Psyllid ID: psy1854


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
CLQEENKILEDPKSILKLETPPPKRVVAIFEALKRETHWLSMKMDQQFRLKWNNHCNTLLQVFGNLLKTETLVDCTIGADGQYLKAHKVVVSACSPYFQVSWDVVFCMLA
ccccccccccccccccccccccccccccHHHHHHHHHHccccccccEEEEEccccHHHHHHHHHHHHccccEEEEEEEEccEEEEEEEHHHHcccHHHHHHHHHcccccc
cccHHHcccccccccccccccccccccccccccccccccHcccccccEEEEccccHHHHHHHHHHHHcccccEEEEEEccccEEHHHHEEEccccHHHHHHEEEcccccc
clqeenkiledpksilkletpppkRVVAIFEALKRETHWLSMKMDQQFRLKWNNHCNTLLQVFGNLlktetlvdctigadgqyLKAHKVVVSACSPYFQVSWDVVFCMLA
clqeenkiledpksilkletpppkRVVAIFEALKRETHWLSMKMDQQFRLKWNNHCNTLLQVFGNLLKTETLVDCTIGADGQYLKAHKVVVSACSPYFQVSWDVVFCMLA
CLQEENKILEDPKSILKLETPPPKRVVAIFEALKRETHWLSMKMDQQFRLKWNNHCNTLLQVFGNLLKTETLVDCTIGADGQYLKAHKVVVSACSPYFQVSWDVVFCMLA
************************RVVAIFEALKRETHWLSMKMDQQFRLKWNNHCNTLLQVFGNLLKTETLVDCTIGADGQYLKAHKVVVSACSPYFQVSWDVVFCML*
************************************************RLKWNNHCNTLLQVFGNLLKTETLVDCTIGADGQYLKAHKVVVSACSPYFQVSWDVVFCMLA
CLQEENKILEDPKSILKLETPPPKRVVAIFEALKRETHWLSMKMDQQFRLKWNNHCNTLLQVFGNLLKTETLVDCTIGADGQYLKAHKVVVSACSPYFQVSWDVVFCMLA
CL****K**********************************MKMDQQFRLKWNNHCNTLLQVFGNLLKTETLVDCTIGADGQYLKAHKVVVSACSPYFQVSWDVVFCMLA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
CLQEENKILEDPKSILKLETPPPKRVVAIFEALKRETHWLSMKMDQQFRLKWNNHCNTLLQVFGNLLKTETLVDCTIGADGQYLKAHKVVVSACSPYFQVSWDVVFCMLA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query110 2.2.26 [Sep-21-2011]
Q9V5M6 963 Longitudinals lacking pro no N/A 0.518 0.059 0.684 2e-18
Q867Z4 970 Longitudinals lacking pro no N/A 0.518 0.058 0.684 2e-18
Q7KQZ4 787 Longitudinals lacking pro no N/A 0.518 0.072 0.684 2e-18
P42284 549 Longitudinals lacking pro no N/A 0.518 0.103 0.684 2e-18
P42283 891 Longitudinals lacking pro no N/A 0.518 0.063 0.684 2e-18
Q9V5M3 878 Longitudinals lacking pro no N/A 0.518 0.064 0.684 3e-18
P17789 643 Protein tramtrack, beta i no N/A 0.518 0.088 0.603 2e-14
P42282 813 Protein tramtrack, alpha no N/A 0.518 0.070 0.603 2e-14
Q9W0K4 1067 Protein bric-a-brac 2 OS= no N/A 0.709 0.073 0.410 4e-13
Q9W0K7 977 Protein bric-a-brac 1 OS= no N/A 0.490 0.055 0.555 9e-13
>sp|Q9V5M6|LOLA5_DROME Longitudinals lacking protein, isoforms J/P/Q/S/Z OS=Drosophila melanogaster GN=lola PE=1 SV=4 Back     alignment and function desciption
 Score = 91.3 bits (225), Expect = 2e-18,   Method: Composition-based stats.
 Identities = 39/57 (68%), Positives = 48/57 (84%)

Query: 42 MKMDQQFRLKWNNHCNTLLQVFGNLLKTETLVDCTIGADGQYLKAHKVVVSACSPYF 98
          M  DQQF L+WNNH +TL+ VF  LL+ ETLVDCT+ A+G++LKAHKVV+SACSPYF
Sbjct: 1  MDDDQQFCLRWNNHQSTLISVFDTLLENETLVDCTLAAEGKFLKAHKVVLSACSPYF 57




Putative transcription factor required for axon growth and guidance in the central and peripheral nervous systems. Repels CNS axons away from the midline by promoting the expression of the midline repellent sli and its receptor robo.
Drosophila melanogaster (taxid: 7227)
>sp|Q867Z4|LOLA4_DROME Longitudinals lacking protein, isoforms F/I/K/T OS=Drosophila melanogaster GN=lola PE=1 SV=1 Back     alignment and function description
>sp|Q7KQZ4|LOLA3_DROME Longitudinals lacking protein, isoforms A/B/D/L OS=Drosophila melanogaster GN=lola PE=1 SV=1 Back     alignment and function description
>sp|P42284|LOLA2_DROME Longitudinals lacking protein, isoforms H/M/V OS=Drosophila melanogaster GN=lola PE=1 SV=2 Back     alignment and function description
>sp|P42283|LOLA1_DROME Longitudinals lacking protein, isoform G OS=Drosophila melanogaster GN=lola PE=1 SV=2 Back     alignment and function description
>sp|Q9V5M3|LOLA6_DROME Longitudinals lacking protein, isoforms N/O/W/X/Y OS=Drosophila melanogaster GN=lola PE=1 SV=3 Back     alignment and function description
>sp|P17789|TTKB_DROME Protein tramtrack, beta isoform OS=Drosophila melanogaster GN=ttk PE=1 SV=2 Back     alignment and function description
>sp|P42282|TTKA_DROME Protein tramtrack, alpha isoform OS=Drosophila melanogaster GN=ttk PE=1 SV=3 Back     alignment and function description
>sp|Q9W0K4|BAB2_DROME Protein bric-a-brac 2 OS=Drosophila melanogaster GN=bab2 PE=1 SV=2 Back     alignment and function description
>sp|Q9W0K7|BAB1_DROME Protein bric-a-brac 1 OS=Drosophila melanogaster GN=bab1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query110
195582232 671 GD25965 [Drosophila simulans] gi|1941929 0.609 0.099 0.626 1e-18
467229 467 Lola protein short isoform [Drosophila m 0.518 0.122 0.684 7e-17
45552563 577 longitudinals lacking, isoform Y [Drosop 0.518 0.098 0.684 7e-17
45552565 602 longitudinals lacking, isoform X [Drosop 0.518 0.094 0.684 7e-17
28573897 603 longitudinals lacking, isoform Q [Drosop 0.518 0.094 0.684 7e-17
24652470 891 longitudinals lacking, isoform G [Drosop 0.518 0.063 0.684 7e-17
28573881 706 longitudinals lacking, isoform A [Drosop 0.518 0.080 0.684 7e-17
24652482 787 longitudinals lacking, isoform C [Drosop 0.518 0.072 0.684 7e-17
28573909 465 longitudinals lacking, isoform M [Drosop 0.518 0.122 0.684 7e-17
29539425 602 Lola protein isoform S [Drosophila melan 0.518 0.094 0.684 7e-17
>gi|195582232|ref|XP_002080932.1| GD25965 [Drosophila simulans] gi|194192941|gb|EDX06517.1| GD25965 [Drosophila simulans] Back     alignment and taxonomy information
 Score = 97.1 bits (240), Expect = 1e-18,   Method: Composition-based stats.
 Identities = 42/67 (62%), Positives = 53/67 (79%)

Query: 42  MKMDQQFRLKWNNHCNTLLQVFGNLLKTETLVDCTIGADGQYLKAHKVVVSACSPYFQVS 101
           M  DQQF L+WNNH +TL+ VF  LL+ ETLVDCT+ A+G++LKAHKVV+SACSPYF + 
Sbjct: 1   MDDDQQFCLRWNNHQSTLISVFDTLLENETLVDCTLAAEGKFLKAHKVVLSACSPYFAMD 60

Query: 102 WDVVFCM 108
            D  FC+
Sbjct: 61  DDQQFCL 67




Source: Drosophila simulans

Species: Drosophila simulans

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|467229|gb|AAA19592.1| Lola protein short isoform [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|45552563|ref|NP_995804.1| longitudinals lacking, isoform Y [Drosophila melanogaster] gi|45445595|gb|AAS64875.1| longitudinals lacking, isoform Y [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|45552565|ref|NP_995805.1| longitudinals lacking, isoform X [Drosophila melanogaster] gi|45445594|gb|AAS64874.1| longitudinals lacking, isoform X [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|28573897|ref|NP_788319.1| longitudinals lacking, isoform Q [Drosophila melanogaster] gi|28380930|gb|AAM68768.2| longitudinals lacking, isoform Q [Drosophila melanogaster] gi|281183401|gb|ADA53569.1| FI13033p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|24652470|ref|NP_524766.2| longitudinals lacking, isoform G [Drosophila melanogaster] gi|78711875|ref|NP_788312.2| longitudinals lacking, isoform R [Drosophila melanogaster] gi|317373382|sp|P42283.2|LOLA1_DROME RecName: Full=Longitudinals lacking protein, isoform G gi|21627542|gb|AAF58782.2| longitudinals lacking, isoform G [Drosophila melanogaster] gi|71911712|gb|AAO41425.2| longitudinals lacking, isoform R [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|28573881|ref|NP_724953.2| longitudinals lacking, isoform A [Drosophila melanogaster] gi|28380928|gb|AAF58775.3| longitudinals lacking, isoform A [Drosophila melanogaster] gi|28626486|gb|AAO49162.1| LD03274p [Drosophila melanogaster] gi|220942526|gb|ACL83806.1| lola-PA [synthetic construct] gi|220952742|gb|ACL88914.1| lola-PA [synthetic construct] Back     alignment and taxonomy information
>gi|24652482|ref|NP_724946.1| longitudinals lacking, isoform C [Drosophila melanogaster] gi|78711864|ref|NP_724949.2| longitudinals lacking, isoform B [Drosophila melanogaster] gi|73920870|sp|Q7KQZ4.1|LOLA3_DROME RecName: Full=Longitudinals lacking protein, isoforms A/B/D/L gi|7303724|gb|AAF58773.1| longitudinals lacking, isoform C [Drosophila melanogaster] gi|71911713|gb|AAF58776.3| longitudinals lacking, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|28573909|ref|NP_788320.1| longitudinals lacking, isoform M [Drosophila melanogaster] gi|28380931|gb|AAO41431.1| longitudinals lacking, isoform M [Drosophila melanogaster] gi|29539389|dbj|BAC67577.1| Lola protein isoform A [Drosophila melanogaster] gi|29539429|dbj|BAC67597.1| Lola protein isoform A [Drosophila melanogaster] gi|29539469|dbj|BAC67617.1| Lola protein isoform A [Drosophila melanogaster] gi|29539509|dbj|BAC67637.1| Lola protein isoform A [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|29539425|dbj|BAC67595.1| Lola protein isoform S [Drosophila melanogaster] gi|29539465|dbj|BAC67615.1| Lola protein isoform S [Drosophila melanogaster] gi|29539505|dbj|BAC67635.1| Lola protein isoform S [Drosophila melanogaster] gi|29539545|dbj|BAC67655.1| Lola protein isoform S [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query110
FB|FBgn0005630 970 lola "longitudinals lacking" [ 0.518 0.058 0.684 1.9e-16
FB|FBgn0003870 813 ttk "tramtrack" [Drosophila me 0.518 0.070 0.603 4e-13
FB|FBgn0025525 1067 bab2 "bric a brac 2" [Drosophi 0.490 0.050 0.555 2.9e-11
FB|FBgn0004870 977 bab1 "bric a brac 1" [Drosophi 0.490 0.055 0.555 3.3e-11
FB|FBgn0004652 955 fru "fruitless" [Drosophila me 0.509 0.058 0.517 6.8e-11
FB|FBgn0263108 798 BtbVII "BTB-protein-VII" [Dros 0.490 0.067 0.555 1.4e-10
FB|FBgn0022238127 lolal "lola like" [Drosophila 0.527 0.456 0.465 3.2e-10
FB|FBgn0003715 1046 CG16778 [Drosophila melanogast 0.472 0.049 0.538 1.1e-09
FB|FBgn0000210 880 br "broad" [Drosophila melanog 0.490 0.061 0.481 2.4e-09
FB|FBgn0038339 967 CG6118 [Drosophila melanogaste 0.6 0.068 0.424 1.2e-08
FB|FBgn0005630 lola "longitudinals lacking" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 216 (81.1 bits), Expect = 1.9e-16, P = 1.9e-16
 Identities = 39/57 (68%), Positives = 48/57 (84%)

Query:    42 MKMDQQFRLKWNNHCNTLLQVFGNLLKTETLVDCTIGADGQYLKAHKVVVSACSPYF 98
             M  DQQF L+WNNH +TL+ VF  LL+ ETLVDCT+ A+G++LKAHKVV+SACSPYF
Sbjct:     1 MDDDQQFCLRWNNHQSTLISVFDTLLENETLVDCTLAAEGKFLKAHKVVLSACSPYF 57




GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=ISS
GO:0007411 "axon guidance" evidence=IGI;NAS;IMP
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;NAS
GO:0007409 "axonogenesis" evidence=IMP
GO:0005634 "nucleus" evidence=NAS;IDA
GO:0006357 "regulation of transcription from RNA polymerase II promoter" evidence=NAS
GO:0016199 "axon midline choice point recognition" evidence=IGI;IMP
GO:0005515 "protein binding" evidence=IPI
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0019730 "antimicrobial humoral response" evidence=IMP
GO:0045476 "nurse cell apoptotic process" evidence=IMP
GO:0045467 "R7 cell development" evidence=IMP
GO:0006355 "regulation of transcription, DNA-dependent" evidence=IMP
GO:0007464 "R3/R4 cell fate commitment" evidence=IMP
GO:0048854 "brain morphogenesis" evidence=IMP
GO:0031987 "locomotion involved in locomotory behavior" evidence=IMP
GO:0001964 "startle response" evidence=IMP
GO:0002121 "inter-male aggressive behavior" evidence=IMP
GO:0008406 "gonad development" evidence=IMP
GO:0022008 "neurogenesis" evidence=IMP
FB|FBgn0003870 ttk "tramtrack" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0025525 bab2 "bric a brac 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0004870 bab1 "bric a brac 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0004652 fru "fruitless" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0263108 BtbVII "BTB-protein-VII" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0022238 lolal "lola like" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0003715 CG16778 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0000210 br "broad" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0038339 CG6118 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query110
pfam00651101 pfam00651, BTB, BTB/POZ domain 2e-09
smart0022597 smart00225, BTB, Broad-Complex, Tramtrack and Bric 3e-04
>gnl|CDD|216043 pfam00651, BTB, BTB/POZ domain Back     alignment and domain information
 Score = 50.3 bits (121), Expect = 2e-09
 Identities = 14/38 (36%), Positives = 20/38 (52%)

Query: 63  FGNLLKTETLVDCTIGADGQYLKAHKVVVSACSPYFQV 100
              L +   L D T+    +   AHK V++ACSPYF+ 
Sbjct: 1   LNELRENGELCDVTLVVGDKEFHAHKAVLAACSPYFKA 38


The BTB (for BR-C, ttk and bab) or POZ (for Pox virus and Zinc finger) domain is present near the N-terminus of a fraction of zinc finger (pfam00096) proteins and in proteins that contain the pfam01344 motif such as Kelch and a family of pox virus proteins. The BTB/POZ domain mediates homomeric dimerisation and in some instances heteromeric dimerisation. The structure of the dimerised PLZF BTB/POZ domain has been solved and consists of a tightly intertwined homodimer. The central scaffolding of the protein is made up of a cluster of alpha-helices flanked by short beta-sheets at both the top and bottom of the molecule. POZ domains from several zinc finger proteins have been shown to mediate transcriptional repression and to interact with components of histone deacetylase co-repressor complexes including N-CoR and SMRT. The POZ or BTB domain is also known as BR-C/Ttk or ZiN. Length = 101

>gnl|CDD|197585 smart00225, BTB, Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 110
PHA02713 557 hypothetical protein; Provisional 99.47
KOG4441|consensus 571 99.42
PHA02790 480 Kelch-like protein; Provisional 99.17
PF00651111 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB ( 99.08
PHA03098 534 kelch-like protein; Provisional 98.91
KOG4350|consensus 620 98.83
smart0022590 BTB Broad-Complex, Tramtrack and Bric a brac. Doma 98.49
KOG2075|consensus 521 97.91
KOG0783|consensus 1267 97.65
KOG4591|consensus 280 97.59
KOG0783|consensus 1267 96.59
KOG4682|consensus 488 96.56
KOG2838|consensus 401 95.1
KOG2838|consensus 401 92.6
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
Probab=99.47  E-value=2.6e-14  Score=119.61  Aligned_cols=57  Identities=28%  Similarity=0.451  Sum_probs=53.0

Q ss_pred             eecCCcHHHHHHHHHhhhcCCCcceEEEEeC-CeEEEeEEEeeccCCHHHHHhhCCCC
Q psy1854          50 LKWNNHCNTLLQVFGNLLKTETLVDCTIGAD-GQYLKAHKVVVSACSPYFQVSWDVVF  106 (110)
Q Consensus        50 ~~~~~h~~~~l~~l~~lr~~~~~~DV~l~v~-g~~f~aHk~VLAa~S~yFr~mf~~~p  106 (110)
                      +.+..|...+++.|++||+++.+|||+|.++ |++|+|||.||||+|+|||+||++++
T Consensus         3 ~~~~~h~~~~l~~l~~lr~~~~l~DV~L~v~~~~~f~~Hr~vLaa~S~YF~amF~~~~   60 (557)
T PHA02713          3 IDDIKHNRRVVSNISNLLDDDILCDVIITIGDGEEIKAHKTILAAGSKYFRTLFTTPM   60 (557)
T ss_pred             cchhhhhHHHHHHHHHHHhCCCCCCEEEEeCCCCEEeehHHHHhhcCHHHHHHhcCCc
Confidence            3456899999999999999999999999997 89999999999999999999999864



>KOG4441|consensus Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>PF00651 BTB: BTB/POZ domain; InterPro: IPR013069 The BTB (for BR-C, ttk and bab) [] or POZ (for Pox virus and Zinc finger) [] domain is present near the N terminus of a fraction of zinc finger (IPR007087 from INTERPRO) proteins and in proteins that contain the IPR006652 from INTERPRO motif such as Kelch and a family of pox virus proteins Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG4350|consensus Back     alignment and domain information
>smart00225 BTB Broad-Complex, Tramtrack and Bric a brac Back     alignment and domain information
>KOG2075|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG4591|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG4682|consensus Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information
>KOG2838|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query110
3m52_A117 Crystal Structure Of The Btb Domain From The Miz-1Z 4e-04
2ihc_A124 Crystal Structure Of The Bric-A-Brac (Btb) Domain O 6e-04
2q81_A119 Crystal Structure Of The Miz-1 BtbPOZ DOMAIN Length 7e-04
2z8h_A138 Structure Of Mouse Bach1 Btb Domain Length = 138 7e-04
>pdb|3M52|A Chain A, Crystal Structure Of The Btb Domain From The Miz-1ZBTB17 Transcription Regulator Length = 117 Back     alignment and structure

Iteration: 1

Score = 39.7 bits (91), Expect = 4e-04, Method: Compositional matrix adjust. Identities = 18/53 (33%), Positives = 29/53 (54%) Query: 50 LKWNNHCNTLLQVFGNLLKTETLVDCTIGADGQYLKAHKVVVSACSPYFQVSW 102 + + H +L+ + L DCT DG + KAHK V++ACS YF++ + Sbjct: 3 MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLF 55
>pdb|2IHC|A Chain A, Crystal Structure Of The Bric-A-Brac (Btb) Domain Of Human Bach1 Length = 124 Back     alignment and structure
>pdb|2Q81|A Chain A, Crystal Structure Of The Miz-1 BtbPOZ DOMAIN Length = 119 Back     alignment and structure
>pdb|2Z8H|A Chain A, Structure Of Mouse Bach1 Btb Domain Length = 138 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query110
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 2e-13
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 2e-13
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 5e-13
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 7e-13
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 7e-13
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 1e-12
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 2e-12
2vpk_A116 Myoneurin; transcription regulation, transcription 2e-12
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 3e-12
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 4e-12
3b84_A119 Zinc finger and BTB domain-containing protein 48; 1e-11
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 1e-11
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 2e-11
3hve_A 256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 5e-11
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 5e-10
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 6e-10
3i3n_A 279 Kelch-like protein 11; structural genomics, BTB, K 7e-10
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 9e-09
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 5e-08
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 4e-07
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Length = 138 Back     alignment and structure
 Score = 60.7 bits (148), Expect = 2e-13
 Identities = 18/59 (30%), Positives = 31/59 (52%)

Query: 40 LSMKMDQQFRLKWNNHCNTLLQVFGNLLKTETLVDCTIGADGQYLKAHKVVVSACSPYF 98
          +S+     F  + + H   +L    +  K + L D T+  +GQ  +AH+ V++ACS YF
Sbjct: 4  MSVSESAVFAYESSVHSTNVLLSLNDQRKKDVLCDVTVLVEGQRFRAHRSVLAACSSYF 62


>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Length = 116 Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Length = 144 Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Length = 129 Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Length = 127 Back     alignment and structure
>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Length = 124 Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} PDB: 3ohv_A Length = 125 Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Length = 116 Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Length = 135 Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Length = 120 Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Length = 119 Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Length = 121 Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Length = 119 Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Length = 256 Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Length = 145 Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Length = 172 Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} Length = 279 Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} Length = 119 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Length = 312 Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Length = 109 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query110
2z8h_A138 Transcription regulator protein BACH1; BTB, POZ, d 99.69
2ihc_A124 Transcription regulator protein BACH1; BRIC-A-BRAC 99.68
3fkc_A116 Transcriptional regulator kaiso; zinc finger and B 99.67
3ohu_A125 Transcription regulator protein BACH2; BTB/POZ dom 99.66
1r29_A127 B-cell lymphoma 6 protein; BTB domain, transcripti 99.64
3b84_A119 Zinc finger and BTB domain-containing protein 48; 99.64
3ga1_A129 Nucleus accumbens-associated protein 1; BTB/POZ do 99.64
1buo_A121 POZ domain, protein (promyelocytic leukemia zinc f 99.63
2if5_A120 Zinc finger and BTB domain-containing protein 7A; 99.63
2ppi_A144 Gigaxonin; BTB domain, protein degradation, struct 99.61
2yy9_A135 Zinc finger and BTB domain-containing protein 48; 99.6
2q81_A119 MIZ-1 protein; BTB/POZ domain, transcription; HET: 99.59
2vpk_A116 Myoneurin; transcription regulation, transcription 99.58
3hve_A 256 Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, dis 99.56
3i3n_A 279 Kelch-like protein 11; structural genomics, BTB, K 99.52
3htm_A172 Speckle-type POZ protein; BTB, SPOP, ubiquitin, li 99.39
4eoz_A145 Speckle-type POZ protein; E3 ubiquitin ligase, nuc 99.36
2vkp_A109 BTB/POZ domain-containing protein 6; protein-bindi 99.33
3m5b_A119 Zinc finger and BTB domain-containing protein 32; 99.3
3hqi_A312 Speckle-type POZ protein; SPOP, ubiquitin, puckere 99.18
4ajy_C97 Transcription elongation factor B polypeptide 1; E 97.54
2ast_A 159 S-phase kinase-associated protein 1A; SCF-substrat 96.98
1fs1_B 141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 94.82
1hv2_A99 Elongin C, ELC1; protein-peptide complex, signalin 91.62
2fnj_C96 Transcription elongation factor B polypeptide 1; b 91.59
2p1m_A 160 SKP1-like protein 1A; F-BOX, leucine rich repeat, 91.54
>2z8h_A Transcription regulator protein BACH1; BTB, POZ, disulfide bond, activator, DNA-binding, nucleus, phosphorylation, repressor; 2.50A {Mus musculus} Back     alignment and structure
Probab=99.69  E-value=1e-17  Score=115.28  Aligned_cols=66  Identities=27%  Similarity=0.414  Sum_probs=61.0

Q ss_pred             ccccCceeEeecCCcHHHHHHHHHhhhcCCCcceEEEEeCCeEEEeEEEeeccCCHHHHHhhCCCC
Q psy1854          41 SMKMDQQFRLKWNNHCNTLLQVFGNLLKTETLVDCTIGADGQYLKAHKVVVSACSPYFQVSWDVVF  106 (110)
Q Consensus        41 ~~~~~~~~~~~~~~h~~~~l~~l~~lr~~~~~~DV~l~v~g~~f~aHk~VLAa~S~yFr~mf~~~p  106 (110)
                      +.+....+.++|+.|...+++.|+++|+++.+|||+|.++|+.|+|||.|||++|+||++||.+.+
T Consensus         5 ~~~~~~~~~~~~~~~~~~l~~~l~~l~~~~~~~Dv~l~v~~~~f~aHk~vLaa~S~yF~~~f~~~~   70 (138)
T 2z8h_A            5 SVSESAVFAYESSVHSTNVLLSLNDQRKKDVLCDVTVLVEGQRFRAHRSVLAACSSYFHSRIVGQT   70 (138)
T ss_dssp             CCCTTCCCCCCCSSHHHHHHHHHHHHHHHTCSCCEEEEETTEEEEECHHHHHHHCHHHHHHHTTCC
T ss_pred             CCCCCCeeEecCCchHHHHHHHHHHHHhhCCCcCeEEEECCEEEechHHHHHHcCHHHHHHHhcCC
Confidence            334457888999999999999999999999999999999999999999999999999999999865



>2ihc_A Transcription regulator protein BACH1; BRIC-A-BRAC domain,transcription factor, protein-PROT interaction; 2.44A {Homo sapiens} Back     alignment and structure
>3fkc_A Transcriptional regulator kaiso; zinc finger and BTB domain containing 33, kaiso transcriptio ZNF-kaiso, ZNF348,wugsc:H_DJ525N14.1; 1.70A {Homo sapiens} PDB: 3m4t_A 3m8v_A Back     alignment and structure
>3ohu_A Transcription regulator protein BACH2; BTB/POZ domain; 2.10A {Homo sapiens} SCOP: d.42.1.0 PDB: 3ohv_A Back     alignment and structure
>1r29_A B-cell lymphoma 6 protein; BTB domain, transcriptional repression, transcription; 1.30A {Homo sapiens} SCOP: d.42.1.1 PDB: 1r28_A 1r2b_A 3bim_A 3lbz_A* 3e4u_A Back     alignment and structure
>3b84_A Zinc finger and BTB domain-containing protein 48; krueppel related zinc finger protein 3, HKR3, ZBTB48, Z finger, oncogene; 1.74A {Homo sapiens} Back     alignment and structure
>3ga1_A Nucleus accumbens-associated protein 1; BTB/POZ domain, phosphoprotein, repressor, transcri transcription regulation; 2.10A {Homo sapiens} Back     alignment and structure
>1buo_A POZ domain, protein (promyelocytic leukemia zinc finger prote; protein-protein interaction domain, transcriptional represso finger protein; 1.90A {Homo sapiens} SCOP: d.42.1.1 PDB: 1cs3_A Back     alignment and structure
>2if5_A Zinc finger and BTB domain-containing protein 7A; POZ domain, POK, proto oncogene, transcription F transcription; 2.00A {Homo sapiens} PDB: 2nn2_A Back     alignment and structure
>2ppi_A Gigaxonin; BTB domain, protein degradation, structural genomics, struct genomics consortium, SGC, structural protein; 2.40A {Homo sapiens} Back     alignment and structure
>2yy9_A Zinc finger and BTB domain-containing protein 48; mouse, HKR3, structural genomics, NPPSFA; 2.60A {Mus musculus} Back     alignment and structure
>2q81_A MIZ-1 protein; BTB/POZ domain, transcription; HET: PG4; 2.10A {Homo sapiens} PDB: 3m52_A Back     alignment and structure
>2vpk_A Myoneurin; transcription regulation, transcription, metal-binding, alternative splicing, zinc, nucleus, BTB domain, zinc-finger, DNA-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3hve_A Gigaxonin; ubiquitin, cytoplasm, cytoskeleton, disease mutation, kelch repeat, neurodegeneration, phosphoprotein, polymorphism, UBL conjugation; 2.80A {Homo sapiens} PDB: 3hve_B Back     alignment and structure
>3i3n_A Kelch-like protein 11; structural genomics, BTB, KLHL11A, SGC, structural genomics consortium, kelch repeat, secreted, protein binding; 2.60A {Homo sapiens} PDB: 4ap2_A* 4apf_A Back     alignment and structure
>3htm_A Speckle-type POZ protein; BTB, SPOP, ubiquitin, ligase, nucleus, UBL conjugation pathway, protein binding; 2.50A {Homo sapiens} Back     alignment and structure
>4eoz_A Speckle-type POZ protein; E3 ubiquitin ligase, nucleus, protein binding; 2.40A {Homo sapiens} Back     alignment and structure
>2vkp_A BTB/POZ domain-containing protein 6; protein-binding; 1.9A {Homo sapiens} Back     alignment and structure
>3m5b_A Zinc finger and BTB domain-containing protein 32; POZ domain, BTB/POZ domain, ZBTB32, zinc finger domain-containing protein 32; 2.00A {Homo sapiens} SCOP: d.42.1.0 Back     alignment and structure
>3hqi_A Speckle-type POZ protein; SPOP, ubiquitin, puckered, nucleus, UBL conjugation pathway, protein binding, ligase; 2.62A {Homo sapiens} PDB: 3hu6_A Back     alignment and structure
>4ajy_C Transcription elongation factor B polypeptide 1; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 2izv_C 3dcg_B 3zrc_B* 3zrf_B 3ztc_B* 3ztd_B* 3zun_B* 2c9w_C 4awj_B* 4b95_B* 4b9k_B* 2fnj_C 1lqb_B 1lm8_C 2jz3_C 2xai_B 4b9k_E* Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>1hv2_A Elongin C, ELC1; protein-peptide complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.42.1.1 Back     alignment and structure
>2fnj_C Transcription elongation factor B polypeptide 1; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.42.1.1 PDB: 1lqb_B 1lm8_C 2jz3_C 2xai_B 2c9w_C 2izv_C 3dcg_B 3zrc_B* 3zrf_B Back     alignment and structure
>2p1m_A SKP1-like protein 1A; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_A* 2p1o_A* 2p1p_A* 2p1q_A* 3c6n_A* 3c6o_A* 3c6p_A* 3ogk_A* 3ogl_A* 3ogm_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 110
d1r29a_122 d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB 2e-10
d1buoa_121 d.42.1.1 (A:) Promyelocytic leukaemia zinc finger 3e-10
>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 122 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: B-cell lymphoma 6 (Bcl6) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 51.7 bits (123), Expect = 2e-10
 Identities = 14/51 (27%), Positives = 24/51 (47%)

Query: 49 RLKWNNHCNTLLQVFGNLLKTETLVDCTIGADGQYLKAHKVVVSACSPYFQ 99
          ++++  H + +L     L   + L D  I    +  +AHK V+ ACS  F 
Sbjct: 2  QIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMACSGLFY 52


>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query110
d1buoa_121 Promyelocytic leukaemia zinc finger (PLZF) protein 99.68
d1r29a_122 B-cell lymphoma 6 (Bcl6) protein BTB domain {Human 99.65
>d1buoa_ d.42.1.1 (A:) Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: POZ domain
superfamily: POZ domain
family: BTB/POZ domain
domain: Promyelocytic leukaemia zinc finger (PLZF) protein BTB domain
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.68  E-value=4.6e-18  Score=114.45  Aligned_cols=61  Identities=25%  Similarity=0.279  Sum_probs=57.5

Q ss_pred             ceeEeecCCcHHHHHHHHHhhhcCCCcceEEEEeCCeEEEeEEEeeccCCHHHHHhhCCCC
Q psy1854          46 QQFRLKWNNHCNTLLQVFGNLLKTETLVDCTIGADGQYLKAHKVVVSACSPYFQVSWDVVF  106 (110)
Q Consensus        46 ~~~~~~~~~h~~~~l~~l~~lr~~~~~~DV~l~v~g~~f~aHk~VLAa~S~yFr~mf~~~p  106 (110)
                      +.+.+++++|...+++.|+++|.++.||||+|.++|++|+|||+|||++|+||++||.+++
T Consensus         2 ~~~~~~~~~h~~~ll~~l~~l~~~~~~~Dv~l~v~~~~~~aHk~vLaa~S~~F~~lf~~~~   62 (121)
T d1buoa_           2 GMIQLQNPSHPTGLLCKANQMRLAGTLCDVVIMVDSQEFHAHRTVLACTSKMFEILFHRNS   62 (121)
T ss_dssp             CCCCCCCTTHHHHHHHHHHHHHHHTTTCCEEEEESSCEEEECHHHHHHHCHHHHHHTTSCC
T ss_pred             CeEEEcCCchHHHHHHHHHHHHhcCCcEeEEEEECCEEEEEEHHHhcccChhhhhhccCcc
Confidence            3567889999999999999999999999999999999999999999999999999998764



>d1r29a_ d.42.1.1 (A:) B-cell lymphoma 6 (Bcl6) protein BTB domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure