain information
>gnl|CDD|133150 cd05483, retropepsin_like_bacteria, Bacterial aspartate proteases, retropepsin-like protease family Back     alignment and domain information
>gnl|CDD|131334 TIGR02281, clan_AA_DTGA, clan AA aspartic protease, TIGR02281 family Back     alignment and domain information
>gnl|CDD|206145 pfam13975, gag-asp_proteas, gag-polyprotein putative aspartyl protease Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 144
KOG0012|consensus380 99.97
PF09668124 Asp_protease: Aspartyl protease; InterPro: IPR0191 99.97
cd05479124 RP_DDI RP_DDI; retropepsin-like domain of DNA dama 99.96
cd05480103 NRIP_C NRIP_C; putative nuclear receptor interacti 99.96
PF08284135 RVP_2: Retroviral aspartyl protease; InterPro: IPR 99.91
TIGR02281121 clan_AA_DTGA clan AA aspartic protease, TIGR02281 99.85
cd0548491 retropepsin_like_LTR_2 Retropepsins_like_LTR, peps 99.83
PF1365090 Asp_protease_2: Aspartyl protease 99.78
PF00077100 RVP: Retroviral aspartyl protease The Prosite entr 99.77
cd0548396 retropepsin_like_bacteria Bacterial aspartate prot 99.74
TIGR03698107 clan_AA_DTGF clan AA aspartic protease, AF_0612 fa 99.72
cd0609586 RP_RTVL_H_like Retropepsin of the RTVL_H family of 99.71
COG3577215 Predicted aspartyl protease [General function pred 99.61
cd0030392 retropepsin_like Retropepsins; pepsin-like asparta 99.48
cd0548193 retropepsin_like_LTR_1 Retropepsins_like_LTR; peps 99.44
PF12384177 Peptidase_A2B: Ty3 transposon peptidase; InterPro: 99.31
PF1397572 gag-asp_proteas: gag-polyprotein putative aspartyl 99.26
COG5550125 Predicted aspartyl protease [Posttranslational mod 99.13
cd0609489 RP_Saci_like RP_Saci_like, retropepsin family. Ret 99.06
cd0548287 HIV_retropepsin_like Retropepsins, pepsin-like asp 99.04
PF02160201 Peptidase_A3: Cauliflower mosaic virus peptidase ( 98.92
PF05585164 DUF1758: Putative peptidase (DUF1758); InterPro: I 98.69
PF12382137 Peptidase_A2E: Retrotransposon peptidase; InterPro 97.67
PF00026 317 Asp: Eukaryotic aspartyl protease The Prosite entr 97.29
PTZ00013 450 plasmepsin 4 (PM4); Provisional 97.23
cd05470109 pepsin_retropepsin_like Cellular and retroviral pe 97.07
PTZ00147 453 plasmepsin-1; Provisional 97.07
cd05476265 pepsin_A_like_plant Chroloplast Nucleoids DNA-bind 96.9
COG4067162 Uncharacterized protein conserved in archaea [Post 96.86
cd05474 295 SAP_like SAPs, pepsin-like proteinases secreted fr 96.83
cd06097 278 Aspergillopepsin_like Aspergillopepsin_like, aspar 96.75
cd05478 317 pepsin_A Pepsin A, aspartic protease produced in g 96.46
cd05476 265 pepsin_A_like_plant Chroloplast Nucleoids DNA-bind 96.36
cd05487 326 renin_like Renin stimulates production of angioten 96.19
PF05618138 Zn_protease: Putative ATP-dependant zinc protease; 96.17
cd05477 318 gastricsin Gastricsins, asparate proteases produce 96.04
cd05488 320 Proteinase_A_fungi Fungal Proteinase A , aspartic 95.95
cd05477318 gastricsin Gastricsins, asparate proteases produce 95.94
PTZ00165 482 aspartyl protease; Provisional 95.89
cd05478317 pepsin_A Pepsin A, aspartic protease produced in g 95.85
cd06096326 Plasmepsin_5 Plasmepsins are a class of aspartic p 95.69
cd05472 299 cnd41_like Chloroplast Nucleoids DNA-binding Prote 95.68
cd05486 316 Cathespin_E Cathepsin E, non-lysosomal aspartic pr 95.66
cd06098 317 phytepsin Phytepsin, a plant homolog of mammalian 95.65
cd05474295 SAP_like SAPs, pepsin-like proteinases secreted fr 95.49
cd06098317 phytepsin Phytepsin, a plant homolog of mammalian 95.44
cd05490 325 Cathepsin_D2 Cathepsin_D2, pepsin family of protei 95.37
cd05485329 Cathepsin_D_like Cathepsin_D_like, pepsin family o 95.34
cd05485 329 Cathepsin_D_like Cathepsin_D_like, pepsin family o 95.2
cd05473 364 beta_secretase_like Beta-secretase, aspartic-acid 95.09
cd05471283 pepsin_like Pepsin-like aspartic proteases, biloba 95.07
cd06096 326 Plasmepsin_5 Plasmepsins are a class of aspartic p 94.83
cd05475273 nucellin_like Nucellins, plant aspartic proteases 94.83
cd05488320 Proteinase_A_fungi Fungal Proteinase A , aspartic 94.75
PF03539163 Spuma_A9PTase: Spumavirus aspartic protease (A9); 94.61
cd06097278 Aspergillopepsin_like Aspergillopepsin_like, aspar 94.53
cd05472299 cnd41_like Chloroplast Nucleoids DNA-binding Prote 94.26
cd05475 273 nucellin_like Nucellins, plant aspartic proteases 93.75
cd05471 283 pepsin_like Pepsin-like aspartic proteases, biloba 93.72
PF00026317 Asp: Eukaryotic aspartyl protease The Prosite entr 93.65
cd05486316 Cathespin_E Cathepsin E, non-lysosomal aspartic pr 93.24
PLN03146431 aspartyl protease family protein; Provisional 92.5
cd05487326 renin_like Renin stimulates production of angioten 91.58
cd05490325 Cathepsin_D2 Cathepsin_D2, pepsin family of protei 90.46
PF03419293 Peptidase_U4: Sporulation factor SpoIIGA This fami 90.09
PTZ00165482 aspartyl protease; Provisional 89.87
PF14541161 TAXi_C: Xylanase inhibitor C-terminal; PDB: 3AUP_D 89.65
cd05489362 xylanase_inhibitor_I_like TAXI-I inhibits degradat 89.53
PTZ00147453 plasmepsin-1; Provisional 87.48
PTZ00013450 plasmepsin 4 (PM4); Provisional 86.31
KOG1339|consensus 398 83.56
>KOG0012|consensus Back     alignment and domain information 
Probab=99.97  E-value=6.7e-32  Score=217.69  Aligned_cols=135  Identities=63%  Similarity=1.037  Sum_probs=129.9

Q ss_pred             CeEEEEEECCEEEEEEEecCCCceecCHHHHHHcCceeeecceeeeEeeccceeEEEEEEEEEEEEEcCEEEeeeEEEec
Q psy18197          1 MLFINCCVNGVPVKAFVDSGAQTTIMSAECAERCAIMRLIDTRWAGVAKGVGIQRIIGRIHMVQVVIEKDFLTTSLSILE   80 (144)
Q Consensus         1 ~~~v~v~InG~~v~~LvDTGA~~s~Is~~~a~~lgl~~~~~~~~~~~a~g~g~~~~~g~i~~~~i~iG~~~~~~~~~V~~   80 (144)
                      |+||+|+|||+|++|.|||||+.|+||.++|+|||+.+.+++++.+++.|+|..++.|+++.++++||+..++|+|.|++
T Consensus       235 ML~iN~~ing~~VKAfVDsGaq~timS~~Caer~gL~rlid~r~~g~a~gvg~~ki~g~Ih~~~lki~~~~l~c~ftV~d  314 (380)
T KOG0012|consen  235 MLYINCEINGVPVKAFVDSGAQTTIMSAACAERCGLNRLIDKRFQGEARGVGTEKILGRIHQAQLKIEDLYLPCSFTVLD  314 (380)
T ss_pred             EEEEEEEECCEEEEEEEcccchhhhhhHHHHHHhChHHHhhhhhhccccCCCcccccceeEEEEEEeccEeeccceEEec
Confidence            89999999999999999999999999999999999999999999999999998899999999999999999999999999


Q ss_pred             CCCCceEeeechhheecEEEEcCCCEEEEccCCeEEEeecCCCcCceeeccCCCC
Q psy18197         81 EQPMDMLLGLDMLRRHQCCIDLKRNVLRIGTTGTETRFLSESELPVCARLTNGVD  135 (144)
Q Consensus        81 ~~~~d~ILG~d~L~~~~~~iD~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~  135 (144)
                      ..+.|++||+|.|++|+|+||+++++|++++++.++||+...+.|...+++.--+
T Consensus       315 ~~~~d~llGLd~Lrr~~ccIdL~~~~L~ig~~~teiPfl~~~~lp~~~~~~~~~~  369 (380)
T KOG0012|consen  315 RRDMDLLLGLDMLRRHQCCIDLKTNVLRIGNTETEIPFLPSNELPSHNKETGASP  369 (380)
T ss_pred             CCCcchhhhHHHHHhccceeecccCeEEecCCCccccccccccCCccccccccCC
Confidence            9999999999999999999999999999999989999999999999998775443

>PF09668 Asp_protease: Aspartyl protease; InterPro: IPR019103 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd05479 RP_DDI RP_DDI; retropepsin-like domain of DNA damage inducible protein Back     alignment and domain information
>cd05480 NRIP_C NRIP_C; putative nuclear receptor interacting protein Back     alignment and domain information
>PF08284 RVP_2: Retroviral aspartyl protease; InterPro: IPR013242 This region defines single domain aspartyl proteases from retroviruses, retrotransposons, and badnaviruses (plant dsDNA viruses) Back     alignment and domain information
>TIGR02281 clan_AA_DTGA clan AA aspartic protease, TIGR02281 family Back     alignment and domain information
>cd05484 retropepsin_like_LTR_2 Retropepsins_like_LTR, pepsin-like aspartate proteases Back     alignment and domain information
>PF13650 Asp_protease_2: Aspartyl protease Back     alignment and domain information
>PF00077 RVP: Retroviral aspartyl protease The Prosite entry also includes Pfam:PF00026; InterPro: IPR018061 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd05483 retropepsin_like_bacteria Bacterial aspartate proteases, retropepsin-like protease family Back     alignment and domain information
>TIGR03698 clan_AA_DTGF clan AA aspartic protease, AF_0612 family Back     alignment and domain information
>cd06095 RP_RTVL_H_like Retropepsin of the RTVL_H family of human endogenous retrovirus-like elements Back     alignment and domain information
>COG3577 Predicted aspartyl protease [General function prediction only] Back     alignment and domain information
>cd00303 retropepsin_like Retropepsins; pepsin-like aspartate proteases Back     alignment and domain information
>cd05481 retropepsin_like_LTR_1 Retropepsins_like_LTR; pepsin-like aspartate protease from retrotransposons with long terminal repeats Back     alignment and domain information
>PF12384 Peptidase_A2B: Ty3 transposon peptidase; InterPro: IPR024650 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF13975 gag-asp_proteas: gag-polyprotein putative aspartyl protease Back     alignment and domain information
>COG5550 Predicted aspartyl protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06094 RP_Saci_like RP_Saci_like, retropepsin family Back     alignment and domain information
>cd05482 HIV_retropepsin_like Retropepsins, pepsin-like aspartate proteases Back     alignment and domain information
>PF02160 Peptidase_A3: Cauliflower mosaic virus peptidase (A3); InterPro: IPR000588 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF05585 DUF1758: Putative peptidase (DUF1758); InterPro: IPR008737 This is a family of nematode proteins of unknown function [] Back     alignment and domain information
>PF12382 Peptidase_A2E: Retrotransposon peptidase; InterPro: IPR024648 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF00026 Asp: Eukaryotic aspartyl protease The Prosite entry also includes Pfam:PF00077 Back     alignment and domain information
>PTZ00013 plasmepsin 4 (PM4); Provisional Back     alignment and domain information
>cd05470 pepsin_retropepsin_like Cellular and retroviral pepsin-like aspartate proteases Back     alignment and domain information
>PTZ00147 plasmepsin-1; Provisional Back     alignment and domain information
>cd05476 pepsin_A_like_plant Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants Back     alignment and domain information
>COG4067 Uncharacterized protein conserved in archaea [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd05474 SAP_like SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins Back     alignment and domain information
>cd06097 Aspergillopepsin_like Aspergillopepsin_like, aspartic proteases of fungal origin Back     alignment and domain information
>cd05478 pepsin_A Pepsin A, aspartic protease produced in gastric mucosa of mammals Back     alignment and domain information
>cd05476 pepsin_A_like_plant Chroloplast Nucleoids DNA-binding Protease and Nucellin, pepsin-like aspartic proteases from plants Back     alignment and domain information
>cd05487 renin_like Renin stimulates production of angiotensin and thus affects blood pressure Back     alignment and domain information
>PF05618 Zn_protease: Putative ATP-dependant zinc protease; InterPro: IPR008503 This family consists of several hypothetical proteins from different archaeal and bacterial species Back     alignment and domain information
>cd05477 gastricsin Gastricsins, asparate proteases produced in gastric mucosa Back     alignment and domain information
>cd05488 Proteinase_A_fungi Fungal Proteinase A , aspartic proteinase superfamily Back     alignment and domain information
>cd05477 gastricsin Gastricsins, asparate proteases produced in gastric mucosa Back     alignment and domain information
>PTZ00165 aspartyl protease; Provisional Back     alignment and domain information
>cd05478 pepsin_A Pepsin A, aspartic protease produced in gastric mucosa of mammals Back     alignment and domain information
>cd06096 Plasmepsin_5 Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite Back     alignment and domain information
>cd05472 cnd41_like Chloroplast Nucleoids DNA-binding Protease, catalyzes the degradation of ribulose-1,5-bisphosphate carboxylase/oxygenase Back     alignment and domain information
>cd05486 Cathespin_E Cathepsin E, non-lysosomal aspartic protease Back     alignment and domain information
>cd06098 phytepsin Phytepsin, a plant homolog of mammalian lysosomal pepsins Back     alignment and domain information
>cd05474 SAP_like SAPs, pepsin-like proteinases secreted from pathogens to degrade host proteins Back     alignment and domain information
>cd06098 phytepsin Phytepsin, a plant homolog of mammalian lysosomal pepsins Back     alignment and domain information
>cd05490 Cathepsin_D2 Cathepsin_D2, pepsin family of proteinases Back     alignment and domain information
>cd05485 Cathepsin_D_like Cathepsin_D_like, pepsin family of proteinases Back     alignment and domain information
>cd05485 Cathepsin_D_like Cathepsin_D_like, pepsin family of proteinases Back     alignment and domain information
>cd05473 beta_secretase_like Beta-secretase, aspartic-acid protease important in the pathogenesis of Alzheimer's disease Back     alignment and domain information
>cd05471 pepsin_like Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH Back     alignment and domain information
>cd06096 Plasmepsin_5 Plasmepsins are a class of aspartic proteinases produced by the plasmodium parasite Back     alignment and domain information
>cd05475 nucellin_like Nucellins, plant aspartic proteases specifically expressed in nucellar cells during degradation Back     alignment and domain information
>cd05488 Proteinase_A_fungi Fungal Proteinase A , aspartic proteinase superfamily Back     alignment and domain information
>PF03539 Spuma_A9PTase: Spumavirus aspartic protease (A9); InterPro: IPR001641 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd06097 Aspergillopepsin_like Aspergillopepsin_like, aspartic proteases of fungal origin Back     alignment and domain information
>cd05472 cnd41_like Chloroplast Nucleoids DNA-binding Protease, catalyzes the degradation of ribulose-1,5-bisphosphate carboxylase/oxygenase Back     alignment and domain information
>cd05475 nucellin_like Nucellins, plant aspartic proteases specifically expressed in nucellar cells during degradation Back     alignment and domain information
>cd05471 pepsin_like Pepsin-like aspartic proteases, bilobal enzymes that cleave bonds in peptides at acidic pH Back     alignment and domain information
>PF00026 Asp: Eukaryotic aspartyl protease The Prosite entry also includes Pfam:PF00077 Back     alignment and domain information
>cd05486 Cathespin_E Cathepsin E, non-lysosomal aspartic protease Back     alignment and domain information
>PLN03146 aspartyl protease family protein; Provisional Back     alignment and domain information
>cd05487 renin_like Renin stimulates production of angiotensin and thus affects blood pressure Back     alignment and domain information
>cd05490 Cathepsin_D2 Cathepsin_D2, pepsin family of proteinases Back     alignment and domain information
>PF03419 Peptidase_U4: Sporulation factor SpoIIGA This family belongs to family U4 of the peptidase classification Back     alignment and domain information
>PTZ00165 aspartyl protease; Provisional Back     alignment and domain information
>PF14541 TAXi_C: Xylanase inhibitor C-terminal; PDB: 3AUP_D 3HD8_A 1T6G_A 1T6E_X 2B42_A 3VLB_A 3VLA_A Back     alignment and domain information
>cd05489 xylanase_inhibitor_I_like TAXI-I inhibits degradation of xylan in the cell wall Back     alignment and domain information
>PTZ00147 plasmepsin-1; Provisional Back     alignment and domain information
>PTZ00013 plasmepsin 4 (PM4); Provisional Back     alignment and domain information
>KOG1339|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
3s8i_A148 The Retroviral-Like Protease (Rvp) Domain Of Human 1e-46
2i1a_A148 A Retroviral Protease-Like Domain In The Eukaryotic 4e-28
>pdb|3S8I|A Chain A, The Retroviral-Like Protease (Rvp) Domain Of Human Ddi1 Length = 148 Back     alignment and structure 
Iteration: 1

 Score =  181 bits (459), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 87/125 (69%), Positives = 96/125 (76%)
Query: 1   MLFINCCVNGVPVKAFVDSGAQTTIMSAECAERCAIMRLIDTRWAGVAKGVGIQRIIGRI 60
           ML+INC VNG P+KAFVDSGAQ TIMS  CAERC IMRL+D RWAGVAKGVG QRIIGR+
Sbjct: 24  MLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGVAKGVGTQRIIGRV 83
Query: 61  HMVQVVIEKDFLTTSLSILEEQPXXXXXXXXXXRRHQCCIDLKRNVLRIGTTGTETRFLS 120
           H+ Q+ IE DFL  S SILE+QP          RRHQC IDLK+NVL IGTTGT+T FL 
Sbjct: 84  HLAQIQIEGDFLQCSFSILEDQPMDMLLGLDMLRRHQCSIDLKKNVLVIGTTGTQTYFLP 143
Query: 121 ESELP 125
           E ELP
Sbjct: 144 EGELP 148
>pdb|2I1A|A Chain A, A Retroviral Protease-Like Domain In The Eukaryotic Protein Ddi1 Length = 148 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query144
3s8i_A148 Protein DDI1 homolog 1; protease, structural genom 1e-46
2i1a_A148 DNA damage-inducible protein DDI1; acid protease f 1e-45
>3s8i_A Protein DDI1 homolog 1; protease, structural genomics, structural genomics consortiu retropepsin-like domain, protein turnover, hydrolase; 1.70A {Homo sapiens} Length = 148 Back     alignment and structure
 Score =  147 bits (371), Expect = 1e-46
 Identities = 97/125 (77%), Positives = 106/125 (84%)

Query: 1   MLFINCCVNGVPVKAFVDSGAQTTIMSAECAERCAIMRLIDTRWAGVAKGVGIQRIIGRI 60
           ML+INC VNG P+KAFVDSGAQ TIMS  CAERC IMRL+D RWAGVAKGVG QRIIGR+
Sbjct: 24  MLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGVAKGVGTQRIIGRV 83

Query: 61  HMVQVVIEKDFLTTSLSILEEQPMDMLLGLDMLRRHQCCIDLKRNVLRIGTTGTETRFLS 120
           H+ Q+ IE DFL  S SILE+QPMDMLLGLDMLRRHQC IDLK+NVL IGTTGT+T FL 
Sbjct: 84  HLAQIQIEGDFLQCSFSILEDQPMDMLLGLDMLRRHQCSIDLKKNVLVIGTTGTQTYFLP 143

Query: 121 ESELP 125
           E ELP
Sbjct: 144 EGELP 148
>2i1a_A DNA damage-inducible protein DDI1; acid protease fold, dimer, retroviral protease domain, protein turnover; HET: DNA; 2.30A {Saccharomyces cerevisiae} Length = 148 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query144
3s8i_A148 Protein DDI1 homolog 1; protease, structural genom 100.0
2i1a_A148 DNA damage-inducible protein DDI1; acid protease f 99.97
1fmb_A104 EIAV protease; hydrolase (acid proteinase), RNA-di 99.58
3slz_A132 GAG-Pro-POL polyprotein; beta sheet and dimer, pro 99.54
3ec0_A99 Protease; HIV-2, inhibitor, hydrolase; HET: GRL; 1 99.4
2hs1_A99 HIV-1 protease; ultra-high resolution active site 99.37
3ka2_A203 [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydro 99.29
2hah_A116 Protease, retropepsin; retroviral, aspartyl, hydro 99.21
3ka2_A203 [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydro 98.93
3sqf_A114 Protease; folded monomer, retropepsin, D-type retr 98.72
2rsp_A124 RSV protease; hydrolase(aspartyl proteinase); 2.00 98.49
2pma_A146 Uncharacterized protein; APC86035.2, protein LPG00 98.05
3liy_A116 Protease; hydrolase, hydrolase-hydrolase inhibitor 98.04
1bxo_A 323 Protein (penicillopepsin); hydrolase, phosphonate 97.06
1izd_A 323 Aspartic proteinase; sugar binding, acid protease, 96.98
3qvc_A 451 Histo-aspartic protease; HAP, plasmepsin, zymogen, 96.93
1ibq_A 325 Aspergillopepsin; aspartic proteinase, hydrolase; 96.88
2jys_A107 Protease/reverse transcriptase; retroviral proteas 96.86
1yg9_A 330 Aspartic protease BLA G 2; allegren, hydrolase, al 96.84
2x0b_A 383 Renin; hydrolase-hormone complex, hydrolase hormon 96.83
2bju_A 453 Plasmepsin II; aspartic proteinase, drug design, m 96.82
3cms_A 323 Chymosin B; hydrolase, acid proteinase; 2.00A {Bos 96.77
1oew_A 329 Endothiapepsin; hydrolase, aspartic proteinase mec 96.77
1wkr_A 340 Polyporopepsin; hydrolase, hydrolase-hydrolase inh 96.71
3k1w_A 341 Renin; protease, alternative splicing, aspartyl pr 96.65
3c9x_A 329 Trichoderma reesei aspartic protease; aspartic pro 96.61
1miq_A 375 Plasmepsin; aspartic proteinase zymogen, domain op 96.59
4aa9_A 320 Chymosin; hydrolase, aspartic peptidase, rennet; H 96.57
1mpp_A 361 Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu 96.56
1b5f_A239 Protein (cardosin A); hydrolase, aspartic proteina 96.51
1tzs_A 351 Cathepsin E; hydrolase, aspartic protease, activat 96.5
3psg_A 370 Pepsinogen; hydrolase(acid proteinase zymogen); 1. 96.49
1dpj_A 329 Proteinase A; proteinase A, hydrolase-hydrolase in 96.45
3fv3_A 339 SAPP1P-secreted aspartic protease 1; secreted aspa 96.38
3pvk_A 342 Candidapepsin-2; hydrolase; 1.27A {Candida albican 96.35
1htr_B 329 Gastricsin; aspartyl protease; 1.62A {Homo sapiens 96.25
2apr_A 325 Rhizopuspepsin; hydrolase (aspartic proteinase); 1 96.21
1j71_A 334 Candidapepsin, aspartic proteinase; candida tropic 96.11
2qzx_A 342 Candidapepsin-5; aspartic proteinase, aspartyl pro 96.04
1am5_A 324 Pepsin, acid proteinase; aspartyl protease, hydrol 95.96
3aup_A 403 SBG7S, BG, basic 7S globulin; pepsin-like fold, pl 95.94
1qdm_A 478 Prophytepsin; aspartic proteinases, saposin-like d 95.82
2ewy_A 383 Beta-secretase 2; BACE2, aspartic protease, hydrol 95.81
3cms_A323 Chymosin B; hydrolase, acid proteinase; 2.00A {Bos 95.5
1lya_A97 Cathepsin D; lysosomal aspartic protease; HET: NAG 95.37
2qp8_A 395 Beta-secretase 1; BACE1, protease, alternative spl 95.35
3vf3_A 402 Beta-secretase 1; structure-based drug design, hyd 95.29
3lpj_A 455 Beta-secretase 1; alzheimer'S, aspartyl protease, 95.29
1lya_B241 Cathepsin D; lysosomal aspartic protease; HET: NAG 95.02
4aa9_A320 Chymosin; hydrolase, aspartic peptidase, rennet; H 94.74
1yg9_A330 Aspartic protease BLA G 2; allegren, hydrolase, al 94.61
1dpj_A329 Proteinase A; proteinase A, hydrolase-hydrolase in 94.55
1am5_A324 Pepsin, acid proteinase; aspartyl protease, hydrol 94.49
1wkr_A340 Polyporopepsin; hydrolase, hydrolase-hydrolase inh 94.31
1mpp_A361 Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomu 94.09
3k1w_A341 Renin; protease, alternative splicing, aspartyl pr 94.09
1bxo_A323 Protein (penicillopepsin); hydrolase, phosphonate 94.04
1htr_B329 Gastricsin; aspartyl protease; 1.62A {Homo sapiens 93.96
3fv3_A339 SAPP1P-secreted aspartic protease 1; secreted aspa 93.9
1izd_A323 Aspartic proteinase; sugar binding, acid protease, 93.73
1ibq_A325 Aspergillopepsin; aspartic proteinase, hydrolase; 93.68
3qvc_A451 Histo-aspartic protease; HAP, plasmepsin, zymogen, 93.53
1oew_A329 Endothiapepsin; hydrolase, aspartic proteinase mec 93.46
2apr_A325 Rhizopuspepsin; hydrolase (aspartic proteinase); 1 93.25
2qzx_A342 Candidapepsin-5; aspartic proteinase, aspartyl pro 93.15
3pvk_A342 Candidapepsin-2; hydrolase; 1.27A {Candida albican 93.09
1miq_A375 Plasmepsin; aspartic proteinase zymogen, domain op 92.99
2x0b_A383 Renin; hydrolase-hormone complex, hydrolase hormon 92.91
3c9x_A329 Trichoderma reesei aspartic protease; aspartic pro 92.91
1tzs_A351 Cathepsin E; hydrolase, aspartic protease, activat 92.88
1t6e_X381 Xylanase inhibitor; two beta-barrel domain structu 92.74
1j71_A334 Candidapepsin, aspartic proteinase; candida tropic 92.6
3psg_A370 Pepsinogen; hydrolase(acid proteinase zymogen); 1. 91.79
2bju_A453 Plasmepsin II; aspartic proteinase, drug design, m 91.78
3vla_A 413 EDGP; extracellular, inhibitor, plant protein; HET 89.96
>3s8i_A Protein DDI1 homolog 1; protease, structural genomics, structural genomics consortiu retropepsin-like domain, protein turnover, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=3.9e-35  Score=213.77  Aligned_cols=125  Identities=78%  Similarity=1.237  Sum_probs=113.8

Q ss_pred             CeEEEEEECCEEEEEEEecCCCceecCHHHHHHcCceeeecceeeeEeeccceeEEEEEEEEEEEEEcCEEEeeeEEEec
Q psy18197          1 MLFINCCVNGVPVKAFVDSGAQTTIMSAECAERCAIMRLIDTRWAGVAKGVGIQRIIGRIHMVQVVIEKDFLTTSLSILE   80 (144)
Q Consensus         1 ~~~v~v~InG~~v~~LvDTGA~~s~Is~~~a~~lgl~~~~~~~~~~~a~g~g~~~~~g~i~~~~i~iG~~~~~~~~~V~~   80 (144)
                      |+|++++|||++++|||||||++|+||+++|+|||+++..+.++.+.+.|.|..+..|+++.++++||+++++++|.|++
T Consensus        24 ~l~v~~~Ing~~v~~LVDTGAs~s~Is~~~A~rlGL~~~~~~~~~~~a~g~G~~~~~g~v~~~~I~Ig~~~~~~~~~Vle  103 (148)
T 3s8i_A           24 MLYINCKVNGHPLKAFVDSGAQMTIMSQACAERCNIMRLVDRRWAGVAKGVGTQRIIGRVHLAQIQIEGDFLQCSFSILE  103 (148)
T ss_dssp             CCEEEEEETTEEEEEEECTTCSSCEEEHHHHHHTTCGGGEEGGGCEECCC---CEEEEEEEEEEEEETTEEEEEEEEEET
T ss_pred             EEEEEEEECCEEEEEEEeCCCCcEeeCHHHHHHcCCccccCcceeEEEEcCCccEEEEEEEEEEEEECCEEEEEEEEEeC
Confidence            68999999999999999999999999999999999976556655557788887888999999999999999999999999


Q ss_pred             CCCCceEeeechhheecEEEEcCCCEEEEccCCeEEEeecCCCcC
Q psy18197         81 EQPMDMLLGLDMLRRHQCCIDLKRNVLRIGTTGTETRFLSESELP  125 (144)
Q Consensus        81 ~~~~d~ILG~d~L~~~~~~iD~~~~~l~~~~~~~~~~~~~~~~~~  125 (144)
                      ..+.|+|||||||++++++||+++++|+++++++++||++.+|+|
T Consensus       104 ~~~~d~LLGmD~L~~~~~~ID~~~~~L~l~~~~~~~pfl~~~~~~  148 (148)
T 3s8i_A          104 DQPMDMLLGLDMLRRHQCSIDLKKNVLVIGTTGTQTYFLPEGELP  148 (148)
T ss_dssp             TCSSSEEECHHHHHHTTCEEETTTTEEECTTTCCEEECCCGGGCC
T ss_pred             CCCcCeeccHHHHHhCCEEEEcCCCEEEEccCCeEEeecCcccCc
Confidence            888999999999999999999999999999988999999999987
>2i1a_A DNA damage-inducible protein DDI1; acid protease fold, dimer, retroviral protease domain, protein turnover; HET: DNA; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1fmb_A EIAV protease; hydrolase (acid proteinase), RNA-directed DNA polymerase, AS protease, endonuclease, polyprotein; HET: HYB; 1.80A {Equine infectious anemia virus} SCOP: b.50.1.1 PDB: 2fmb_A* Back     alignment and structure
>3slz_A GAG-Pro-POL polyprotein; beta sheet and dimer, protease, peptide inhibitor, TL-3 PEPS virus, hydrolase-hydrolase inhibitor complex; HET: 3TL; 1.40A {Dg-75 murine leukemia virus} PDB: 3nr6_A* 3sm1_A* 3sm2_A* 4exh_A* Back     alignment and structure
>3ec0_A Protease; HIV-2, inhibitor, hydrolase; HET: GRL; 1.18A {Human immunodeficiency virus type 2} SCOP: b.50.1.1 PDB: 1hii_A* 1hsi_A 1hsh_A* 1idb_A* 1jld_A* 2mip_A 1ida_A* 3ebz_A* 3ecg_A* 3s45_A* 4upj_A* 1ivq_A* 1ivp_A 2hpf_A 3upj_A* 2hpe_A* 5upj_A* 6upj_A* 1sip_A 1tcw_A* ... Back     alignment and structure
>2hs1_A HIV-1 protease; ultra-high resolution active site surface binding site, HYDR; HET: 017; 0.84A {Human immunodeficiency virus 1} PDB: 3nu4_A* 3tl9_A* 3tkw_A* 3tkg_A* 3ndu_A* 3ndt_A* 3k4v_A* 3a2o_A* 1fgc_C* 2a1e_A* 2aod_A* 2aoi_A* 2aoj_A* 2hb3_A* 2ien_A* 1sdt_A* 2z4o_A* 2zye_A* 2nmw_A* 3b7v_A* ... Back     alignment and structure
>3ka2_A [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydrolase-hydrolase inhibitor complex; HET: YCM 2NC; 1.40A {Synthetic} PDB: 3fsm_A* 3gi0_A* 2o40_A* 3hzc_A* 3hlo_A* 3iaw_A* 3nxe_A* 3nxn_A* 4epj_A 4ep2_A 4ep3_A 4eq0_A 4eqj_A 1hvc_A* 1g6l_A 2whh_A* 1lv1_A* 3dox_A 3kt5_A 3kt2_A ... Back     alignment and structure
>2hah_A Protease, retropepsin; retroviral, aspartyl, hydrolase-hydrolase complex; HET: 3TL; 1.70A {Feline immunodeficiency virus} PDB: 3ogp_A* 3ogq_A* 2fiv_A* 6fiv_A* 3fiv_A* 5fiv_A* 4fiv_A* 1fiv_A* 1b11_A* Back     alignment and structure
>3ka2_A [L-Ala51;Gly51']HIV-1 protease; beta-barrel, hydrolase-hydrolase inhibitor complex; HET: YCM 2NC; 1.40A {Synthetic} PDB: 3fsm_A* 3gi0_A* 2o40_A* 3hzc_A* 3hlo_A* 3iaw_A* 3nxe_A* 3nxn_A* 4epj_A 4ep2_A 4ep3_A 4eq0_A 4eqj_A 1hvc_A* 1g6l_A 2whh_A* 1lv1_A* 3dox_A 3kt5_A 3kt2_A ... Back     alignment and structure
>3sqf_A Protease; folded monomer, retropepsin, D-type retrovirus; 1.63A {Mason-pfizer monkey virus} SCOP: b.50.1.1 PDB: 1nso_A Back     alignment and structure
>2rsp_A RSV protease; hydrolase(aspartyl proteinase); 2.00A {Rous sarcoma virus} SCOP: b.50.1.1 PDB: 1mvp_A 1bai_A* Back     alignment and structure
>2pma_A Uncharacterized protein; APC86035.2, protein LPG0085, DUF785, legionella pneumophila pneumophila STR. philadelphia 1; 1.89A {Legionella pneumophila subsp} SCOP: b.50.1.3 Back     alignment and structure
>3liy_A Protease; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.86A {Human t-lymphotropic virus 1} PDB: 2b7f_A* 3liq_A* 3lit_A* 3liv_A* 3lix_A* 3lin_A* Back     alignment and structure
>1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A Back     alignment and structure
>1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* Back     alignment and structure
>3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Back     alignment and structure
>1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 Back     alignment and structure
>2jys_A Protease/reverse transcriptase; retroviral protease, hydrolase; NMR {Simian foamy virus type 1} Back     alignment and structure
>1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* Back     alignment and structure
>2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Back     alignment and structure
>2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Back     alignment and structure
>3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Back     alignment and structure
>1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... Back     alignment and structure
>1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Back     alignment and structure
>3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... Back     alignment and structure
>3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Back     alignment and structure
>1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Back     alignment and structure
>4aa9_A Chymosin; hydrolase, aspartic peptidase, rennet; HET: NAG; 1.60A {Camelus dromedarius} PDB: 4aa8_A 1czi_E* 1cms_A 4cms_A 3cms_A Back     alignment and structure
>1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* Back     alignment and structure
>1b5f_A Protein (cardosin A); hydrolase, aspartic proteinase; HET: NAG FUC BMA MAN; 1.72A {Cynara cardunculus} SCOP: b.50.1.2 Back     alignment and structure
>1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Back     alignment and structure
>3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A Back     alignment and structure
>1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* Back     alignment and structure
>3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} SCOP: b.50.1.0 PDB: 3tne_A* Back     alignment and structure
>3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} SCOP: b.50.1.2 PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* Back     alignment and structure
>1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A Back     alignment and structure
>2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A Back     alignment and structure
>1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 Back     alignment and structure
>2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} Back     alignment and structure
>1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 Back     alignment and structure
>3aup_A SBG7S, BG, basic 7S globulin; pepsin-like fold, plant protein; 1.91A {Glycine max} Back     alignment and structure
>1qdm_A Prophytepsin; aspartic proteinases, saposin-like domain, zymogen structure, hydrolase; 2.30A {Hordeum vulgare} SCOP: a.64.1.2 b.50.1.2 Back     alignment and structure
>2ewy_A Beta-secretase 2; BACE2, aspartic protease, hydrolase; HET: DBO; 3.10A {Homo sapiens} Back     alignment and structure
>3cms_A Chymosin B; hydrolase, acid proteinase; 2.00A {Bos taurus} SCOP: b.50.1.2 PDB: 4cms_A 1czi_E* 1cms_A Back     alignment and structure
>1lya_A Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_A* 1lyw_A* Back     alignment and structure
>2qp8_A Beta-secretase 1; BACE1, protease, alternative splicing, aspartyl protease, glycoprotein, hydrolase, membrane, transmembrane, zymogen; HET: TAR SC7; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 2qk5_A* 2qmf_A* 2qmg_A* 2qmd_A* 4djx_A* 3l59_A* 3l5b_A* 3l5c_A* 3l58_A* 3l5d_A* 3l5f_A* 4dju_A* 4djv_A* 4djw_A* 3l5e_A* 4djy_A* 2zhv_A 2zhs_A 2zhr_A 2zhu_A ... Back     alignment and structure
>3vf3_A Beta-secretase 1; structure-based drug design, hydrolase-hydrolase inhibitor C; HET: 0GS; 1.48A {Homo sapiens} PDB: 2f3e_A* 2f3f_A* 1ym2_A* 3dv1_A* 3dv5_A* 3k5c_A* 3k5f_A* 3k5g_A* 3pi5_A* 3qbh_A* 3duy_A* 3veu_A* 3vg1_A* 4d83_A* 4d88_A* 4d89_A* 4d8c_A* 3msk_A* 3k5d_A* 1ym4_A* ... Back     alignment and structure
>3lpj_A Beta-secretase 1; alzheimer'S, aspartyl protease, hydrolase; HET: TLA Z75; 1.79A {Homo sapiens} PDB: 3lpi_A* 3lpk_A* 3ohf_A* 3ohh_A* 3r2f_A* 3skf_A* 3skg_A* 4fse_A* 2hiz_A* 2p83_A* 2va7_A* 2va5_A* 2va6_A* Back     alignment and structure
>1lya_B Cathepsin D; lysosomal aspartic protease; HET: NAG BMA MAN; 2.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 1lyb_B* 1lyw_B* Back     alignment and structure
>4aa9_A Chymosin; hydrolase, aspartic peptidase, rennet; HET: NAG; 1.60A {Camelus dromedarius} PDB: 4aa8_A 1czi_E* 1cms_A 4cms_A 3cms_A Back     alignment and structure
>1yg9_A Aspartic protease BLA G 2; allegren, hydrolase, allergen; HET: NAG; 1.30A {Blattella germanica} PDB: 2nr6_A* 3liz_A* Back     alignment and structure
>1dpj_A Proteinase A; proteinase A, hydrolase-hydrolase inhibitor COM; HET: BMA MAN NAG; 1.80A {Saccharomyces cerevisiae} SCOP: b.50.1.2 PDB: 1dp5_A* 1fmu_A* 1fmx_A* 1fq5_A* 1fq4_A* 1fq6_A* 1fq7_A* 1fq8_A* 2jxr_A* 1g0v_A* Back     alignment and structure
>1am5_A Pepsin, acid proteinase; aspartyl protease, hydrolase; 2.16A {Gadus morhua} SCOP: b.50.1.2 Back     alignment and structure
>1wkr_A Polyporopepsin; hydrolase, hydrolase-hydrolase inhibitor complex; HET: STA; 1.30A {Irpex lacteus} SCOP: b.50.1.2 Back     alignment and structure
>1mpp_A Pepsin; hydrolase(acid proteinase); 2.00A {Rhizomucor pusillus} SCOP: b.50.1.2 PDB: 2asi_A* 2rmp_A* Back     alignment and structure
>3k1w_A Renin; protease, alternative splicing, aspartyl protease, cleavage on PAIR of basic residues, disease mutation, disulfide bond, glycoprotein; HET: BFX NDG HSQ; 1.50A {Homo sapiens} SCOP: b.50.1.2 PDB: 3d91_A* 3g70_A* 3g6z_A* 3own_A* 2iko_A* 1bbs_A* 1rne_A* 2bkt_A* 2bks_A* 2iku_A* 2il2_A* 2ren_A* 2v0z_C* 2v10_C* 2v11_C* 2v12_C* 2v13_A* 2v16_C* 3g72_A* 3oot_A* ... Back     alignment and structure
>1bxo_A Protein (penicillopepsin); hydrolase, phosphonate inhibitors, macrocycle; HET: MAN PP7; 0.95A {Penicillium janthinellum} SCOP: b.50.1.2 PDB: 1apu_E* 1apv_E* 1apw_E* 1apt_E* 1bxq_A* 1ppk_E* 1ppl_E* 1ppm_E* 2wea_A* 2web_A* 2wec_A* 2wed_A* 3app_A Back     alignment and structure
>1htr_B Gastricsin; aspartyl protease; 1.62A {Homo sapiens} SCOP: b.50.1.2 PDB: 1avf_A Back     alignment and structure
>3fv3_A SAPP1P-secreted aspartic protease 1; secreted aspartic protease, virulence factor, H; HET: STA; 1.85A {Candida parapsilosis} SCOP: b.50.1.0 PDB: 3tne_A* Back     alignment and structure
>1izd_A Aspartic proteinase; sugar binding, acid protease, hydrolase; HET: MAN; 1.90A {Aspergillus oryzae} SCOP: b.50.1.2 PDB: 1ize_A* Back     alignment and structure
>1ibq_A Aspergillopepsin; aspartic proteinase, hydrolase; HET: MAN; 2.14A {Aspergillus phoenicis} SCOP: b.50.1.2 Back     alignment and structure
>3qvc_A Histo-aspartic protease; HAP, plasmepsin, zymogen, hydrolase; 2.10A {Plasmodium falciparum} PDB: 3qvi_A* 3fns_A 3fnt_A* 3fnu_A* Back     alignment and structure
>1oew_A Endothiapepsin; hydrolase, aspartic proteinase mechanism, atomic resolution, succinimide, anisotropic refinement; HET: SUI; 0.9A {Cryphonectria parasitica} SCOP: b.50.1.2 PDB: 1gkt_A* 1gvt_A* 1gvv_A* 1gvw_A* 1gvx_A* 1gvu_A* 1oex_A* 2jji_A* 2jjj_A* 2vs2_A* 3uri_A* 3urj_A* 3url_A* 3pww_A* 1e80_E* 1e81_E* 1e82_E* 1e5o_E* 1eed_P* 1epl_E* ... Back     alignment and structure
>2apr_A Rhizopuspepsin; hydrolase (aspartic proteinase); 1.80A {Rhizopus microsporus var} SCOP: b.50.1.2 PDB: 3apr_E* 4apr_E* 5apr_E* 6apr_E* 1uh9_A 1uh8_A 1uh7_A Back     alignment and structure
>2qzx_A Candidapepsin-5; aspartic proteinase, aspartyl protease, CL PAIR of basic residues, glycoprotein, protease, secreted; HET: STA; 2.50A {Candida albicans} Back     alignment and structure
>3pvk_A Candidapepsin-2; hydrolase; 1.27A {Candida albicans} SCOP: b.50.1.2 PDB: 1eag_A 3q70_A* 1zap_A* 2qzw_A 2h6t_A* 2h6s_A* Back     alignment and structure
>1miq_A Plasmepsin; aspartic proteinase zymogen, domain opening, hydrolase; 2.50A {Plasmodium vivax} SCOP: b.50.1.2 PDB: 1ls5_A* Back     alignment and structure
>2x0b_A Renin; hydrolase-hormone complex, hydrolase hormone complex, vasoconstrictor, glycoprotein, hypertension, serpins; 4.33A {Homo sapiens} Back     alignment and structure
>3c9x_A Trichoderma reesei aspartic protease; aspartic proteinase, aspartyl protease, hydrolase; 1.70A {Trichoderma reesei} PDB: 3c9y_A* 3emy_A* Back     alignment and structure
>1tzs_A Cathepsin E; hydrolase, aspartic protease, activation intermediate; 2.35A {Homo sapiens} Back     alignment and structure
>1t6e_X Xylanase inhibitor; two beta-barrel domain structure, hydrolase inhibitor; 1.70A {Triticum aestivum} SCOP: b.50.1.2 PDB: 1t6g_A 2b42_A 3hd8_A Back     alignment and structure
>1j71_A Candidapepsin, aspartic proteinase; candida tropicalis aspartic protease, SAPT1, hydrolase; 1.80A {Candida tropicalis} SCOP: b.50.1.2 Back     alignment and structure
>3psg_A Pepsinogen; hydrolase(acid proteinase zymogen); 1.65A {Sus scrofa} SCOP: b.50.1.2 PDB: 2psg_A 4pep_A* 3pep_A* 1f34_A* 1psa_A* 1yx9_A 5pep_A 1flh_A 1qrp_E* 1psn_A* 1pso_E* 3utl_A Back     alignment and structure
>2bju_A Plasmepsin II; aspartic proteinase, drug design, malaria, aspartyl protease, glycoprotein, hydrolase, signal, zymogen; HET: IH4; 1.56A {Plasmodium falciparum} SCOP: b.50.1.2 PDB: 1pfz_A 1xdh_A* 1lf3_A 1w6h_A* 1w6i_A* 1lf4_A* 1lf2_A* 1lee_A* 1m43_A* 2igx_A* 1sme_A* 1me6_A* 1xe6_A* 1xe5_A* 2igy_A* 2r9b_A 3f9q_A 3qrv_A 3qs1_A* 2anl_A* ... Back     alignment and structure
>3vla_A EDGP; extracellular, inhibitor, plant protein; HET: NAG; 0.95A {Daucus carota} PDB: 3vlb_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query144
d2fmba_104 EIAV protease {Equine infectious anemia virus [Tax 99.42
d4fiva_113 Feline immunodeficiency virus (FIV) protease {Feli 99.28
d1hvca_203 Human immunodeficiency virus type 1 protease {Huma 99.16
d2nmza199 Human immunodeficiency virus type 1 protease {Huma 99.13
d3ecga199 Human immunodeficiency virus type 2 (HIV-2) protea 99.02
d1nsoa_107 Mason-Pfizer monkey virus protease {Simian retrovi 98.98
d1hvca_203 Human immunodeficiency virus type 1 protease {Huma 98.56
d2rspa_124 Rous sarcoma virus protease {Rous sarcoma virus, s 98.28
d2pmaa1141 Uncharacterized protein LPG0085 {Legionella pneumo 97.73
d1bxoa_323 Acid protease {Fungus (Penicillium janthinellum), 96.12
d1oewa_ 330 Endothiapepsin {Chestnut blight fungus (Endothia p 95.99
d1bxoa_ 323 Acid protease {Fungus (Penicillium janthinellum), 95.94
d1izea_ 323 Acid protease {Fungus (Aspergillus oryzae) [TaxId: 95.88
d1smra_ 335 Chymosin (synonym: renin) {Mouse (Mus musculus) [T 95.83
d1izea_323 Acid protease {Fungus (Aspergillus oryzae) [TaxId: 95.73
d2apra_ 325 Acid protease {Bread mold (Rhizopus chinensis) [Ta 95.64
d3psga_ 370 Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} 95.58
d1wkra_ 340 Acid protease {Irpex lacteus (Polyporus tulipifera 95.58
d2apra_325 Acid protease {Bread mold (Rhizopus chinensis) [Ta 95.13
d2bjua1 329 Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo 95.09
d1j71a_334 Acid protease {Yeast (Candida tropicalis) [TaxId: 94.89
d1dpja_329 Acid protease {Baker's yeast (Saccharomyces cerevi 94.6
d1wkra_340 Acid protease {Irpex lacteus (Polyporus tulipifera 94.58
d1eaga_342 Acid protease {Yeast (Candida albicans) [TaxId: 54 94.43
d3cmsa_323 Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId 94.35
g1htr.1 372 Pepsin(ogen) {Human (Homo sapiens), progastricsin 93.85
d1miqa_373 Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo 93.71
d2bjua1329 Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo 93.71
d1j71a_ 334 Acid protease {Yeast (Candida tropicalis) [TaxId: 93.56
d1am5a_324 Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 93.54
d1dpja_ 329 Acid protease {Baker's yeast (Saccharomyces cerevi 93.43
d1miqa_ 373 Plasmepsin (a hemoglobin-degrading enzyme) {Plasmo 93.43
g1lya.1 338 Cathepsin D {Human (Homo sapiens) [TaxId: 9606]} 93.29
g1htr.1372 Pepsin(ogen) {Human (Homo sapiens), progastricsin 92.89
d1mppa_357 Pepsin {Mucor pusillus [TaxId: 4840]} 92.74
d1hrna_ 337 Chymosin (synonym: renin) {Human (Homo sapiens) [T 92.69
d1eaga_ 342 Acid protease {Yeast (Candida albicans) [TaxId: 54 92.65
d1oewa_330 Endothiapepsin {Chestnut blight fungus (Endothia p 92.61
d2qp8a1 387 beta-secretase (memapsin) {Human (Homo sapiens) [T 92.4
d3psga_370 Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} 92.02
d1t6ex_381 Xylanase inhibitor TAXI-I {Wheat (Triticum aestivu 91.98
d1hrna_337 Chymosin (synonym: renin) {Human (Homo sapiens) [T 91.27
d2qp8a1387 beta-secretase (memapsin) {Human (Homo sapiens) [T 91.09
d1smra_335 Chymosin (synonym: renin) {Mouse (Mus musculus) [T 91.07
g1lya.1338 Cathepsin D {Human (Homo sapiens) [TaxId: 9606]} 90.66
d1qdma2337 Plant acid proteinase, phytepsin {Barley (Hordeum 86.26
d3cmsa_ 323 Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId 85.99
d1am5a_ 324 Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 84.11
d1mppa_ 357 Pepsin {Mucor pusillus [TaxId: 4840]} 82.79
d1qdma2 337 Plant acid proteinase, phytepsin {Barley (Hordeum 82.32
g1b5f.1 326 Plant acid proteinase, phytepsin {Cynara carduncul 80.35
>d2fmba_ b.50.1.1 (A:) EIAV protease {Equine infectious anemia virus [TaxId: 11665]} Back     information, alignment and structure
class: All beta proteins
fold: Acid proteases
superfamily: Acid proteases
family: Retroviral protease (retropepsin)
domain: EIAV protease
species: Equine infectious anemia virus [TaxId: 11665]

Probab=99.42  E-value=5.7e-13  Score=89.63  Aligned_cols=94  Identities=18%  Similarity=0.254  Sum_probs=66.5

Q ss_pred             eEEEEEECCEEEEEEEecCCCceecCHHHHHHcCceeeecceeeeEeeccceeEEEEEEEEEEEEEcCEEEeeeEEEecC
Q psy18197          2 LFINCCVNGVPVKAFVDSGAQTTIMSAECAERCAIMRLIDTRWAGVAKGVGIQRIIGRIHMVQVVIEKDFLTTSLSILEE   81 (144)
Q Consensus         2 ~~v~v~InG~~v~~LvDTGA~~s~Is~~~a~~lgl~~~~~~~~~~~a~g~g~~~~~g~i~~~~i~iG~~~~~~~~~V~~~   81 (144)
                      +.++++|||++++||+||||++|+|+...+.+...... ..... ...|.|.. ..-+...+++++.+......+.|.+ 
T Consensus         9 P~~~i~I~Gq~v~~LLDTGAD~TVI~~~~~p~~~~~~~-~~~~~-~igg~g~~-~~~~~~~v~i~~~g~~~~~~~lV~p-   84 (104)
T d2fmba_           9 PTTIVLINDTPLNVLLDTGADTSVLTTAHYNRLKYRGR-KYQGT-GIGGVGGN-VETFSTPVTIKKKGRHIKTRMLVAD-   84 (104)
T ss_dssp             CEEEEEETTEEEEEEECTTCSSCEEEHHHHHHCSSCCC-CEECC-CEEETTEE-ECCEEEEEEEEETTEEEEEEEEEES-
T ss_pred             eEEEEEECCEEEEEEEeCCCCeEEEcccccCccCCCCC-Cccee-EEEEecce-EEEEEEEEEEEECCeEEEEEEEECC-
Confidence            46899999999999999999999999999987654221 11111 22333332 1112234678888888888888887 


Q ss_pred             CCCceEeeechhheecEEE
Q psy18197         82 QPMDMLLGLDMLRRHQCCI  100 (144)
Q Consensus        82 ~~~d~ILG~d~L~~~~~~i  100 (144)
                      .+. =|||.|.|.++++.+
T Consensus        85 ~Pv-nLlGRdlL~qlG~~L  102 (104)
T d2fmba_          85 IPV-TILGRDILQDLGAKL  102 (104)
T ss_dssp             CSS-CEECHHHHHHHTCCC
T ss_pred             CCc-ceecHHHHHHhCCEE
Confidence            333 499999999999865
>d4fiva_ b.50.1.1 (A:) Feline immunodeficiency virus (FIV) protease {Feline immunodeficiency virus [TaxId: 11673]} Back     information, alignment and structure
>d1hvca_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} Back     information, alignment and structure
>d2nmza1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} Back     information, alignment and structure
>d3ecga1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 2 (HIV-2) protease {Human immunodeficiency virus type 2 [TaxId: 11709]} Back     information, alignment and structure
>d1nsoa_ b.50.1.1 (A:) Mason-Pfizer monkey virus protease {Simian retrovirus 1, SRV-1 [TaxId: 11942]} Back     information, alignment and structure
>d1hvca_ b.50.1.1 (A:) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]} Back     information, alignment and structure
>d2rspa_ b.50.1.1 (A:) Rous sarcoma virus protease {Rous sarcoma virus, strain pr-C [TaxId: 11886]} Back     information, alignment and structure
>d2pmaa1 b.50.1.3 (A:26-166) Uncharacterized protein LPG0085 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} Back     information, alignment and structure
>d1bxoa_ b.50.1.2 (A:) Acid protease {Fungus (Penicillium janthinellum), penicillopepsin [TaxId: 5079]} Back     information, alignment and structure
>d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} Back     information, alignment and structure
>d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1izea_ b.50.1.2 (A:) Acid protease {Fungus (Aspergillus oryzae) [TaxId: 5062]} Back     information, alignment and structure
>d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} Back     information, alignment and structure
>d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} Back     information, alignment and structure
>d2apra_ b.50.1.2 (A:) Acid protease {Bread mold (Rhizopus chinensis) [TaxId: 4843]} Back     information, alignment and structure
>d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} Back     information, alignment and structure
>d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} Back     information, alignment and structure
>d1wkra_ b.50.1.2 (A:) Acid protease {Irpex lacteus (Polyporus tulipiferae), Polyporopepsin [TaxId: 5319]} Back     information, alignment and structure
>d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d2bjua1 b.50.1.2 (A:1-329) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium falciparum, plasmepsin II [TaxId: 5833]} Back     information, alignment and structure
>d1j71a_ b.50.1.2 (A:) Acid protease {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} Back     information, alignment and structure
>d1dpja_ b.50.1.2 (A:) Acid protease {Baker's yeast (Saccharomyces cerevisiae), proteinase A [TaxId: 4932]} Back     information, alignment and structure
>d1miqa_ b.50.1.2 (A:) Plasmepsin (a hemoglobin-degrading enzyme) {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Back     information, alignment and structure
>d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eaga_ b.50.1.2 (A:) Acid protease {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1oewa_ b.50.1.2 (A:) Endothiapepsin {Chestnut blight fungus (Endothia parasitica) [TaxId: 5116]} Back     information, alignment and structure
>d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3psga_ b.50.1.2 (A:) Pepsin(ogen) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1t6ex_ b.50.1.2 (X:) Xylanase inhibitor TAXI-I {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
>d1hrna_ b.50.1.2 (A:) Chymosin (synonym: renin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qp8a1 b.50.1.2 (A:60-446) beta-secretase (memapsin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1smra_ b.50.1.2 (A:) Chymosin (synonym: renin) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure
>d3cmsa_ b.50.1.2 (A:) Chymosin (synonym: renin) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1am5a_ b.50.1.2 (A:) Pepsin(ogen) {Atlantic cod (Gadus morhua) [TaxId: 8049]} Back     information, alignment and structure
>d1mppa_ b.50.1.2 (A:) Pepsin {Mucor pusillus [TaxId: 4840]} Back     information, alignment and structure
>d1qdma2 b.50.1.2 (A:2-247,A:248-338) Plant acid proteinase, phytepsin {Barley (Hordeum vulgare) [TaxId: 4513]} Back     information, alignment and structure