Psyllid ID: psy1844


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
LNAFFAKELTKYQPISEDPKSTLNSLRYRGLDGFVAAVSPFNFTAIGGNLAYTPALMGSSVLWKPSDTALLSNYTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVP
ccHHHHHHHHHHccccccccccccEEEEEcccEEEEEEccccHHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHHHccccccEEEEccccHHHHHHHHHcccccEEEEEcccc
ccHHHHHHHHHcccccccccccEEEEEEccccEEEEEEccccHHHHHcccccccHHcccEEEEEccccccHHHHHHHHHHHHHccccccEEEcccccccHHHHHHccccccEEEEEcccc
LNAFFAKEltkyqpisedpkstlnslryrgldgfvaavspfnftaiggnlaytpalmgssvlwkpsdtallsNYTIYKIMIeagvppgvvnfvpadgpvfgdtitaspylaginftgsvp
lnaffakeltkyqpisedpkstLNSLRYRGLDGFVAAVSPFNFTAIGGNLAYTPALMGSSVLWKPSDTALLSNYTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVP
LNAFFAKELTKYQPISEDPKSTLNSLRYRGLDGFVAAVSPFNFTAIGGNLAYTPALMGSSVLWKPSDTALLSNYTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVP
***********************NSLRYRGLDGFVAAVSPFNFTAIGGNLAYTPALMGSSVLWKPSDTALLSNYTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFT****
LNAFFAKELTKYQPI****KSTLNSLRYRGLDGFVAAVSPFNFTAIGGNLAYTPALMGSSVLWKPSDTALLSNYTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSV*
LNAFFAKELTKYQPISEDPKSTLNSLRYRGLDGFVAAVSPFNFTAIGGNLAYTPALMGSSVLWKPSDTALLSNYTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVP
LNAFFAKELTKYQPISEDPKSTLNSLRYRGLDGFVAAVSPFNFTAIGGNLAYTPALMGSSVLWKPSDTALLSNYTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSV*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LNAFFAKELTKYQPISEDPKSTLNSLRYRGLDGFVAAVSPFNFTAIGGNLAYTPALMGSSVLWKPSDTALLSNYTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query120 2.2.26 [Sep-21-2011]
A7YWE4 563 Delta-1-pyrroline-5-carbo yes N/A 0.983 0.209 0.666 3e-42
P0C2X9 563 Delta-1-pyrroline-5-carbo yes N/A 0.983 0.209 0.675 2e-41
P30038 563 Delta-1-pyrroline-5-carbo yes N/A 0.983 0.209 0.666 3e-41
Q7SY23 556 Delta-1-pyrroline-5-carbo yes N/A 0.983 0.212 0.658 4e-41
Q8CHT0 562 Delta-1-pyrroline-5-carbo yes N/A 0.983 0.209 0.666 5e-41
Q9P8I0 572 Delta-1-pyrroline-5-carbo yes N/A 0.941 0.197 0.482 4e-26
Q54RA2 558 Delta-1-pyrroline-5-carbo yes N/A 0.975 0.209 0.466 1e-25
P07275 575 Delta-1-pyrroline-5-carbo yes N/A 0.941 0.196 0.5 8e-25
O74766 548 Probable delta-1-pyrrolin yes N/A 0.975 0.213 0.483 3e-24
P78568 546 Delta-1-pyrroline-5-carbo N/A N/A 0.933 0.205 0.5 2e-23
>sp|A7YWE4|AL4A1_BOVIN Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Bos taurus GN=ALDH4A1 PE=2 SV=1 Back     alignment and function desciption
 Score =  170 bits (430), Expect = 3e-42,   Method: Composition-based stats.
 Identities = 80/120 (66%), Positives = 98/120 (81%), Gaps = 2/120 (1%)

Query: 1   LNAFFAKELTKYQPISEDPKSTLNSLRYRGLDGFVAAVSPFNFTAIGGNLAYTPALMGSS 60
            NA FA EL   QP+S  P +  NS+ YRGL+GFVAA+SPFNFTAIGGNLA  PALMG+ 
Sbjct: 172 FNAKFAMELEGEQPLSVPPST--NSMLYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNV 229

Query: 61  VLWKPSDTALLSNYTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVP 120
           VLWKPSDTA+L++Y +Y+I+ EAG+PP ++ FVPADGP FGDT+T+S +L GINFTGSVP
Sbjct: 230 VLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPTFGDTVTSSEHLCGINFTGSVP 289




Irreversible conversion of delta-1-pyrroline-5-carboxylate (P5C), derived either from proline or ornithine, to glutamate. This is a necessary step in the pathway interconnecting the urea and tricarboxylic acid cycles. The preferred substrate is glutamic gamma-semialdehyde, other substrates include succinic, glutaric and adipic semialdehydes.
Bos taurus (taxid: 9913)
EC: 1EC: .EC: 5EC: .EC: 1EC: .EC: 1EC: 2
>sp|P0C2X9|AL4A1_RAT Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Aldh4a1 PE=1 SV=1 Back     alignment and function description
>sp|P30038|AL4A1_HUMAN Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Homo sapiens GN=ALDH4A1 PE=1 SV=3 Back     alignment and function description
>sp|Q7SY23|AL4A1_DANRE Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Danio rerio GN=aldh4a1 PE=2 SV=1 Back     alignment and function description
>sp|Q8CHT0|AL4A1_MOUSE Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Mus musculus GN=Aldh4a1 PE=1 SV=3 Back     alignment and function description
>sp|Q9P8I0|PUT2_EMENI Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prnC PE=3 SV=2 Back     alignment and function description
>sp|Q54RA2|AL4A1_DICDI Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Dictyostelium discoideum GN=DDB_G0283293 PE=3 SV=1 Back     alignment and function description
>sp|P07275|PUT2_YEAST Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PUT2 PE=1 SV=2 Back     alignment and function description
>sp|O74766|PUT2_SCHPO Probable delta-1-pyrroline-5-carboxylate dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC24C6.04 PE=1 SV=1 Back     alignment and function description
>sp|P78568|PUT2_AGABI Delta-1-pyrroline-5-carboxylate dehydrogenase OS=Agaricus bisporus GN=pruA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query120
328698360 535 PREDICTED: delta-1-pyrroline-5-carboxyla 1.0 0.224 0.9 1e-57
91084231 568 PREDICTED: similar to pyrroline-5-carbox 1.0 0.211 0.85 2e-54
357528293 398 pyrroline-5-carboxylate dehydrogenase [L 1.0 0.301 0.85 4e-54
312375387 613 hypothetical protein AND_14227 [Anophele 1.0 0.195 0.825 1e-53
194876019 574 GG13195 [Drosophila erecta] gi|190655482 1.0 0.209 0.833 1e-53
195377365 569 GJ13456 [Drosophila virilis] gi|19415461 1.0 0.210 0.841 2e-53
195348687 574 GM22106 [Drosophila sechellia] gi|194122 1.0 0.209 0.833 2e-53
195496644 573 GE19517 [Drosophila yakuba] gi|194181881 1.0 0.209 0.833 2e-53
195552912 574 GD17558 [Drosophila simulans] gi|1942021 1.0 0.209 0.833 2e-53
24668413 574 delta-1-Pyrroline-5-carboxylate dehydrog 1.0 0.209 0.833 3e-53
>gi|328698360|ref|XP_001952392.2| PREDICTED: delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  226 bits (576), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 114/120 (95%)

Query: 1   LNAFFAKELTKYQPISEDPKSTLNSLRYRGLDGFVAAVSPFNFTAIGGNLAYTPALMGSS 60
           LNAFFAKELTKYQPISE+   TLNSLRYRGLDGFVAAVSPFNFTAIGGNLAYTPALMG S
Sbjct: 177 LNAFFAKELTKYQPISENKNVTLNSLRYRGLDGFVAAVSPFNFTAIGGNLAYTPALMGCS 236

Query: 61  VLWKPSDTALLSNYTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVP 120
           VLWKPSDTALLSN+ IY+IM EAGVPPGVVNF+PADGPVFGDTITASP+L+GINFTGSVP
Sbjct: 237 VLWKPSDTALLSNWVIYEIMTEAGVPPGVVNFIPADGPVFGDTITASPHLSGINFTGSVP 296




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91084231|ref|XP_969408.1| PREDICTED: similar to pyrroline-5-carboxylate dehydrogenase [Tribolium castaneum] gi|270008791|gb|EFA05239.1| hypothetical protein TcasGA2_TC015385 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357528293|gb|AET80385.1| pyrroline-5-carboxylate dehydrogenase [Leptinotarsa decemlineata] Back     alignment and taxonomy information
>gi|312375387|gb|EFR22772.1| hypothetical protein AND_14227 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|194876019|ref|XP_001973699.1| GG13195 [Drosophila erecta] gi|190655482|gb|EDV52725.1| GG13195 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195377365|ref|XP_002047461.1| GJ13456 [Drosophila virilis] gi|194154619|gb|EDW69803.1| GJ13456 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195348687|ref|XP_002040879.1| GM22106 [Drosophila sechellia] gi|194122389|gb|EDW44432.1| GM22106 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195496644|ref|XP_002095780.1| GE19517 [Drosophila yakuba] gi|194181881|gb|EDW95492.1| GE19517 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195552912|ref|XP_002076564.1| GD17558 [Drosophila simulans] gi|194202175|gb|EDX15751.1| GD17558 [Drosophila simulans] Back     alignment and taxonomy information
>gi|24668413|ref|NP_730695.1| delta-1-Pyrroline-5-carboxylate dehydrogenase 1, isoform A [Drosophila melanogaster] gi|24668417|ref|NP_649368.2| delta-1-Pyrroline-5-carboxylate dehydrogenase 1, isoform B [Drosophila melanogaster] gi|24668425|ref|NP_730698.1| delta-1-Pyrroline-5-carboxylate dehydrogenase 1, isoform D [Drosophila melanogaster] gi|320546182|ref|NP_001189159.1| delta-1-Pyrroline-5-carboxylate dehydrogenase 1, isoform E [Drosophila melanogaster] gi|442634086|ref|NP_001262196.1| delta-1-Pyrroline-5-carboxylate dehydrogenase 1, isoform F [Drosophila melanogaster] gi|7296504|gb|AAF51790.1| delta-1-Pyrroline-5-carboxylate dehydrogenase 1, isoform A [Drosophila melanogaster] gi|23094285|gb|AAN12191.1| delta-1-Pyrroline-5-carboxylate dehydrogenase 1, isoform B [Drosophila melanogaster] gi|23094287|gb|AAN12193.1| delta-1-Pyrroline-5-carboxylate dehydrogenase 1, isoform D [Drosophila melanogaster] gi|211938657|gb|ACJ13225.1| FI08816p [Drosophila melanogaster] gi|318069273|gb|ADV37595.1| delta-1-Pyrroline-5-carboxylate dehydrogenase 1, isoform E [Drosophila melanogaster] gi|440216173|gb|AGB94889.1| delta-1-Pyrroline-5-carboxylate dehydrogenase 1, isoform F [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query120
FB|FBgn0037138 574 P5CDh1 "delta-1-Pyrroline-5-ca 1.0 0.209 0.833 3.1e-51
UNIPROTKB|E1C8Z8 551 ALDH4A1 "Uncharacterized prote 0.975 0.212 0.705 1.2e-40
UNIPROTKB|A7YWE4 563 ALDH4A1 "Delta-1-pyrroline-5-c 0.975 0.207 0.689 2.6e-40
UNIPROTKB|I3LNB4 512 ALDH4A1 "Uncharacterized prote 0.975 0.228 0.689 3.3e-40
UNIPROTKB|D2D4A3 512 ALDH4A1 "Mitochondrial aldehyd 0.975 0.228 0.689 6.8e-40
UNIPROTKB|P30038 563 ALDH4A1 "Delta-1-pyrroline-5-c 0.975 0.207 0.689 6.8e-40
UNIPROTKB|J9P2L3 564 TAS1R2 "Taste receptor type 1 0.975 0.207 0.680 8.7e-40
RGD|1624206 563 Aldh4a1 "aldehyde dehydrogenas 0.975 0.207 0.697 8.7e-40
UNIPROTKB|F1LQ99 543 Aldh4a1 "Delta-1-pyrroline-5-c 0.975 0.215 0.697 8.7e-40
UNIPROTKB|P0C2X9 563 Aldh4a1 "Delta-1-pyrroline-5-c 0.975 0.207 0.697 8.7e-40
FB|FBgn0037138 P5CDh1 "delta-1-Pyrroline-5-carboxylate dehydrogenase 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 532 (192.3 bits), Expect = 3.1e-51, P = 3.1e-51
 Identities = 100/120 (83%), Positives = 112/120 (93%)

Query:     1 LNAFFAKELTKYQPISEDPKSTLNSLRYRGLDGFVAAVSPFNFTAIGGNLAYTPALMGSS 60
             +NA+F KE+TKYQPISE+ K T NSLRYRG+DGF+AAVSPFNFTAIGGNL+YTPALMG+ 
Sbjct:   181 MNAYFLKEVTKYQPISENIKVTKNSLRYRGIDGFIAAVSPFNFTAIGGNLSYTPALMGNG 240

Query:    61 VLWKPSDTALLSNYTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVP 120
             VLWKPSDTA+LSN+ I+KIM EAGVP GVVNFVPADGPVFGDTITASP+LAGINFTGSVP
Sbjct:   241 VLWKPSDTAMLSNWIIFKIMREAGVPDGVVNFVPADGPVFGDTITASPHLAGINFTGSVP 300




GO:0003842 "1-pyrroline-5-carboxylate dehydrogenase activity" evidence=ISS
GO:0005759 "mitochondrial matrix" evidence=ISS
GO:0006560 "proline metabolic process" evidence=ISS;IMP
GO:0016620 "oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0006561 "proline biosynthetic process" evidence=IEA
GO:0007005 "mitochondrion organization" evidence=IMP
GO:0005739 "mitochondrion" evidence=IDA
UNIPROTKB|E1C8Z8 ALDH4A1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A7YWE4 ALDH4A1 "Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LNB4 ALDH4A1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|D2D4A3 ALDH4A1 "Mitochondrial aldehyde dehydrogenase 4 family member A1 transcript variant ALDH4A1_v6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P30038 ALDH4A1 "Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9P2L3 TAS1R2 "Taste receptor type 1 member 2" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1624206 Aldh4a1 "aldehyde dehydrogenase 4 family, member A1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LQ99 Aldh4a1 "Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P0C2X9 Aldh4a1 "Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7SY23AL4A1_DANRE1, ., 5, ., 1, ., 1, 20.65830.98330.2122yesN/A
A7YWE4AL4A1_BOVIN1, ., 5, ., 1, ., 1, 20.66660.98330.2095yesN/A
P30038AL4A1_HUMAN1, ., 5, ., 1, ., 1, 20.66660.98330.2095yesN/A
Q8CHT0AL4A1_MOUSE1, ., 5, ., 1, ., 1, 20.66660.98330.2099yesN/A
P0C2X9AL4A1_RAT1, ., 5, ., 1, ., 1, 20.6750.98330.2095yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
cd07123 522 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-ca 1e-70
TIGR01236 532 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carb 9e-56
cd07083 500 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent 2e-40
cd07124 512 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline- 3e-26
pfam00171 459 pfam00171, Aldedh, Aldehyde dehydrogenase family 3e-26
cd07078 432 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrog 2e-24
cd06534 367 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehyd 4e-23
COG1012 472 COG1012, PutA, NAD-dependent aldehyde dehydrogenas 2e-21
PRK03137 514 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehy 7e-20
cd07097 473 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+ 1e-17
cd07125 518 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-car 5e-17
cd07145 456 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcu 1e-16
cd07149 453 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) wi 2e-16
cd07104 431 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P) 3e-16
cd07115 453 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 4e-16
cd07150 451 cd07150, ALDH_VaniDH_like, Pseudomonas putida vani 4e-16
PRK11904 1038 PRK11904, PRK11904, bifunctional proline dehydroge 2e-15
cd07114 457 cd07114, ALDH_DhaS, Uncharacterized Candidatus pel 4e-15
cd07088 468 cd07088, ALDH_LactADH-AldA, Escherichia coli lacta 6e-15
COG4230 769 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate 6e-15
TIGR01237 511 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carb 9e-15
cd07082 473 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-ph 1e-14
cd07103 451 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succina 1e-14
cd07112 462 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+ 2e-14
cd07086 478 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha 5e-14
PRK11905 1208 PRK11905, PRK11905, bifunctional proline dehydroge 7e-14
cd07131 478 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candi 8e-14
TIGR01804 467 TIGR01804, BADH, glycine betaine aldehyde dehydrog 1e-13
cd07138 466 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-ox 1e-13
cd07113 477 cd07113, ALDH_PADH_NahF, Escherichia coli NAD+-dep 1e-13
cd07089 459 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6- 2e-13
cd07095 431 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-sem 3e-13
cd07094 453 cd07094, ALDH_F21_LactADH-like, ALDH subfamily: NA 4e-13
cd07102 452 cd07102, ALDH_EDX86601, Uncharacterized aldehyde d 6e-13
PLN02278 498 PLN02278, PLN02278, succinic semialdehyde dehydrog 7e-13
cd07105 432 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogena 8e-13
cd07091 476 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH 1e-12
PRK11809 1318 PRK11809, putA, trifunctional transcriptional regu 2e-12
cd07139 471 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculo 2e-12
cd07090 457 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethy 3e-12
cd07152 443 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde 3e-12
cd07110 456 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehy 4e-12
TIGR01238 500 TIGR01238, D1pyr5carbox3, delta-1-pyrroline-5-carb 5e-12
cd07119 482 cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-de 7e-12
cd07109 454 cd07109, ALDH_AAS00426, Uncharacterized Saccharopo 1e-11
PRK13252 488 PRK13252, PRK13252, betaine aldehyde dehydrogenase 1e-11
cd07151 465 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxyb 2e-11
cd07106 446 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofac 5e-11
cd07093 455 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogen 7e-11
TIGR01780 448 TIGR01780, SSADH, succinate-semialdehyde dehydroge 8e-11
PRK09847 494 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobuty 2e-10
cd07107 456 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxyben 3e-10
cd07085 478 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyd 4e-10
cd07141 481 cd07141, ALDH_F1AB_F2_RALDH1, NAD+-dependent retin 4e-10
PRK09457 487 PRK09457, astD, succinylglutamic semialdehyde dehy 5e-10
cd07144 484 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisi 6e-10
cd07118 454 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbos 1e-09
cd07111 480 cd07111, ALDH_F16, Aldehyde dehydrogenase family 1 1e-09
cd07130 474 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-amin 2e-09
cd07092 450 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-d 2e-09
cd07143 481 cd07143, ALDH_AldA_AN0554, Aspergillus nidulans al 4e-09
PLN02467 503 PLN02467, PLN02467, betaine aldehyde dehydrogenase 5e-09
TIGR02299 488 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate 6e-09
cd07146 451 cd07146, ALDH_PhpJ, Streptomyces putative phosphon 7e-09
PRK09407 524 PRK09407, gabD2, succinic semialdehyde dehydrogena 8e-09
cd07140 486 cd07140, ALDH_F1L_FTFDH, 10-formyltetrahydrofolate 9e-09
cd07142 476 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogen 1e-08
TIGR03216 481 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semia 2e-08
cd07147 452 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase f 4e-08
PRK10090 409 PRK10090, PRK10090, aldehyde dehydrogenase A; Prov 4e-08
cd07559 480 cd07559, ALDH_ACDHII_AcoD-like, Ralstonia eutrophu 5e-08
TIGR03240 484 TIGR03240, arg_catab_astD, succinylglutamic semial 5e-08
cd07101 454 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tubercul 7e-08
TIGR03250 472 TIGR03250, PhnAcAld_DH, putative phosphonoacetalde 1e-07
cd07120 455 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida al 2e-07
PRK11241 482 PRK11241, gabD, succinate-semialdehyde dehydrogena 2e-07
PRK13473 475 PRK13473, PRK13473, gamma-aminobutyraldehyde dehyd 3e-07
PLN02766 501 PLN02766, PLN02766, coniferyl-aldehyde dehydrogena 3e-07
TIGR03374 472 TIGR03374, ABALDH, 1-pyrroline dehydrogenase 3e-07
PLN00412 496 PLN00412, PLN00412, NADP-dependent glyceraldehyde- 4e-07
cd07108 457 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-d 5e-07
cd07117 475 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylo 6e-07
cd07116 479 cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD 7e-07
PLN02466 538 PLN02466, PLN02466, aldehyde dehydrogenase family 2e-06
TIGR01722 477 TIGR01722, MMSDH, methylmalonic acid semialdehyde 3e-06
cd07148 455 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL031 8e-06
cd07100 429 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tubercul 4e-05
TIGR04284 480 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, 6e-05
PRK13968 462 PRK13968, PRK13968, putative succinate semialdehyd 2e-04
cd07099 453 cd07099, ALDH_DDALDH, Methylomonas sp 4e-04
cd07126 489 cd07126, ALDH_F12_P5CDH, Delta(1)-pyrroline-5-carb 8e-04
>gnl|CDD|143441 cd07123, ALDH_F4-17_P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
 Score =  219 bits (560), Expect = 1e-70
 Identities = 81/120 (67%), Positives = 95/120 (79%), Gaps = 1/120 (0%)

Query: 1   LNAFFAKELTKYQPISEDPKSTLNSLRYRGLDGFVAAVSPFNFTAIGGNLAYTPALMGSS 60
            N  +A+EL   QP+S  P    N L YR L+GFV AVSPFNFTAIGGNLA  PALMG+ 
Sbjct: 141 FNVKYAEELYAQQPLSS-PAGVWNRLEYRPLEGFVYAVSPFNFTAIGGNLAGAPALMGNV 199

Query: 61  VLWKPSDTALLSNYTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVP 120
           VLWKPSDTA+LSNY +YKI+ EAG+PPGV+NFVP DGPV GDT+ ASP+LAG++FTGS P
Sbjct: 200 VLWKPSDTAVLSNYLVYKILEEAGLPPGVINFVPGDGPVVGDTVLASPHLAGLHFTGSTP 259


Delta(1)-pyrroline-5-carboxylate dehydrogenase (EC=1.5.1.12 ), families 4 and 17: a proline catabolic enzyme of the aldehyde dehydrogenase (ALDH) protein superfamily. Delta(1)-pyrroline-5-carboxylate dehydrogenase (P5CDH), also known as ALDH4A1 in humans, is a mitochondrial homodimer involved in proline degradation and catalyzes the NAD + -dependent conversion of P5C to glutamate. This is a necessary step in the pathway interconnecting the urea and tricarboxylic acid cycles. The preferred substrate is glutamic gamma-semialdehyde, other substrates include succinic, glutaric and adipic semialdehydes. Also included in this CD is the Aldh17 Drosophila melanogaster (Q9VUC0) P5CDH and similar sequences. Length = 522

>gnl|CDD|233324 TIGR01236, D1pyr5carbox1, delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>gnl|CDD|143402 cd07083, ALDH_P5CDH, ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143442 cd07124, ALDH_PutA-P5CDH-RocA, Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>gnl|CDD|215767 pfam00171, Aldedh, Aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|143397 cd07078, ALDH, NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>gnl|CDD|143395 cd06534, ALDH-SF, NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>gnl|CDD|223944 COG1012, PutA, NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|179543 PRK03137, PRK03137, 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143415 cd07097, ALDH_KGSADH-YcbD, Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>gnl|CDD|143443 cd07125, ALDH_PutA-P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>gnl|CDD|143463 cd07145, ALDH_LactADH_F420-Bios, Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143467 cd07149, ALDH_y4uC, Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|143422 cd07104, ALDH_BenzADH-like, ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|143433 cd07115, ALDH_HMSADH_HapE, Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143468 cd07150, ALDH_VaniDH_like, Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>gnl|CDD|237017 PRK11904, PRK11904, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143432 cd07114, ALDH_DhaS, Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>gnl|CDD|143407 cd07088, ALDH_LactADH-AldA, Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|226683 COG4230, COG4230, Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|200087 TIGR01237, D1pyr5carbox2, delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>gnl|CDD|143401 cd07082, ALDH_F11_NP-GAPDH, NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>gnl|CDD|143421 cd07103, ALDH_F5_SSADH_GabD, Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>gnl|CDD|143430 cd07112, ALDH_GABALDH-PuuC, Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>gnl|CDD|143405 cd07086, ALDH_F7_AASADH-like, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>gnl|CDD|237018 PRK11905, PRK11905, bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143449 cd07131, ALDH_AldH-CAJ73105, Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>gnl|CDD|200131 TIGR01804, BADH, glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143456 cd07138, ALDH_CddD_SSP0762, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143431 cd07113, ALDH_PADH_NahF, Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>gnl|CDD|143408 cd07089, ALDH_CddD-AldA-like, Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>gnl|CDD|143414 cd07095, ALDH_SGSD_AstD, N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>gnl|CDD|143413 cd07094, ALDH_F21_LactADH-like, ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>gnl|CDD|143420 cd07102, ALDH_EDX86601, Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>gnl|CDD|215157 PLN02278, PLN02278, succinic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143423 cd07105, ALDH_SaliADH, Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>gnl|CDD|143410 cd07091, ALDH_F1-2_Ald2-like, ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>gnl|CDD|236989 PRK11809, putA, trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143457 cd07139, ALDH_AldA-Rv0768, Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>gnl|CDD|143409 cd07090, ALDH_F9_TMBADH, NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>gnl|CDD|143470 cd07152, ALDH_BenzADH, NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|143428 cd07110, ALDH_F10_BADH, Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>gnl|CDD|233325 TIGR01238, D1pyr5carbox3, delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>gnl|CDD|143437 cd07119, ALDH_BADH-GbsA, Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143427 cd07109, ALDH_AAS00426, Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>gnl|CDD|183918 PRK13252, PRK13252, betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143469 cd07151, ALDH_HBenzADH, NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143424 cd07106, ALDH_AldA-AAD23400, Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>gnl|CDD|143412 cd07093, ALDH_F8_HMSADH, Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>gnl|CDD|188167 TIGR01780, SSADH, succinate-semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|182108 PRK09847, PRK09847, gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143425 cd07107, ALDH_PhdK-like, Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>gnl|CDD|143404 cd07085, ALDH_F6_MMSDH, Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>gnl|CDD|143459 cd07141, ALDH_F1AB_F2_RALDH1, NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>gnl|CDD|181873 PRK09457, astD, succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143462 cd07144, ALDH_ALD2-YMR170C, Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>gnl|CDD|143436 cd07118, ALDH_SNDH, Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143429 cd07111, ALDH_F16, Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>gnl|CDD|143448 cd07130, ALDH_F7_AASADH, NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>gnl|CDD|143411 cd07092, ALDH_ABALDH-YdcW, Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>gnl|CDD|143461 cd07143, ALDH_AldA_AN0554, Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>gnl|CDD|215260 PLN02467, PLN02467, betaine aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|131352 TIGR02299, HpaE, 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143464 cd07146, ALDH_PhpJ, Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>gnl|CDD|236501 PRK09407, gabD2, succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|143458 cd07140, ALDH_F1L_FTFDH, 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>gnl|CDD|143460 cd07142, ALDH_F2BC, Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>gnl|CDD|132260 TIGR03216, OH_muco_semi_DH, 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143465 cd07147, ALDH_F21_RNP123, Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>gnl|CDD|182233 PRK10090, PRK10090, aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|143471 cd07559, ALDH_ACDHII_AcoD-like, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>gnl|CDD|132284 TIGR03240, arg_catab_astD, succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143419 cd07101, ALDH_SSADH2_GabD2, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>gnl|CDD|132294 TIGR03250, PhnAcAld_DH, putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143438 cd07120, ALDH_PsfA-ACA09737, Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>gnl|CDD|183050 PRK11241, gabD, succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>gnl|CDD|237391 PRK13473, PRK13473, gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215410 PLN02766, PLN02766, coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|132417 TIGR03374, ABALDH, 1-pyrroline dehydrogenase Back     alignment and domain information
>gnl|CDD|215110 PLN00412, PLN00412, NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143426 cd07108, ALDH_MGR_2402, Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>gnl|CDD|143435 cd07117, ALDH_StaphAldA1, Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>gnl|CDD|143434 cd07116, ALDH_ACDHII-AcoD, Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>gnl|CDD|215259 PLN02466, PLN02466, aldehyde dehydrogenase family 2 member Back     alignment and domain information
>gnl|CDD|130783 TIGR01722, MMSDH, methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>gnl|CDD|143466 cd07148, ALDH_RL0313, Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>gnl|CDD|143418 cd07100, ALDH_SSADH1_GabD1, Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>gnl|CDD|212007 TIGR04284, aldehy_Rv0768, aldehyde dehydrogenase, Rv0768 family Back     alignment and domain information
>gnl|CDD|184426 PRK13968, PRK13968, putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|143417 cd07099, ALDH_DDALDH, Methylomonas sp Back     alignment and domain information
>gnl|CDD|143444 cd07126, ALDH_F12_P5CDH, Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 120
KOG2450|consensus 501 100.0
COG1012 472 PutA NAD-dependent aldehyde dehydrogenases [Energy 99.97
KOG2451|consensus 503 99.97
PRK11241 482 gabD succinate-semialdehyde dehydrogenase I; Provi 99.96
PLN02766 501 coniferyl-aldehyde dehydrogenase 99.96
cd07126 489 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate de 99.96
PLN02466 538 aldehyde dehydrogenase family 2 member 99.96
cd07142 476 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 99.96
PRK10090 409 aldehyde dehydrogenase A; Provisional 99.96
PLN02419 604 methylmalonate-semialdehyde dehydrogenase [acylati 99.96
PLN02278 498 succinic semialdehyde dehydrogenase 99.96
cd07124 512 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxyl 99.96
cd07143 481 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde deh 99.96
cd07109 454 ALDH_AAS00426 Uncharacterized Saccharopolyspora sp 99.96
PLN02467 503 betaine aldehyde dehydrogenase 99.96
cd07116 479 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependen 99.96
cd07144 484 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyd 99.96
cd07119 482 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent be 99.96
TIGR01804 467 BADH glycine betaine aldehyde dehydrogenase. Betai 99.96
TIGR01236 533 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehy 99.96
PRK13968 462 putative succinate semialdehyde dehydrogenase; Pro 99.96
cd07091 476 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 99.96
TIGR01780 448 SSADH succinate-semialdehyde dehydrogenase. SSADH 99.96
cd07123 522 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate 99.96
cd07140 486 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydroge 99.96
TIGR03250 472 PhnAcAld_DH putative phosphonoacetaldehyde dehydro 99.95
cd07113 477 ALDH_PADH_NahF Escherichia coli NAD+-dependent phe 99.95
cd07110 456 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydro 99.95
PRK13252 488 betaine aldehyde dehydrogenase; Provisional 99.95
cd07083 500 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)- 99.95
cd07120 455 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde deh 99.95
cd07141 481 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydro 99.95
PRK03137 514 1-pyrroline-5-carboxylate dehydrogenase; Provision 99.95
PRK09847 494 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogen 99.95
TIGR01237 511 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehy 99.95
PLN02315 508 aldehyde dehydrogenase family 7 member 99.95
cd07118 454 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydr 99.95
cd07097 473 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent 99.95
cd07112 462 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent 99.95
PRK09406 457 gabD1 succinic semialdehyde dehydrogenase; Reviewe 99.95
cd07115 453 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxy 99.95
PRK09457 487 astD succinylglutamic semialdehyde dehydrogenase; 99.95
TIGR03374 472 ABALDH 1-pyrroline dehydrogenase. Members of this 99.95
cd07150 451 ALDH_VaniDH_like Pseudomonas putida vanillin dehyd 99.95
cd07559 480 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dep 99.95
cd07145 456 ALDH_LactADH_F420-Bios Methanocaldococcus jannasch 99.95
cd07148 455 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with si 99.95
cd07095 431 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde 99.95
cd07081 439 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldeh 99.95
cd07089 459 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric 99.95
cd07117 475 ALDH_StaphAldA1 Uncharacterized Staphylococcus aur 99.95
cd07151 465 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyd 99.95
cd07131 478 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuen 99.95
TIGR02299 488 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyd 99.95
cd07121 429 ALDH_EutE Ethanolamine utilization protein EutE-li 99.95
TIGR03240 484 arg_catab_astD succinylglutamic semialdehyde dehyd 99.95
cd07100 429 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succi 99.95
cd07138 466 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric ac 99.95
TIGR03216 481 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehy 99.95
cd07088 468 ALDH_LactADH-AldA Escherichia coli lactaldehyde de 99.95
cd07146 451 ALDH_PhpJ Streptomyces putative phosphonoformaldeh 99.95
PRK11904 1038 bifunctional proline dehydrogenase/pyrroline-5-car 99.95
cd07105 432 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-l 99.95
cd07107 456 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde 99.95
cd07086 478 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadip 99.95
cd07114 457 ALDH_DhaS Uncharacterized Candidatus pelagibacter 99.95
PLN02174 484 aldehyde dehydrogenase family 3 member H1 99.95
cd07090 457 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobuty 99.95
PRK15398 465 aldehyde dehydrogenase EutE; Provisional 99.95
cd07152 443 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogen 99.95
PRK11809 1318 putA trifunctional transcriptional regulator/proli 99.95
cd07094 453 ALDH_F21_LactADH-like ALDH subfamily: NAD+-depende 99.94
TIGR02288 551 PaaN_2 phenylacetic acid degradation protein paaN. 99.94
cd07104 431 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependen 99.94
cd07139 471 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehy 99.94
cd07130 474 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic se 99.94
cd07122 436 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydr 99.94
PRK13473 475 gamma-aminobutyraldehyde dehydrogenase; Provisiona 99.94
cd07093 455 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 99.94
cd07085 478 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrog 99.94
cd07102 452 ALDH_EDX86601 Uncharacterized aldehyde dehydrogena 99.94
TIGR01722 477 MMSDH methylmalonic acid semialdehyde dehydrogenas 99.94
cd07103 451 ALDH_F5_SSADH_GabD Mitochondrial succinate-semiald 99.94
PF00171 462 Aldedh: Aldehyde dehydrogenase family; InterPro: I 99.94
cd07125 518 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate d 99.94
cd07147 452 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1 99.94
cd07092 450 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent g 99.94
cd07082 473 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylat 99.94
cd07108 457 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent a 99.94
cd07149 453 ALDH_y4uC Uncharacterized ALDH (y4uC) with similar 99.94
PRK11905 1208 bifunctional proline dehydrogenase/pyrroline-5-car 99.93
cd07101 454 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succi 99.93
PLN00412 496 NADP-dependent glyceraldehyde-3-phosphate dehydrog 99.93
cd07136 449 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydr 99.93
TIGR02518 488 EutH_ACDH acetaldehyde dehydrogenase (acetylating) 99.93
PRK09407 524 gabD2 succinic semialdehyde dehydrogenase; Reviewe 99.93
PLN02203 484 aldehyde dehydrogenase 99.93
cd07135 436 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde 99.93
TIGR01238 500 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehy 99.93
cd07137 432 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 m 99.93
cd07099 453 ALDH_DDALDH Methylomonas sp. 4,4'-diapolycopene-di 99.93
TIGR00407 398 proA gamma-glutamyl phosphate reductase. The prosi 99.93
COG4230 769 Delta 1-pyrroline-5-carboxylate dehydrogenase [Ene 99.93
cd07084 442 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent 99.93
cd07129 454 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydr 99.93
cd07098 465 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 99.93
cd07128 513 ALDH_MaoC-N N-terminal domain of the monoamine oxi 99.93
PTZ00381 493 aldehyde dehydrogenase family protein; Provisional 99.93
cd07133 434 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-l 99.93
cd07111 480 ALDH_F16 Aldehyde dehydrogenase family 16A1-like. 99.93
cd07106 446 ALDH_AldA-AAD23400 Streptomyces aureofaciens putat 99.93
cd07077 397 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase 99.92
cd07127 549 ALDH_PAD-PaaZ Phenylacetic acid degradation protei 99.92
PRK11903 521 aldehyde dehydrogenase; Provisional 99.92
PLN02418 718 delta-1-pyrroline-5-carboxylate synthase 99.92
TIGR02278 663 PaaN-DH phenylacetic acid degradation protein paaN 99.92
PRK13805 862 bifunctional acetaldehyde-CoA/alcohol dehydrogenas 99.92
cd07087 426 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl 99.92
PRK11563 675 bifunctional aldehyde dehydrogenase/enoyl-CoA hydr 99.91
cd07079 406 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate redu 99.91
cd07134 433 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydro 99.91
PRK00197 417 proA gamma-glutamyl phosphate reductase; Provision 99.91
cd07132 443 ALDH_F3AB Aldehyde dehydrogenase family 3 members 99.91
cd06534 367 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase s 99.91
cd07078 432 ALDH NAD(P)+ dependent aldehyde dehydrogenase fami 99.9
TIGR01092 715 P5CS delta l-pyrroline-5-carboxylate synthetase. T 99.89
KOG2456|consensus 477 99.89
KOG2455|consensus 561 99.81
KOG2454|consensus 583 99.79
cd07080 422 ALDH_Acyl-CoA-Red_LuxC Acyl-CoA reductase LuxC. Ac 99.76
KOG2452|consensus 881 99.6
KOG2453|consensus 507 99.56
COG0014 417 ProA Gamma-glutamyl phosphate reductase [Amino aci 99.09
PRK119051208 bifunctional proline dehydrogenase/pyrroline-5-car 98.52
KOG4165|consensus 433 98.43
PF05893 399 LuxC: Acyl-CoA reductase (LuxC); InterPro: IPR0086 98.38
PRK118091318 putA trifunctional transcriptional regulator/proli 95.07
COG0521169 MoaB Molybdopterin biosynthesis enzymes [Coenzyme 80.03
>KOG2450|consensus Back     alignment and domain information
Probab=100.00  E-value=5.2e-33  Score=217.96  Aligned_cols=119  Identities=29%  Similarity=0.492  Sum_probs=112.6

Q ss_pred             hHHHHHHhhhcCCCCCCCCCCcceEEEeccCeEEEEEcCCChhhhhHHhhhcccc-CCCeEEeecCCCcHHHHHHHHHHH
Q psy1844           2 NAFFAKELTKYQPISEDPKSTLNSLRYRGLDGFVAAVSPFNFTAIGGNLAYTPAL-MGSSVLWKPSDTALLSNYTIYKIM   80 (120)
Q Consensus         2 ~~~~a~~~~~~~~~~~~~~~~~~~~~~~~p~Gvv~~i~p~n~P~~~~~~~~~~al-aGN~vv~k~~~~~~~~~~~~~~~l   80 (120)
                      +||||+++++..+...+.+.....|++++|+|||+.|.|||||+.+..|+++||| +||+||+||++++|++++.+++++
T Consensus       129 ~ry~ag~ad~~~~~~~~~~~~~~~yt~~eP~GV~G~I~pWN~Pllm~awKlaPALa~GNtvV~Kpae~tplsal~~~~l~  208 (501)
T KOG2450|consen  129 FRYYAGWADKIHGSTIPTDGEFFAYTRREPIGVCGQIIPWNFPLLMQAWKLAPALAAGNTVVLKPAEQTPLTALYLASLC  208 (501)
T ss_pred             HHhhccchhhcccccCCCCCceEEEecCCcceeeeEeccCchHHHHHHHhhhhHHhhCcEEEecCCCCCCchHHHHHHHh
Confidence            5899999999966555567888999999999999999999999999999999999 699999999999999999999999


Q ss_pred             HHhCCCCCcEEEEeCCChHHHHHHHhCCCcceEEEecCCC
Q psy1844          81 IEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVP  120 (120)
Q Consensus        81 ~~ag~p~g~~~~i~~~~~~~~~~l~~~~~i~~v~ftGs~~  120 (120)
                      +++|+|+|++|+|.|.+.++++.|.+|++|+.|.||||+.
T Consensus       209 ~eaG~P~GVvNii~G~G~~aG~al~sH~dv~kiaFTGSt~  248 (501)
T KOG2450|consen  209 KEAGFPPGVVNIVPGSGTTAGAALASHPDVDKVAFTGSTP  248 (501)
T ss_pred             HHhcCCcceEEEccCCCchHHHHHhhCCCCceEEecCCCc
Confidence            9999999999999999999999999999999999999974



>COG1012 PutA NAD-dependent aldehyde dehydrogenases [Energy production and conversion] Back     alignment and domain information
>KOG2451|consensus Back     alignment and domain information
>PRK11241 gabD succinate-semialdehyde dehydrogenase I; Provisional Back     alignment and domain information
>PLN02766 coniferyl-aldehyde dehydrogenase Back     alignment and domain information
>cd07126 ALDH_F12_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12 Back     alignment and domain information
>PLN02466 aldehyde dehydrogenase family 2 member Back     alignment and domain information
>cd07142 ALDH_F2BC Arabidosis aldehyde dehydrogenase family 2 B4, B7, C4-like Back     alignment and domain information
>PRK10090 aldehyde dehydrogenase A; Provisional Back     alignment and domain information
>PLN02419 methylmalonate-semialdehyde dehydrogenase [acylating] Back     alignment and domain information
>PLN02278 succinic semialdehyde dehydrogenase Back     alignment and domain information
>cd07124 ALDH_PutA-P5CDH-RocA Delta(1)-pyrroline-5-carboxylate dehydrogenase, RocA Back     alignment and domain information
>cd07143 ALDH_AldA_AN0554 Aspergillus nidulans aldehyde dehydrogenase, AldA (AN0554)-like Back     alignment and domain information
>cd07109 ALDH_AAS00426 Uncharacterized Saccharopolyspora spinosa aldehyde dehydrogenase (AAS00426)-like Back     alignment and domain information
>PLN02467 betaine aldehyde dehydrogenase Back     alignment and domain information
>cd07116 ALDH_ACDHII-AcoD Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II-like Back     alignment and domain information
>cd07144 ALDH_ALD2-YMR170C Saccharomyces cerevisiae aldehyde dehydrogenase 2 (YMR170c)-like Back     alignment and domain information
>cd07119 ALDH_BADH-GbsA Bacillus subtilis NAD+-dependent betaine aldehyde dehydrogenase-like Back     alignment and domain information
>TIGR01804 BADH glycine betaine aldehyde dehydrogenase Back     alignment and domain information
>TIGR01236 D1pyr5carbox1 delta-1-pyrroline-5-carboxylate dehydrogenase, group 1 Back     alignment and domain information
>PRK13968 putative succinate semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07091 ALDH_F1-2_Ald2-like ALDH subfamily: ALDH families 1and 2, including 10-formyltetrahydrofolate dehydrogenase, NAD+-dependent retinal dehydrogenase 1 and related proteins Back     alignment and domain information
>TIGR01780 SSADH succinate-semialdehyde dehydrogenase Back     alignment and domain information
>cd07123 ALDH_F4-17_P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH families 4 and 17 Back     alignment and domain information
>cd07140 ALDH_F1L_FTFDH 10-formyltetrahydrofolate dehydrogenase, ALDH family 1L Back     alignment and domain information
>TIGR03250 PhnAcAld_DH putative phosphonoacetaldehyde dehydrogenase Back     alignment and domain information
>cd07113 ALDH_PADH_NahF Escherichia coli NAD+-dependent phenylacetaldehyde dehydrogenase PadA-like Back     alignment and domain information
>cd07110 ALDH_F10_BADH Arabidopsis betaine aldehyde dehydrogenase 1 and 2, ALDH family 10A8 and 10A9-like Back     alignment and domain information
>PRK13252 betaine aldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07083 ALDH_P5CDH ALDH subfamily NAD+-dependent delta(1)-pyrroline-5-carboxylate dehydrogenase-like Back     alignment and domain information
>cd07120 ALDH_PsfA-ACA09737 Pseudomonas putida aldehyde dehydrogenase PsfA (ACA09737)-like Back     alignment and domain information
>cd07141 ALDH_F1AB_F2_RALDH1 NAD+-dependent retinal dehydrogenase 1, ALDH families 1A, 1B, and 2-like Back     alignment and domain information
>PRK03137 1-pyrroline-5-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK09847 gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR01237 D1pyr5carbox2 delta-1-pyrroline-5-carboxylate dehydrogenase, group 2, putative Back     alignment and domain information
>PLN02315 aldehyde dehydrogenase family 7 member Back     alignment and domain information
>cd07118 ALDH_SNDH Gluconobacter oxydans L-sorbosone dehydrogenase-like Back     alignment and domain information
>cd07097 ALDH_KGSADH-YcbD Bacillus subtilis NADP+-dependent alpha-ketoglutaric semialdehyde dehydrogenase ycbD-like Back     alignment and domain information
>cd07112 ALDH_GABALDH-PuuC Escherichia coli NADP+-dependent gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase PuuC-like Back     alignment and domain information
>PRK09406 gabD1 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>cd07115 ALDH_HMSADH_HapE Pseudomonas fluorescens 4-hydroxymuconic semialdehyde dehydrogenase-like Back     alignment and domain information
>PRK09457 astD succinylglutamic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03374 ABALDH 1-pyrroline dehydrogenase Back     alignment and domain information
>cd07150 ALDH_VaniDH_like Pseudomonas putida vanillin dehydrogenase-like Back     alignment and domain information
>cd07559 ALDH_ACDHII_AcoD-like Ralstonia eutrophus NAD+-dependent acetaldehyde dehydrogenase II and Staphylococcus aureus AldA1 (SACOL0154)-like Back     alignment and domain information
>cd07145 ALDH_LactADH_F420-Bios Methanocaldococcus jannaschii NAD+-dependent lactaldehyde dehydrogenase-like Back     alignment and domain information
>cd07148 ALDH_RL0313 Uncharacterized ALDH ( RL0313) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>cd07095 ALDH_SGSD_AstD N-succinylglutamate 5-semialdehyde dehydrogenase, AstD-like Back     alignment and domain information
>cd07081 ALDH_F20_ACDH_EutE-like Coenzyme A acylating aldehyde dehydrogenase (ACDH), Ethanolamine utilization protein EutE, and related proteins Back     alignment and domain information
>cd07089 ALDH_CddD-AldA-like Rhodococcus ruber 6-oxolauric acid dehydrogenase-like and related proteins Back     alignment and domain information
>cd07117 ALDH_StaphAldA1 Uncharacterized Staphylococcus aureus AldA1 (SACOL0154) aldehyde dehydrogenase-like Back     alignment and domain information
>cd07151 ALDH_HBenzADH NADP+-dependent p-hydroxybenzaldehyde dehydrogenase-like Back     alignment and domain information
>cd07131 ALDH_AldH-CAJ73105 Uncharacterized Candidatus kuenenia aldehyde dehydrogenase AldH (CAJ73105)-like Back     alignment and domain information
>TIGR02299 HpaE 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase Back     alignment and domain information
>cd07121 ALDH_EutE Ethanolamine utilization protein EutE-like Back     alignment and domain information
>TIGR03240 arg_catab_astD succinylglutamic semialdehyde dehydrogenase Back     alignment and domain information
>cd07100 ALDH_SSADH1_GabD1 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 1-like Back     alignment and domain information
>cd07138 ALDH_CddD_SSP0762 Rhodococcus ruber 6-oxolauric acid dehydrogenase-like Back     alignment and domain information
>TIGR03216 OH_muco_semi_DH 2-hydroxymuconic semialdehyde dehydrogenase Back     alignment and domain information
>cd07088 ALDH_LactADH-AldA Escherichia coli lactaldehyde dehydrogenase AldA-like Back     alignment and domain information
>cd07146 ALDH_PhpJ Streptomyces putative phosphonoformaldehyde dehydrogenase PhpJ-like Back     alignment and domain information
>PRK11904 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07105 ALDH_SaliADH Salicylaldehyde dehydrogenase, DoxF-like Back     alignment and domain information
>cd07107 ALDH_PhdK-like Nocardioides 2-carboxybenzaldehyde dehydrogenase, PhdK-like Back     alignment and domain information
>cd07086 ALDH_F7_AASADH-like NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase and related proteins Back     alignment and domain information
>cd07114 ALDH_DhaS Uncharacterized Candidatus pelagibacter aldehyde dehydrogenase, DhaS-like Back     alignment and domain information
>PLN02174 aldehyde dehydrogenase family 3 member H1 Back     alignment and domain information
>cd07090 ALDH_F9_TMBADH NAD+-dependent 4-trimethylaminobutyraldehyde dehydrogenase, ALDH family 9A1 Back     alignment and domain information
>PRK15398 aldehyde dehydrogenase EutE; Provisional Back     alignment and domain information
>cd07152 ALDH_BenzADH NAD-dependent benzaldehyde dehydrogenase II-like Back     alignment and domain information
>PRK11809 putA trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07094 ALDH_F21_LactADH-like ALDH subfamily: NAD+-dependent, lactaldehyde dehydrogenase, ALDH family 21 A1, and related proteins Back     alignment and domain information
>TIGR02288 PaaN_2 phenylacetic acid degradation protein paaN Back     alignment and domain information
>cd07104 ALDH_BenzADH-like ALDH subfamily: NAD(P)+-dependent benzaldehyde dehydrogenase II, vanillin dehydrogenase, p-hydroxybenzaldehyde dehydrogenase and related proteins Back     alignment and domain information
>cd07139 ALDH_AldA-Rv0768 Mycobacterium tuberculosis aldehyde dehydrogenase AldA-like Back     alignment and domain information
>cd07130 ALDH_F7_AASADH NAD+-dependent alpha-aminoadipic semialdehyde dehydrogenase, ALDH family members 7A1 and 7B Back     alignment and domain information
>cd07122 ALDH_F20_ACDH Coenzyme A acylating aldehyde dehydrogenase (ACDH), ALDH family 20-like Back     alignment and domain information
>PRK13473 gamma-aminobutyraldehyde dehydrogenase; Provisional Back     alignment and domain information
>cd07093 ALDH_F8_HMSADH Human aldehyde dehydrogenase family 8 member A1-like Back     alignment and domain information
>cd07085 ALDH_F6_MMSDH Methylmalonate semialdehyde dehydrogenase and ALDH family members 6A1 and 6B2 Back     alignment and domain information
>cd07102 ALDH_EDX86601 Uncharacterized aldehyde dehydrogenase of Synechococcus sp Back     alignment and domain information
>TIGR01722 MMSDH methylmalonic acid semialdehyde dehydrogenase Back     alignment and domain information
>cd07103 ALDH_F5_SSADH_GabD Mitochondrial succinate-semialdehyde dehydrogenase and ALDH family members 5A1 and 5F1-like Back     alignment and domain information
>PF00171 Aldedh: Aldehyde dehydrogenase family; InterPro: IPR015590 Aldehyde dehydrogenases (1 Back     alignment and domain information
>cd07125 ALDH_PutA-P5CDH Delta(1)-pyrroline-5-carboxylate dehydrogenase, PutA Back     alignment and domain information
>cd07147 ALDH_F21_RNP123 Aldehyde dehydrogenase family 21A1-like Back     alignment and domain information
>cd07092 ALDH_ABALDH-YdcW Escherichia coli NAD+-dependent gamma-aminobutyraldehyde dehydrogenase YdcW-like Back     alignment and domain information
>cd07082 ALDH_F11_NP-GAPDH NADP+-dependent non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase and ALDH family 11 Back     alignment and domain information
>cd07108 ALDH_MGR_2402 Magnetospirillum NAD(P)+-dependent aldehyde dehydrogenase MSR-1-like Back     alignment and domain information
>cd07149 ALDH_y4uC Uncharacterized ALDH (y4uC) with similarity to Tortula ruralis aldehyde dehydrogenase ALDH21A1 Back     alignment and domain information
>PRK11905 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>cd07101 ALDH_SSADH2_GabD2 Mycobacterium tuberculosis succinate-semialdehyde dehydrogenase 2-like Back     alignment and domain information
>PLN00412 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>cd07136 ALDH_YwdH-P39616 Bacillus subtilis aldehyde dehydrogenase ywdH-like Back     alignment and domain information
>TIGR02518 EutH_ACDH acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PRK09407 gabD2 succinic semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PLN02203 aldehyde dehydrogenase Back     alignment and domain information
>cd07135 ALDH_F14-YMR110C Saccharomyces cerevisiae aldehyde dehydrogenase family 14 and related proteins Back     alignment and domain information
>TIGR01238 D1pyr5carbox3 delta-1-pyrroline-5-carboxylate dehydrogenase (PutA C-terminal domain) Back     alignment and domain information
>cd07137 ALDH_F3FHI Plant aldehyde dehydrogenase family 3 members F1, H1, and I1 and related proteins Back     alignment and domain information
>cd07099 ALDH_DDALDH Methylomonas sp Back     alignment and domain information
>TIGR00407 proA gamma-glutamyl phosphate reductase Back     alignment and domain information
>COG4230 Delta 1-pyrroline-5-carboxylate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>cd07084 ALDH_KGSADH-like ALDH subfamily: NAD(P)+-dependent alpha-ketoglutaric semialdehyde dehydrogenases and plant delta(1)-pyrroline-5-carboxylate dehydrogenase, ALDH family 12-like Back     alignment and domain information
>cd07129 ALDH_KGSADH Alpha-Ketoglutaric Semialdehyde Dehydrogenase Back     alignment and domain information
>cd07098 ALDH_F15-22 Aldehyde dehydrogenase family 15A1 and 22A1-like Back     alignment and domain information
>cd07128 ALDH_MaoC-N N-terminal domain of the monoamine oxidase C dehydratase Back     alignment and domain information
>PTZ00381 aldehyde dehydrogenase family protein; Provisional Back     alignment and domain information
>cd07133 ALDH_CALDH_CalB Coniferyl aldehyde dehydrogenase-like Back     alignment and domain information
>cd07111 ALDH_F16 Aldehyde dehydrogenase family 16A1-like Back     alignment and domain information
>cd07106 ALDH_AldA-AAD23400 Streptomyces aureofaciens putative aldehyde dehydrogenase AldA (AAD23400)-like Back     alignment and domain information
>cd07077 ALDH-like NAD(P)+-dependent aldehyde dehydrogenase-like (ALDH-like) family Back     alignment and domain information
>cd07127 ALDH_PAD-PaaZ Phenylacetic acid degradation proteins PaaZ (Escherichia coli) and PaaN (Pseudomonas putida)-like Back     alignment and domain information
>PRK11903 aldehyde dehydrogenase; Provisional Back     alignment and domain information
>PLN02418 delta-1-pyrroline-5-carboxylate synthase Back     alignment and domain information
>TIGR02278 PaaN-DH phenylacetic acid degradation protein paaN Back     alignment and domain information
>PRK13805 bifunctional acetaldehyde-CoA/alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd07087 ALDH_F3-13-14_CALDH-like ALDH subfamily: Coniferyl aldehyde dehydrogenase, ALDH families 3, 13, and 14, and other related proteins Back     alignment and domain information
>PRK11563 bifunctional aldehyde dehydrogenase/enoyl-CoA hydratase; Provisional Back     alignment and domain information
>cd07079 ALDH_F18-19_ProA-GPR Gamma-glutamyl phosphate reductase (GPR), aldehyde dehydrogenase families 18 and 19 Back     alignment and domain information
>cd07134 ALDH_AlkH-like Pseudomonas putida Aldehyde dehydrogenase AlkH-like Back     alignment and domain information
>PRK00197 proA gamma-glutamyl phosphate reductase; Provisional Back     alignment and domain information
>cd07132 ALDH_F3AB Aldehyde dehydrogenase family 3 members A1, A2, and B1 and related proteins Back     alignment and domain information
>cd06534 ALDH-SF NAD(P)+-dependent aldehyde dehydrogenase superfamily Back     alignment and domain information
>cd07078 ALDH NAD(P)+ dependent aldehyde dehydrogenase family Back     alignment and domain information
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase Back     alignment and domain information
>KOG2456|consensus Back     alignment and domain information
>KOG2455|consensus Back     alignment and domain information
>KOG2454|consensus Back     alignment and domain information
>cd07080 ALDH_Acyl-CoA-Red_LuxC Acyl-CoA reductase LuxC Back     alignment and domain information
>KOG2452|consensus Back     alignment and domain information
>KOG2453|consensus Back     alignment and domain information
>COG0014 ProA Gamma-glutamyl phosphate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11905 bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>KOG4165|consensus Back     alignment and domain information
>PF05893 LuxC: Acyl-CoA reductase (LuxC); InterPro: IPR008670 This family consists of several bacterial Acyl-CoA reductase (LuxC) proteins Back     alignment and domain information
>PRK11809 putA trifunctional transcriptional regulator/proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase; Reviewed Back     alignment and domain information
>COG0521 MoaB Molybdopterin biosynthesis enzymes [Coenzyme metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
3v9g_A 566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 2e-42
3v9i_A 566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 2e-42
3v9h_A 566 Crystal Structure Of Human 1-Pyrroline-5-Carboxylat 2e-42
3v9j_A 563 Crystal Structure Of Mouse 1-Pyrroline-5-Carboxylat 4e-42
4f9i_A 1026 Crystal Structure Of Proline Utilization A (Puta) F 6e-11
2bhp_A 516 Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehyd 9e-11
1uzb_A 516 1-pyrroline-5-carboxylate Dehydrogenase Length = 51 9e-11
2bja_A 516 Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehyd 9e-11
3qan_A 538 Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehy 7e-09
3i44_A 497 Crystal Structure Of Aldehyde Dehydrogenase From Ba 1e-08
3jz4_C 481 Crystal Structure Of E. Coli Nadp Dependent Enzyme 2e-08
3jz4_A 481 Crystal Structure Of E. Coli Nadp Dependent Enzyme 2e-08
3rjl_A 538 Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehy 3e-08
3ed6_A 520 1.7 Angstrom Resolution Crystal Structure Of Betain 3e-08
4i8p_A 520 Crystal Structure Of Aminoaldehyde Dehydrogenase 1a 9e-08
1o9j_A 501 The X-Ray Crystal Structure Of Eta-Crystallin Lengt 1e-07
4a0m_A 496 Crystal Structure Of Betaine Aldehyde Dehydrogenase 2e-07
3haz_A 1001 Crystal Structure Of Bifunctional Proline Utilizati 2e-07
1bi9_A 499 Retinal Dehydrogenase Type Two With Nad Bound Lengt 2e-07
3k2w_A 497 Crystal Structure Of Betaine-Aldehyde Dehydrogenase 2e-07
3prl_A 505 Crystal Structure Of Nadp-Dependent Glyceraldehyde- 3e-07
2wme_A 490 Crystallographic Structure Of Betaine Aldehyde Dehy 3e-07
2wox_A 489 Betaine Aldehyde Dehydrogenase From Pseudomonas Aer 3e-07
3zqa_A 490 Crystallographic Structure Of Betaine Aldehyde Dehy 3e-07
2xdr_A 489 Crystallographic Structure Of Betaine Aldehyde Dehy 3e-07
2wme_C 490 Crystallographic Structure Of Betaine Aldehyde Dehy 3e-07
1bxs_A 501 Sheep Liver Class 1 Aldehyde Dehydrogenase With Nad 4e-07
4dng_A 485 Crystal Structure Of Putative Aldehyde Dehydrogenas 7e-07
3r64_A 508 Crystal Structure Of A Nad-Dependent Benzaldehyde D 8e-07
1euh_A 475 Apo Form Of A Nadp Dependent Aldehyde Dehydrogenase 1e-06
2esd_A 475 Crystal Structure Of Thioacylenzyme Intermediate Of 1e-06
1qi1_A 475 Ternary Complex Of An Nadp Dependent Aldehyde Dehyd 1e-06
1a4s_A 503 Betaine Aldehyde Dehydrogenase From Cod Liver Lengt 1e-06
2w8n_A 487 The Crytal Structure Of The Oxidized Form Of Human 2e-06
2w8p_A 487 The Crystal Structure Of Human C340a Ssadh Length = 2e-06
3inl_A 500 Human Mitochondrial Aldehyde Dehydrogenase Asian Va 2e-06
1o05_A 500 Apo Form Of Human Mitochondrial Aldehyde Dehydrogen 2e-06
1zum_A 500 Human Mitochondrial Aldehyde Dehydrogenase Asian Va 2e-06
1cw3_A 494 Human Mitochondrial Aldehyde Dehydrogenase Complexe 2e-06
3n80_A 500 Human Mitochondrial Aldehyde Dehydrogenase, Apo For 2e-06
2onn_A 500 Arg475gln Mutant Of Human Mitochondrial Aldehyde De 2e-06
4fr8_A 500 Crystal Structure Of Human Aldehyde Dehydrogenase-2 2e-06
1nzw_A 500 Cys302ser Mutant Of Human Mitochondrial Aldehyde De 2e-06
3rhm_A 517 Crystal Structure Of The E673q Mutant Of C-Terminal 2e-06
2o2p_A 517 Crystal Structure Of The C-Terminal Domain Of Rat 1 2e-06
2id2_A 475 Gapn T244s Mutant X-Ray Structure At 2.5 A Length = 2e-06
3rhj_A 517 Crystal Structure Of The E673a Mutant Of The C-Term 3e-06
2opx_A 479 Crystal Structure Of Lactaldehyde Dehydrogenase Fro 3e-06
2hg2_A 479 Structure Of Lactaldehyde Dehydrogenase Length = 47 3e-06
3rhr_A 517 Crystal Structure Of The C707a Mutant Of The C-Term 3e-06
2imp_A 479 Crystal Structure Of Lactaldehyde Dehydrogenase Fro 3e-06
1ag8_A 499 Aldehyde Dehydrogenase From Bovine Mitochondria Len 3e-06
3ifg_A 484 Crystal Structure Of Succinate-Semialdehyde Dehydro 4e-06
4e4g_A 521 Crystal Structure Of Putative Methylmalonate-Semial 5e-06
4gnz_A 517 Crystal Structure Of The C707s Mutant Of C-terminal 6e-06
3rhl_A 517 Crystal Structure Of The E673aC707A DOUBLE MUTANT O 6e-06
1wnb_A 495 Escherichia Coli Ydcw Gene Product Is A Medium-Chai 8e-06
3n81_A 500 T244a Mutant Of Human Mitochondrial Aldehyde Dehydr 8e-06
3r31_A 517 Crystal Structure Of Betaine Aldehyde Dehydrogenase 1e-05
3ty7_A 478 Crystal Structure Of Aldehyde Dehydrogenase Family 1e-05
3pqa_A 486 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 1e-05
2d4e_A 515 Crystal Structure Of The Hpcc From Thermus Thermoph 2e-05
3ju8_A 490 Crystal Structure Of Succinylglutamic Semialdehyde 3e-05
3iwj_A 503 Crystal Structure Of Aminoaldehyde Dehydrogenase 2 3e-05
3ek1_A 504 Crystal Structure Of Aldehyde Dehydrogenase From Br 4e-05
3iwk_A 503 Crystal Structure Of Aminoaldehyde Dehydrogenase 1 6e-05
4dal_A 498 Crystal Structure Of Putative Aldehyde Dehydrogenas 6e-05
3u4j_A 528 Crystal Structure Of Nad-Dependent Aldehyde Dehydro 2e-04
4i9b_A 517 Structure Of Aminoaldehyde Dehydrogenase 1 From Sol 3e-04
4i8q_A 514 Structure Of The Aminoaldehyde Dehydrogenase 1 E260 3e-04
3efv_A 462 Crystal Structure Of A Putative Succinate-Semialdeh 4e-04
1t90_A 486 Crystal Structure Of Methylmalonate Semialdehyde De 6e-04
>pdb|3V9G|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Length = 566 Back     alignment and structure

Iteration: 1

Score = 166 bits (421), Expect = 2e-42, Method: Compositional matrix adjust. Identities = 80/120 (66%), Positives = 98/120 (81%), Gaps = 2/120 (1%) Query: 1 LNAFFAKELTKYQPISEDPKSTLNSLRYRGLDGFVAAVSPFNFTAIGGNLAYTPALMGSS 60 NA +A EL QPIS P + NS YRGL+GFVAA+SPFNFTAIGGNLA PALMG+ Sbjct: 175 FNAKYAVELEGQQPISVPPST--NSTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNV 232 Query: 61 VLWKPSDTALLSNYTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVP 120 VLWKPSDTA+L++Y +Y+I+ EAG+PP ++ FVPADGP+FGDT+T+S +L GINFTGSVP Sbjct: 233 VLWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPLFGDTVTSSEHLCGINFTGSVP 292
>pdb|3V9I|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Mutant S352l Length = 566 Back     alignment and structure
>pdb|3V9H|A Chain A, Crystal Structure Of Human 1-Pyrroline-5-Carboxylate Dehydrogenase Mutant S352a Length = 566 Back     alignment and structure
>pdb|3V9J|A Chain A, Crystal Structure Of Mouse 1-Pyrroline-5-Carboxylate Dehydrogenase Complexed With Sulfate Ion Length = 563 Back     alignment and structure
>pdb|4F9I|A Chain A, Crystal Structure Of Proline Utilization A (Puta) From Geobacter Sulfurreducens Pca Length = 1026 Back     alignment and structure
>pdb|2BHP|A Chain A, Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Thermus With Bound Nad. Length = 516 Back     alignment and structure
>pdb|1UZB|A Chain A, 1-pyrroline-5-carboxylate Dehydrogenase Length = 516 Back     alignment and structure
>pdb|2BJA|A Chain A, Crystal Analysis Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Thermus With Bound Nadh Length = 516 Back     alignment and structure
>pdb|3QAN|A Chain A, Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Bacillus Halodurans Length = 538 Back     alignment and structure
>pdb|3I44|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase From Bartonella Henselae At 2.0a Resolution Length = 497 Back     alignment and structure
>pdb|3JZ4|C Chain C, Crystal Structure Of E. Coli Nadp Dependent Enzyme Length = 481 Back     alignment and structure
>pdb|3JZ4|A Chain A, Crystal Structure Of E. Coli Nadp Dependent Enzyme Length = 481 Back     alignment and structure
>pdb|3RJL|A Chain A, Crystal Structure Of 1-Pyrroline-5-Carboxylate Dehydrogenase From Bacillus Licheniformis (Target Nysgrc-000337) Length = 538 Back     alignment and structure
>pdb|3ED6|A Chain A, 1.7 Angstrom Resolution Crystal Structure Of Betaine Aldehyde Dehydrogenase (Betb) From Staphylococcus Aureus Length = 520 Back     alignment and structure
>pdb|4I8P|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 1a From Zea Mays (zmamadh1a) Length = 520 Back     alignment and structure
>pdb|1O9J|A Chain A, The X-Ray Crystal Structure Of Eta-Crystallin Length = 501 Back     alignment and structure
>pdb|4A0M|A Chain A, Crystal Structure Of Betaine Aldehyde Dehydrogenase From Spinach In Complex With Nad Length = 496 Back     alignment and structure
>pdb|3HAZ|A Chain A, Crystal Structure Of Bifunctional Proline Utilization A (Puta) Protein Length = 1001 Back     alignment and structure
>pdb|1BI9|A Chain A, Retinal Dehydrogenase Type Two With Nad Bound Length = 499 Back     alignment and structure
>pdb|3K2W|A Chain A, Crystal Structure Of Betaine-Aldehyde Dehydrogenase From Pseudoalteromonas Atlantica T6c Length = 497 Back     alignment and structure
>pdb|3PRL|A Chain A, Crystal Structure Of Nadp-Dependent Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Halodurans C-125 Length = 505 Back     alignment and structure
>pdb|2WME|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa Length = 490 Back     alignment and structure
>pdb|2WOX|A Chain A, Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa With Nad(P)h-Catalytic Thiol Adduct. Length = 489 Back     alignment and structure
>pdb|3ZQA|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase Mutant C286a From Pseudomonas Aeruginosa In Complex With Nadph Length = 490 Back     alignment and structure
>pdb|2XDR|A Chain A, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase Mutant E252a From Pseudomonas Aeruginosa Length = 489 Back     alignment and structure
>pdb|2WME|C Chain C, Crystallographic Structure Of Betaine Aldehyde Dehydrogenase From Pseudomonas Aeruginosa Length = 490 Back     alignment and structure
>pdb|1BXS|A Chain A, Sheep Liver Class 1 Aldehyde Dehydrogenase With Nad Bound Length = 501 Back     alignment and structure
>pdb|4DNG|A Chain A, Crystal Structure Of Putative Aldehyde Dehydrogenase From Bacillus Subtilis Subsp. Subtilis Str. 168 Length = 485 Back     alignment and structure
>pdb|3R64|A Chain A, Crystal Structure Of A Nad-Dependent Benzaldehyde Dehydrogenase From Corynebacterium Glutamicum Length = 508 Back     alignment and structure
>pdb|1EUH|A Chain A, Apo Form Of A Nadp Dependent Aldehyde Dehydrogenase From Streptococcus Mutans Length = 475 Back     alignment and structure
>pdb|2ESD|A Chain A, Crystal Structure Of Thioacylenzyme Intermediate Of An Nadp Dependent Aldehyde Dehydrogenase Length = 475 Back     alignment and structure
>pdb|1QI1|A Chain A, Ternary Complex Of An Nadp Dependent Aldehyde Dehydrogenase Length = 475 Back     alignment and structure
>pdb|1A4S|A Chain A, Betaine Aldehyde Dehydrogenase From Cod Liver Length = 503 Back     alignment and structure
>pdb|2W8N|A Chain A, The Crytal Structure Of The Oxidized Form Of Human Ssadh Length = 487 Back     alignment and structure
>pdb|2W8P|A Chain A, The Crystal Structure Of Human C340a Ssadh Length = 487 Back     alignment and structure
>pdb|3INL|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant, Aldh22, Complexed With Agonist Alda-1 Length = 500 Back     alignment and structure
>pdb|1O05|A Chain A, Apo Form Of Human Mitochondrial Aldehyde Dehydrogenase Length = 500 Back     alignment and structure
>pdb|1ZUM|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Asian Variant, Aldh22, Apo Form Length = 500 Back     alignment and structure
>pdb|1CW3|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase Complexed With Nad+ And Mn2+ Length = 494 Back     alignment and structure
>pdb|3N80|A Chain A, Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|2ONN|A Chain A, Arg475gln Mutant Of Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|4FR8|A Chain A, Crystal Structure Of Human Aldehyde Dehydrogenase-2 In Complex With Nitroglycerin Length = 500 Back     alignment and structure
>pdb|1NZW|A Chain A, Cys302ser Mutant Of Human Mitochondrial Aldehyde Dehydrogenase Complexed With Nadh And Mg2+ Length = 500 Back     alignment and structure
>pdb|3RHM|A Chain A, Crystal Structure Of The E673q Mutant Of C-Terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase Length = 517 Back     alignment and structure
>pdb|2O2P|A Chain A, Crystal Structure Of The C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase Length = 517 Back     alignment and structure
>pdb|2ID2|A Chain A, Gapn T244s Mutant X-Ray Structure At 2.5 A Length = 475 Back     alignment and structure
>pdb|3RHJ|A Chain A, Crystal Structure Of The E673a Mutant Of The C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase In Complex With Co-Purified Nadp Length = 517 Back     alignment and structure
>pdb|2OPX|A Chain A, Crystal Structure Of Lactaldehyde Dehydrogenase From Escherichia Coli Length = 479 Back     alignment and structure
>pdb|2HG2|A Chain A, Structure Of Lactaldehyde Dehydrogenase Length = 479 Back     alignment and structure
>pdb|3RHR|A Chain A, Crystal Structure Of The C707a Mutant Of The C-Terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase In Complex With Nadph Length = 517 Back     alignment and structure
>pdb|2IMP|A Chain A, Crystal Structure Of Lactaldehyde Dehydrogenase From E. Coli: The Ternary Complex With Product Bound (L)-Lactate And Nadh. Length = 479 Back     alignment and structure
>pdb|1AG8|A Chain A, Aldehyde Dehydrogenase From Bovine Mitochondria Length = 499 Back     alignment and structure
>pdb|3IFG|A Chain A, Crystal Structure Of Succinate-Semialdehyde Dehydrogenase From Burkholderia Pseudomallei, Part 1 Of 2 Length = 484 Back     alignment and structure
>pdb|4E4G|A Chain A, Crystal Structure Of Putative Methylmalonate-Semialdehyde Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 521 Back     alignment and structure
>pdb|4GNZ|A Chain A, Crystal Structure Of The C707s Mutant Of C-terminal Domain Of 10'formyltetrahydrofolate Dehydrogenase In Complex With Nadp Length = 517 Back     alignment and structure
>pdb|3RHL|A Chain A, Crystal Structure Of The E673aC707A DOUBLE MUTANT OF THE C-Terminal Domain Of Rat 10'formyltetrahydrofolate Dehydrogenase In Complex With Co-Purified Nadp Length = 517 Back     alignment and structure
>pdb|1WNB|A Chain A, Escherichia Coli Ydcw Gene Product Is A Medium-Chain Aldehyde Dehydrogenase (Complexed With Nadh And Betaine Aldehyde) Length = 495 Back     alignment and structure
>pdb|3N81|A Chain A, T244a Mutant Of Human Mitochondrial Aldehyde Dehydrogenase, Apo Form Length = 500 Back     alignment and structure
>pdb|3R31|A Chain A, Crystal Structure Of Betaine Aldehyde Dehydrogenase From Agrobacterium Tumefaciens Length = 517 Back     alignment and structure
>pdb|3TY7|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase Family Protein From Staphylococcus Aureus Length = 478 Back     alignment and structure
>pdb|3PQA|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase Gapn From Methanocaldococcus Jannaschii Dsm 2661 Length = 486 Back     alignment and structure
>pdb|2D4E|A Chain A, Crystal Structure Of The Hpcc From Thermus Thermophilus Hb8 Length = 515 Back     alignment and structure
>pdb|3JU8|A Chain A, Crystal Structure Of Succinylglutamic Semialdehyde Dehydrogenase From Pseudomonas Aeruginosa. Length = 490 Back     alignment and structure
>pdb|3IWJ|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 2 From Pisum Sativum (Psamadh2) Length = 503 Back     alignment and structure
>pdb|3EK1|A Chain A, Crystal Structure Of Aldehyde Dehydrogenase From Brucella Melitensis Biovar Abortus 2308 Length = 504 Back     alignment and structure
>pdb|3IWK|A Chain A, Crystal Structure Of Aminoaldehyde Dehydrogenase 1 From Pisum Sativum (Psamadh1) Length = 503 Back     alignment and structure
>pdb|4DAL|A Chain A, Crystal Structure Of Putative Aldehyde Dehydrogenase From Sinorhizobium Meliloti 1021 Length = 498 Back     alignment and structure
>pdb|3U4J|A Chain A, Crystal Structure Of Nad-Dependent Aldehyde Dehydrogenase From Sinorhizobium Meliloti Length = 528 Back     alignment and structure
>pdb|4I9B|A Chain A, Structure Of Aminoaldehyde Dehydrogenase 1 From Solanum Lycopersium (slamadh1) With A Thiohemiacetal Intermediate Length = 517 Back     alignment and structure
>pdb|4I8Q|A Chain A, Structure Of The Aminoaldehyde Dehydrogenase 1 E260a Mutant From Solanum Lycopersicum (slamadh1-e260a) Length = 514 Back     alignment and structure
>pdb|3EFV|A Chain A, Crystal Structure Of A Putative Succinate-Semialdehyde Dehydrogenase From Salmonella Typhimurium Lt2 With Bound Nad Length = 462 Back     alignment and structure
>pdb|1T90|A Chain A, Crystal Structure Of Methylmalonate Semialdehyde Dehydrogenase From Bacillus Subtilis Length = 486 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
4e3x_A 563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 2e-56
3qan_A 538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 5e-33
4f9i_A 1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 5e-25
1uzb_A 516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 2e-22
3haz_A 1001 Proline dehydrogenase; proline utilization A, PUTA 2e-22
3r64_A 508 NAD dependent benzaldehyde dehydrogenase; structur 4e-18
1euh_A 475 NADP dependent non phosphorylating glyceraldehyde- 4e-18
3prl_A 505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 4e-18
4dng_A 485 Uncharacterized aldehyde dehydrogenase ALDY; struc 1e-17
1uxt_A 501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 7e-16
3ju8_A 490 Succinylglutamic semialdehyde dehydrogenase; alpha 1e-15
3ty7_A 478 Putative aldehyde dehydrogenase SAV2122; structura 2e-15
3pqa_A 486 Lactaldehyde dehydrogenase; structural genomics, p 4e-15
3i44_A 497 Aldehyde dehydrogenase; oxidoreductase, structural 4e-15
2j6l_A 500 Aldehyde dehydrogenase family 7 member A1; NAD, re 3e-14
2imp_A 479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 3e-14
3k2w_A 497 Betaine-aldehyde dehydrogenase; structural genomic 1e-13
3rh9_A 506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 2e-13
1ez0_A 510 ALDH, aldehyde dehydrogenase; nucleotide binding d 3e-13
3ek1_A 504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 3e-13
3jz4_A 481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 5e-13
3ifg_A 484 Succinate-semialdehyde dehydrogenase (NADP+); niai 5e-13
3u4j_A 528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 5e-13
3b4w_A 495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 7e-13
2ve5_A 490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 7e-13
2o2p_A 517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 1e-12
1o04_A 500 Aldehyde dehydrogenase, mitochondrial precursor; A 2e-12
1bxs_A 501 Aldehyde dehydrogenase; retinal, class 1, tetramer 3e-12
3v4c_A 528 Aldehyde dehydrogenase (NADP+); structural genomic 3e-12
3iwj_A 503 Putative aminoaldehyde dehydrogenase; rossmann fol 4e-12
2d4e_A 515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 4e-12
3r31_A 517 BADH, betaine aldehyde dehydrogenase; structural g 5e-12
3k9d_A 464 LMO1179 protein, aldehyde dehydrogenase; structura 1e-11
3ed6_A 520 Betaine aldehyde dehydrogenase; structural genomic 1e-11
2y53_A 534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 2e-11
2w8n_A 487 Succinate-semialdehyde dehydrogenase, mitochondria 3e-11
1a4s_A 503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 5e-11
1wnd_A 495 Putative betaine aldehyde dehydrogenase; NADH, flu 2e-10
4f3x_A 498 Putative aldehyde dehydrogenase; structural genomi 2e-10
3my7_A 452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 6e-10
3ros_A 484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 1e-09
1t90_A 486 MMSDH, probable methylmalonate-semialdehyde dehydr 2e-09
3etf_A 462 Putative succinate-semialdehyde dehydrogenase; cen 3e-09
4e4g_A 521 Methylmalonate-semialdehyde dehydrogenase; structu 4e-09
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Length = 563 Back     alignment and structure
 Score =  182 bits (465), Expect = 2e-56
 Identities = 80/119 (67%), Positives = 96/119 (80%), Gaps = 2/119 (1%)

Query: 2   NAFFAKELTKYQPISEDPKSTLNSLRYRGLDGFVAAVSPFNFTAIGGNLAYTPALMGSSV 61
           NA FA EL   QPIS  P +  N   YRGL+GFVAA+SPFNFTAIGGNLA  PALMG+ V
Sbjct: 173 NAKFAVELEGEQPISVPPST--NHTVYRGLEGFVAAISPFNFTAIGGNLAGAPALMGNVV 230

Query: 62  LWKPSDTALLSNYTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVP 120
           LWKPSDTA+L++Y +Y+I+ EAG+PP ++ FVPADGP FGDT+T+S +L GINFTGSVP
Sbjct: 231 LWKPSDTAMLASYAVYRILREAGLPPNIIQFVPADGPTFGDTVTSSEHLCGINFTGSVP 289


>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Length = 538 Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Length = 1026 Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Length = 516 Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Length = 1001 Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Length = 508 Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Length = 475 Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Length = 505 Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Length = 485 Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Length = 501 Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Length = 490 Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Length = 478 Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Length = 486 Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Length = 497 Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Length = 500 Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Length = 479 Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Length = 497 Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Length = 506 Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Length = 510 Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Length = 504 Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Length = 481 Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Length = 484 Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Length = 495 Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Length = 517 Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Length = 500 Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Length = 501 Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Length = 528 Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} PDB: 3iwk_A* 4a0m_A* Length = 503 Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Length = 515 Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Length = 517 Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Length = 464 Back     alignment and structure
>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Length = 520 Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Length = 534 Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Length = 487 Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Length = 503 Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Length = 495 Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Length = 498 Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Length = 452 Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Length = 484 Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Length = 486 Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Length = 462 Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Length = 521 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query120
2wme_A 490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 99.97
3ed6_A 520 Betaine aldehyde dehydrogenase; structural genomic 99.97
1o04_A 500 Aldehyde dehydrogenase, mitochondrial precursor; A 99.97
1bxs_A 501 Aldehyde dehydrogenase; retinal, class 1, tetramer 99.97
2o2p_A 517 Formyltetrahydrofolate dehydrogenase; aldehyde deh 99.97
3ek1_A 504 Aldehyde dehydrogenase; ssgcid, oxidoreductase, st 99.97
1uzb_A 516 1-pyrroline-5-carboxylate dehydrogenase; oxidoredu 99.97
3ifg_A 484 Succinate-semialdehyde dehydrogenase (NADP+); niai 99.97
3u4j_A 528 NAD-dependent aldehyde dehydrogenase; PSI-biology, 99.97
3qan_A 538 1-pyrroline-5-carboxylate dehydrogenase 1; proline 99.97
2d4e_A 515 5-carboxymethyl-2-hydroxymuconate semialdehyde deh 99.97
3ros_A 484 NAD-dependent aldehyde dehydrogenase; nysgrc, PSI- 99.97
3rh9_A 506 Succinate-semialdehyde dehydrogenase (NAD(P)(+)); 99.97
1a4s_A 503 ALDH, betaine aldehyde dehydrogenase; oxidoreducta 99.96
3k2w_A 497 Betaine-aldehyde dehydrogenase; structural genomic 99.96
4e3x_A 563 Delta-1-pyrroline-5-carboxylate dehydrogenase, mit 99.96
3jz4_A 481 Succinate-semialdehyde dehydrogenase [NADP+]; tetr 99.96
3prl_A 505 NADP-dependent glyceraldehyde-3-phosphate dehydro; 99.96
3b4w_A 495 Aldehyde dehydrogenase; RV0223C-NAD complex, struc 99.96
2imp_A 479 Lactaldehyde dehydrogenase; protein-lactate-NADH t 99.96
3r31_A 517 BADH, betaine aldehyde dehydrogenase; structural g 99.96
2ve5_A 490 BADH, betaine aldehyde dehydrogenase; aldehyde oxi 99.96
2w8n_A 487 Succinate-semialdehyde dehydrogenase, mitochondria 99.96
3iwj_A 503 Putative aminoaldehyde dehydrogenase; rossmann fol 99.96
3i44_A 497 Aldehyde dehydrogenase; oxidoreductase, structural 99.96
1euh_A 475 NADP dependent non phosphorylating glyceraldehyde- 99.96
4f3x_A 498 Putative aldehyde dehydrogenase; structural genomi 99.96
1uxt_A 501 Glyceraldehyde-3-phosphate dehydrogenase (NADP+); 99.96
3pqa_A 486 Lactaldehyde dehydrogenase; structural genomics, p 99.96
4e4g_A 521 Methylmalonate-semialdehyde dehydrogenase; structu 99.96
3etf_A 462 Putative succinate-semialdehyde dehydrogenase; cen 99.96
4dng_A 485 Uncharacterized aldehyde dehydrogenase ALDY; struc 99.96
4f9i_A 1026 Proline dehydrogenase/delta-1-pyrroline-5-carboxy 99.96
2j6l_A 500 Aldehyde dehydrogenase family 7 member A1; NAD, re 99.96
1wnd_A 495 Putative betaine aldehyde dehydrogenase; NADH, flu 99.96
3r64_A 508 NAD dependent benzaldehyde dehydrogenase; structur 99.96
3ju8_A 490 Succinylglutamic semialdehyde dehydrogenase; alpha 99.96
1t90_A 486 MMSDH, probable methylmalonate-semialdehyde dehydr 99.95
3ty7_A 478 Putative aldehyde dehydrogenase SAV2122; structura 99.95
3haz_A 1001 Proline dehydrogenase; proline utilization A, PUTA 99.95
1ez0_A 510 ALDH, aldehyde dehydrogenase; nucleotide binding d 99.95
3v4c_A 528 Aldehyde dehydrogenase (NADP+); structural genomic 99.95
3k9d_A 464 LMO1179 protein, aldehyde dehydrogenase; structura 99.95
3lns_A 457 Benzaldehyde dehydrogenase; oxidoreductase, NADP+, 99.94
3my7_A 452 Alcohol dehydrogenase/acetaldehyde dehydrogenase; 99.94
3sza_A 469 Aldehyde dehydrogenase, dimeric NADP-preferring; A 99.93
4ghk_A 444 Gamma-glutamyl phosphate reductase; structural gen 99.93
4h7n_A 474 Aldehyde dehydrogenase; structural genomics, PSI-b 99.93
1vlu_A 468 Gamma-glutamyl phosphate reductase; YOR323C, struc 99.93
2h5g_A 463 Delta 1-pyrroline-5-carboxylate synthetase; dehydr 99.93
2y53_A 534 Aldehyde dehydrogenase (BOX pathway); oxidoreducta 99.93
1o20_A 427 Gamma-glutamyl phosphate reductase; TM0293, struct 99.92
>2wme_A BADH, betaine aldehyde dehydrogenase; aldehyde oxidation, NAD, NADP complex, oxidoreductase; HET: NAP CSO; 2.10A {Pseudomonas aeruginosa} PDB: 2wox_A* 3zqa_A* 2xdr_A* Back     alignment and structure
Probab=99.97  E-value=1.1e-32  Score=218.71  Aligned_cols=119  Identities=27%  Similarity=0.424  Sum_probs=108.9

Q ss_pred             ChHHHHHHhhhcCCCCCCCCCCcceEEEeccCeEEEEEcCCChhhhhHHhhhcccc-CCCeEEeecCCCcHHHHHHHHHH
Q psy1844           1 LNAFFAKELTKYQPISEDPKSTLNSLRYRGLDGFVAAVSPFNFTAIGGNLAYTPAL-MGSSVLWKPSDTALLSNYTIYKI   79 (120)
Q Consensus         1 ~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~p~Gvv~~i~p~n~P~~~~~~~~~~al-aGN~vv~k~~~~~~~~~~~~~~~   79 (120)
                      +++||++.+++..+...+..+....+++++|+|||++|+|||||+..+++++++|| +||+||+|||+.+|+++..++++
T Consensus       112 ~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~P~GVv~~I~PwNfP~~~~~~~~a~ALaaGNtVVlKPse~tp~ta~~l~~l  191 (490)
T 2wme_A          112 VLEYYAGLVPAIEGEQIPLRETSFVYTRREPLGVVAGIGAWNYPVQIALWKSAPALAAGNAMIFKPSEVTPLTALKLAEI  191 (490)
T ss_dssp             HHHHHHHHGGGCCEEEEEEETTEEEEEEEEECSEEEEECCSSSHHHHHHHHHHHHHHTTCEEEEECCTTSCHHHHHHHHH
T ss_pred             HHHHHHhccccccCccccccCCcceeEEecceeEEEEeccccCcchhhhhhHHHHHHcCCeEEEECCcCCHHHHHHHHHH
Confidence            36899999988765332234567789999999999999999999999999999999 69999999999999999999999


Q ss_pred             HHHhCCCCCcEEEEeCCChHHHHHHHhCCCcceEEEecCC
Q psy1844          80 MIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSV  119 (120)
Q Consensus        80 l~~ag~p~g~~~~i~~~~~~~~~~l~~~~~i~~v~ftGs~  119 (120)
                      ++++|+|+|++|++++++.++++.|.+||+||+|.||||+
T Consensus       192 ~~eaGlP~gv~~vv~g~g~~~g~~L~~~p~v~~I~FTGS~  231 (490)
T 2wme_A          192 YTEAGVPDGVFNVLTGSGREVGQWLTEHPLIEKISFTGGT  231 (490)
T ss_dssp             HHHHTCCTTSEEECCSCTTTHHHHHHHCTTCCEEEEESCH
T ss_pred             HHHhCCCCCcEEEEeCChHHHHHHHHhCCCCCEEEEECCh
Confidence            9999999999999999888999999999999999999996



>3ed6_A Betaine aldehyde dehydrogenase; structural genomics, infecti deseases, NAD, oxidoreductase, PSI; 1.70A {Staphylococcus aureus} PDB: 3fg0_A* Back     alignment and structure
>1o04_A Aldehyde dehydrogenase, mitochondrial precursor; ALDH, NAD, NADH, isomerization, oxidoreductase; HET: NAD; 1.42A {Homo sapiens} SCOP: c.82.1.1 PDB: 1nzw_A* 3inl_A* 3n80_A* 1nzz_A* 1o00_A* 1nzx_A* 1o01_A* 1o05_A 1of7_A* 1o02_A* 3inj_A* 3sz9_A* 1zum_A 2onm_A* 2onp_A* 2onn_A 2ono_A* 3n81_A 3n82_A* 3n83_A* ... Back     alignment and structure
>1bxs_A Aldehyde dehydrogenase; retinal, class 1, tetramer, NAD, cytosolic, oxidoreductase; HET: NAD; 2.35A {Ovis aries} SCOP: c.82.1.1 PDB: 1o9j_A* 1bi9_A* Back     alignment and structure
>2o2p_A Formyltetrahydrofolate dehydrogenase; aldehyde dehydrogenase, FDH, oxidoreductase; 1.70A {Rattus norvegicus} PDB: 2o2q_A* 2o2r_A* 3rho_A* 3rhm_A* 3rhj_A* 3rhq_A* 3rhp_A* 3rhr_A* 3rhl_A* Back     alignment and structure
>3ek1_A Aldehyde dehydrogenase; ssgcid, oxidoreductase, structural genomics; HET: MES; 2.10A {Brucella melitensis biovar ABORTUS2308} Back     alignment and structure
>1uzb_A 1-pyrroline-5-carboxylate dehydrogenase; oxidoreductase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.4A {Thermus thermophilus} SCOP: c.82.1.1 PDB: 2eiw_A 2bhq_A* 2bhp_A* 2bja_A* 2bjk_A* 2ehq_A* 2ehu_A* 2eii_A* 2eit_A* 2ej6_A 2ejd_A* 2ejl_A 2iy6_A* 2j40_A* 2j5n_A* Back     alignment and structure
>3ifg_A Succinate-semialdehyde dehydrogenase (NADP+); niaid,.infectious disease, ssgcid, seattle structural genomi for infectious disease; 2.70A {Burkholderia pseudomallei} PDB: 3ifh_Q Back     alignment and structure
>3u4j_A NAD-dependent aldehyde dehydrogenase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, tetramer; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3qan_A 1-pyrroline-5-carboxylate dehydrogenase 1; proline oxidation, redox control, apoptosis, NAD binding, oxidoreductase, PSI-biology; 1.95A {Bacillus halodurans} PDB: 3rjl_A Back     alignment and structure
>2d4e_A 5-carboxymethyl-2-hydroxymuconate semialdehyde dehydrogenase; HPCC; HET: NAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3ros_A NAD-dependent aldehyde dehydrogenase; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Lactobacillus acidophilus} Back     alignment and structure
>3rh9_A Succinate-semialdehyde dehydrogenase (NAD(P)(+)); structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.63A {Marinobacter aquaeolei} Back     alignment and structure
>1a4s_A ALDH, betaine aldehyde dehydrogenase; oxidoreductase, aldehyde oxidation; 2.10A {Gadus callarias} SCOP: c.82.1.1 PDB: 1bpw_A* Back     alignment and structure
>3k2w_A Betaine-aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 1.90A {Pseudoalteromonas atlantica T6C} Back     alignment and structure
>4e3x_A Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial; amino acid metabolism, proline inhibition, oxidoreductase; HET: 16P PGE; 1.24A {Mus musculus} PDB: 3v9k_A* 3v9l_A* 3v9j_A* 3v9g_A 3v9h_A 3v9i_A Back     alignment and structure
>3jz4_A Succinate-semialdehyde dehydrogenase [NADP+]; tetramer, NADP binding, oxidoreductase; HET: NAP; 2.30A {Escherichia coli} Back     alignment and structure
>3prl_A NADP-dependent glyceraldehyde-3-phosphate dehydro; structural genomics, protein structure initiative, dehydroge PSI-biology; 2.00A {Bacillus halodurans} PDB: 3rhh_A* Back     alignment and structure
>3b4w_A Aldehyde dehydrogenase; RV0223C-NAD complex, structural genomics, PSI-2, protein STR initiative; HET: NAD GOL; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2imp_A Lactaldehyde dehydrogenase; protein-lactate-NADH ternary complex, oxidoreductase; HET: NAI; 2.10A {Escherichia coli} PDB: 2ilu_A* 2hg2_A* 2opx_A* Back     alignment and structure
>3r31_A BADH, betaine aldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2w8n_A Succinate-semialdehyde dehydrogenase, mitochondrial; mitochondrion, oxidoreductase, transit peptide, disease mutation, SSA, NAD, ssadh; 2.00A {Homo sapiens} PDB: 2w8o_A 2w8p_A 2w8q_A 2w8r_A* Back     alignment and structure
>3iwj_A Putative aminoaldehyde dehydrogenase; rossmann fold, dimer, betaine aldehyde dehydrogenase, NAD, oxidoreductase; HET: NAD; 2.15A {Pisum sativum} SCOP: c.82.1.0 PDB: 3iwk_A* 4a0m_A* Back     alignment and structure
>3i44_A Aldehyde dehydrogenase; oxidoreductase, structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Bartonella henselae} Back     alignment and structure
>1euh_A NADP dependent non phosphorylating glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase; 1.82A {Streptococcus mutans} SCOP: c.82.1.1 PDB: 1qi6_A 2euh_A* 2id2_A* 2qe0_A* 2esd_A* 1qi1_A* Back     alignment and structure
>4f3x_A Putative aldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology; HET: MSE NAD; 2.01A {Sinorhizobium meliloti} PDB: 4dal_A* Back     alignment and structure
>1uxt_A Glyceraldehyde-3-phosphate dehydrogenase (NADP+); GAPN, ALDH, glucose 1-phosphate, glycolysis, regulation, catatysis, oxidoreductase; HET: G1P NAD; 2.2A {Thermoproteus tenax} SCOP: c.82.1.1 PDB: 1uxp_A* 1uxq_A* 1uxr_A* 1uxn_A* 1uxu_A* 1uxv_A* 1ky8_A* Back     alignment and structure
>3pqa_A Lactaldehyde dehydrogenase; structural genomics, protein structure initiative, nysgrc, P biology, oxidoreductase; 1.50A {Methanocaldococcus jannaschii} PDB: 3rhd_A* Back     alignment and structure
>4e4g_A Methylmalonate-semialdehyde dehydrogenase; structural genomics, protein structure INI nysgrc, PSI-biology; 2.90A {Sinorhizobium meliloti} Back     alignment and structure
>3etf_A Putative succinate-semialdehyde dehydrogenase; center for ST genomics of infectious diseases, oxidoreductase, csgid; 1.85A {Salmonella typhimurium} PDB: 3efv_A Back     alignment and structure
>4dng_A Uncharacterized aldehyde dehydrogenase ALDY; structural genomics, protein structure initiative, nysgrc, P biology; 2.50A {Bacillus subtilis} Back     alignment and structure
>4f9i_A Proline dehydrogenase/delta-1-pyrroline-5-carboxy dehydrogenase; proline utilization A, PUTA, flavoenzyme, structural genomic biology; HET: FAD MES; 2.20A {Geobacter sulfurreducens} Back     alignment and structure
>2j6l_A Aldehyde dehydrogenase family 7 member A1; NAD, reductase, oxidoreductase, lysine catabolism; HET: NAI; 1.3A {Homo sapiens} PDB: 2jg7_A* Back     alignment and structure
>1wnd_A Putative betaine aldehyde dehydrogenase; NADH, fluorescence, kinetics, oxidor; 2.10A {Escherichia coli} SCOP: c.82.1.1 PDB: 1wnb_A Back     alignment and structure
>3r64_A NAD dependent benzaldehyde dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.57A {Corynebacterium glutamicum} Back     alignment and structure
>3ju8_A Succinylglutamic semialdehyde dehydrogenase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: NAD; 1.82A {Pseudomonas aeruginosa} Back     alignment and structure
>1t90_A MMSDH, probable methylmalonate-semialdehyde dehydrogenase; oxidoreductase, NAD; HET: NAD; 2.50A {Bacillus subtilis} Back     alignment and structure
>3ty7_A Putative aldehyde dehydrogenase SAV2122; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3haz_A Proline dehydrogenase; proline utilization A, PUTA, flavoenzyme, 1-pyrroline-5-carboxylate dehydrogenase, oxidoreductase; HET: FAD NAD; 2.10A {Bradyrhizobium japonicum usda 110} Back     alignment and structure
>1ez0_A ALDH, aldehyde dehydrogenase; nucleotide binding domain, NADP+, oxidoreductase; HET: NAP; 2.10A {Vibrio harveyi} SCOP: c.82.1.1 PDB: 1eyy_A* Back     alignment and structure
>3v4c_A Aldehyde dehydrogenase (NADP+); structural genomics, PSI-biology, nysgrc, NEW YORK structura genomics research consortium; HET: PE4; 1.91A {Sinorhizobium meliloti} Back     alignment and structure
>3k9d_A LMO1179 protein, aldehyde dehydrogenase; structural genomics, PSI-2, protein initiative; 2.00A {Listeria monocytogenes} Back     alignment and structure
>3lns_A Benzaldehyde dehydrogenase; oxidoreductase, NADP+, class 3 aldehyde dehyd adduct, covalent catalysis, mandelate racemase pathway; HET: ZBZ NAP; 2.50A {Pseudomonas putida} PDB: 3lv1_A* Back     alignment and structure
>3my7_A Alcohol dehydrogenase/acetaldehyde dehydrogenase; ACDH, PSI, MCSG, structural genomics, midwest center for STR genomics; 2.30A {Vibrio parahaemolyticus} Back     alignment and structure
>3sza_A Aldehyde dehydrogenase, dimeric NADP-preferring; ALDH, rossmann fold, oxidoreductase; 1.48A {Homo sapiens} SCOP: c.82.1.1 PDB: 3szb_A* 1ad3_A* Back     alignment and structure
>4ghk_A Gamma-glutamyl phosphate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.25A {Burkholderia thailandensis} Back     alignment and structure
>4h7n_A Aldehyde dehydrogenase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, ALDH_ddaldh, COG1012, glyco_hydro_97; 2.00A {Anabaena variabilis} Back     alignment and structure
>1vlu_A Gamma-glutamyl phosphate reductase; YOR323C, structural GENO JCSG, protein structure initiative, PSI, joint center for S genomics; 2.29A {Saccharomyces cerevisiae} SCOP: c.82.1.1 Back     alignment and structure
>2h5g_A Delta 1-pyrroline-5-carboxylate synthetase; dehydrogenase, structural genomics, structural genomics CONS SGC, oxidoreductase; 2.25A {Homo sapiens} Back     alignment and structure
>2y53_A Aldehyde dehydrogenase (BOX pathway); oxidoreductase, NADP, nucleotide-binding; HET: NAP; 1.40A {Burkholderia xenovorans LB400} PDB: 2y52_A 2y51_A 2vro_A* 2y5d_A* Back     alignment and structure
>1o20_A Gamma-glutamyl phosphate reductase; TM0293, structural genom JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: c.82.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 120
d1bxsa_ 494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 2e-22
d1o04a_ 494 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 4e-22
d1wnda_ 474 c.82.1.1 (A:) Putative betaine aldehyde dehydrogen 1e-16
d1a4sa_ 503 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 2e-16
d1euha_ 474 c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), 1e-10
d1uzba_ 516 c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogen 3e-07
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Length = 494 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Aldehyde reductase (dehydrogenase), ALDH
species: Sheep (Ovis aries) [TaxId: 9940]
 Score = 88.5 bits (219), Expect = 2e-22
 Identities = 34/118 (28%), Positives = 53/118 (44%), Gaps = 1/118 (0%)

Query: 4   FFAKELTKYQPISEDPKSTLNSLRYRGLDGFVAAVSPFNFTAIGGNLAYTPAL-MGSSVL 62
           + A    K Q  +        +       G    + P+NF  +       PAL  G++V+
Sbjct: 125 YCAGWADKIQGRTIPMDGNFFTYTRSEPVGVCGQIIPWNFPLLMFLWKIGPALSCGNTVV 184

Query: 63  WKPSDTALLSNYTIYKIMIEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSVP 120
            KP++   L+   +  ++ EAG PPGVVN VP  GP  G  I++   +  + FTGS  
Sbjct: 185 VKPAEQTPLTALHMGSLIKEAGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGSTE 242


>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Length = 494 Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Length = 474 Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Length = 503 Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Length = 474 Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 516 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query120
d1bxsa_ 494 Aldehyde reductase (dehydrogenase), ALDH {Sheep (O 99.97
d1o04a_ 494 Aldehyde reductase (dehydrogenase), ALDH {Human (H 99.97
d1a4sa_ 503 Aldehyde reductase (dehydrogenase), ALDH {Baltic c 99.96
d1uzba_ 516 1-pyrroline-5-carboxylate dehydrogenase {Thermus t 99.96
d1wnda_ 474 Putative betaine aldehyde dehydrogenase YdcW {Esch 99.95
d1ez0a_ 504 Aldehyde reductase (dehydrogenase), ALDH {Vibrio h 99.94
d1euha_ 474 Aldehyde reductase (dehydrogenase), ALDH {Streptoc 99.92
d1ky8a_ 499 Non-phosphorylating glyceraldehyde-3-phosphate deh 99.88
d1ad3a_ 446 Aldehyde reductase (dehydrogenase), ALDH {Rat (Rat 99.86
d1o20a_ 414 Gamma-glutamyl phosphate reductase {Thermotoga mar 99.71
d1vlua_ 436 Gamma-glutamyl phosphate reductase {Baker's yeast 99.71
>d1bxsa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ALDH-like
superfamily: ALDH-like
family: ALDH-like
domain: Aldehyde reductase (dehydrogenase), ALDH
species: Sheep (Ovis aries) [TaxId: 9940]
Probab=99.97  E-value=3e-31  Score=208.29  Aligned_cols=118  Identities=29%  Similarity=0.411  Sum_probs=108.1

Q ss_pred             hHHHHHHhhhcCCCCCCCCCCcceEEEeccCeEEEEEcCCChhhhhHHhhhcccc-CCCeEEeecCCCcHHHHHHHHHHH
Q psy1844           2 NAFFAKELTKYQPISEDPKSTLNSLRYRGLDGFVAAVSPFNFTAIGGNLAYTPAL-MGSSVLWKPSDTALLSNYTIYKIM   80 (120)
Q Consensus         2 ~~~~a~~~~~~~~~~~~~~~~~~~~~~~~p~Gvv~~i~p~n~P~~~~~~~~~~al-aGN~vv~k~~~~~~~~~~~~~~~l   80 (120)
                      ++||++..++..+...+...+...+++++|+||+++|+|||||+..+++++++|| +||+||+|||+.+|+++..+.+++
T Consensus       123 ~~~~a~~~~~~~~~~~~~~~~~~~~~~~~P~GVv~~I~PwN~P~~~~~~~i~~ALaaGN~VVlKpse~tp~~a~~l~~~~  202 (494)
T d1bxsa_         123 LRYCAGWADKIQGRTIPMDGNFFTYTRSEPVGVCGQIIPWNFPLLMFLWKIGPALSCGNTVVVKPAEQTPLTALHMGSLI  202 (494)
T ss_dssp             HHHHHHHGGGCCEEEECCSSSEEEEEEEEECCEEEEECCSSSHHHHHHHHHHHHHHTTCEEEEECCTTCCHHHHHHHHHH
T ss_pred             HHHHhhhhhhhcceeecCCCCceeEEEEccEEEEEEEeCccchhHHHHHHHHHHHHcCCeEEEECCCCChHHHHHHHHHH
Confidence            5788888887765333345677889999999999999999999999999999999 699999999999999999999999


Q ss_pred             HHhCCCCCcEEEEeCCChHHHHHHHhCCCcceEEEecCC
Q psy1844          81 IEAGVPPGVVNFVPADGPVFGDTITASPYLAGINFTGSV  119 (120)
Q Consensus        81 ~~ag~p~g~~~~i~~~~~~~~~~l~~~~~i~~v~ftGs~  119 (120)
                      +++|+|+|++|+|++++.+.++.|++||+|++|.||||+
T Consensus       203 ~~aglP~gv~~~v~g~~~~~~~~l~~~p~v~~i~fTGS~  241 (494)
T d1bxsa_         203 KEAGFPPGVVNIVPGYGPTAGAAISSHMDVDKVAFTGST  241 (494)
T ss_dssp             HHHTCCTTSEEECCSCTTTHHHHHHTCTTCSEEEEESCH
T ss_pred             HHhCCCcCeEEEEeCCchHHHHHHHhCCCcCEEEecCCH
Confidence            999999999999999888899999999999999999995



>d1o04a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1a4sa_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Baltic cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1uzba_ c.82.1.1 (A:) 1-pyrroline-5-carboxylate dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wnda_ c.82.1.1 (A:) Putative betaine aldehyde dehydrogenase YdcW {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ez0a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1euha_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1ky8a_ c.82.1.1 (A:) Non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase GapN {Archaeon Thermoproteus tenax [TaxId: 2271]} Back     information, alignment and structure
>d1ad3a_ c.82.1.1 (A:) Aldehyde reductase (dehydrogenase), ALDH {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o20a_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlua_ c.82.1.1 (A:) Gamma-glutamyl phosphate reductase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure