Psyllid ID: psy1886

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170
VYNEIQAILGNDPDKVPTYEQLQKLDLLNRVIKETMRLYPAVPIVARSSPEELHLCGYTIPAGVTIAVFIYGLHRHPQHWPNPEQFNPDRFLPSESSKRHPNAFMPFSLGARNCLGYKYAMLQMKVTVSTILRRYKVLVGDRCKTMEDIRFQFGLTLKTLPGNDIKLEPR
cHHHHHHHHcccccccccHHHHccccHHHHHHHHHccccccccEEEEEccccEEEccEEEccccEEEEEEcccccccccccccccccccccccccccccccccEEccccccccHHHHHHHHHHHHHHHHHHHHccEEEEccccccccccEEcccEEEEcccccEEEEEEc
cHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcccccccHHHHccccEEEccEEEccccEEEEEEEEEccccccccccHHccHHHcccccccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHccccccEEEEccccEEEEEEcc
VYNEIQAilgndpdkvptyeqlQKLDLLNRVIKETMrlypavpivarsspeelhlcgytipaGVTIAVFIYGlhrhpqhwpnpeqfnpdrflpsesskrhpnafmpfslgarnCLGYKYAMLQMKVTVSTILRRYKVLVGDRCKTMEDIRFQFGLtlktlpgndiklepr
VYNEIqailgndpdkvptyEQLQKLDLLNRVIKETMRLYPAVPIVARSSPEELHLCGYTIPAGVTIAVFIYGLHRHPQHWPNPEQFNPDRFLPSESSKRHPNAFMPFSLGARNCLGYKYAMLQMKVTVSTILRRYKVLVGDRCKTMEDIRFqfgltlktlpgndiklepr
VYNEIQAILGNDPDKVPTYEQLQKLDLLNRVIKETMRLYPAVPIVARSSPEELHLCGYTIPAGVTIAVFIYGLHRHPQHWPNPEQFNPDRFLPSESSKRHPNAFMPFSLGARNCLGYKYAMLQMKVTVSTILRRYKVLVGDRCKTMEDIRFQFGLTLKTLPGNDIKLEPR
***************VPTYEQLQKLDLLNRVIKETMRLYPAVPIVARSSPEELHLCGYTIPAGVTIAVFIYGLHRHPQHW***********************FMPFSLGARNCLGYKYAMLQMKVTVSTILRRYKVLVGDRCKTMEDIRFQFGLTLKTLP*********
VYNEIQAILGNDPDKVPTYEQLQKLDLLNRVIKETMRLYPAVPIVARSSPEELHLCGYTIPAGVTIAVFIYGLHRHPQHWPNPEQFNPDRFLPSESSKRHPNAFMPFSLGARNCLGYKYAMLQMKVTVSTILRRYKVLVGDRCKTMEDIRFQFGLTLKTLPGNDIKLEPR
VYNEIQAILGNDPDKVPTYEQLQKLDLLNRVIKETMRLYPAVPIVARSSPEELHLCGYTIPAGVTIAVFIYGLHRHPQHWPNPEQFNPDRFLPSESSKRHPNAFMPFSLGARNCLGYKYAMLQMKVTVSTILRRYKVLVGDRCKTMEDIRFQFGLTLKTLPGNDIKLEPR
VYN*IQAILGNDPDKVPTYEQLQKLDLLNRVIKETMRLYPAVPIVARSSPEELHLCGYTIPAGVTIAVFIYGLHRHPQHWPNPEQFNPDRFLPSESSKRHPNAFMPFSLGARNCLGYKYAMLQMKVTVSTILRRYKVLVGDRCKTMEDIRFQFGLTLKTLPGNDIKLEPR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VYNEIQAILGNDPDKVPTYEQLQKLDLLNRVIKETMRLYPAVPIVARSSPEELHLCGYTIPAGVTIAVFIYGLHRHPQHWPNPEQFNPDRFLPSESSKRHPNAFMPFSLGARNCLGYKYAMLQMKVTVSTILRRYKVLVGDRCKTMEDIRFQFGLTLKTLPGNDIKLEPR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query170 2.2.26 [Sep-21-2011]
Q9VA27535 Cytochrome P450 4c3 OS=Dr yes N/A 0.982 0.312 0.411 6e-35
Q9V3S0556 Cytochrome P450 4g1 OS=Dr no N/A 0.982 0.300 0.430 7e-33
Q9VMS9509 Probable cytochrome P450 no N/A 0.964 0.322 0.396 3e-32
P29981511 Cytochrome P450 4C1 OS=Bl N/A N/A 0.976 0.324 0.411 9e-32
Q9V559515 Probable cytochrome P450 no N/A 0.970 0.320 0.429 2e-31
Q9VMS7509 Probable cytochrome P450 no N/A 0.964 0.322 0.402 3e-31
Q9V557520 Probable cytochrome P450 no N/A 0.964 0.315 0.426 4e-31
Q9VYY4574 Cytochrome P450 4g15 OS=D no N/A 0.976 0.289 0.412 6e-31
Q5RCN6525 Cytochrome P450 4V2 OS=Po yes N/A 0.976 0.316 0.4 6e-31
Q6ZWL3525 Cytochrome P450 4V2 OS=Ho yes N/A 0.976 0.316 0.4 7e-31
>sp|Q9VA27|CP4C3_DROME Cytochrome P450 4c3 OS=Drosophila melanogaster GN=Cyp4c3 PE=2 SV=1 Back     alignment and function desciption
 Score =  146 bits (369), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 70/170 (41%), Positives = 107/170 (62%), Gaps = 3/170 (1%)

Query: 1   VYNEIQAILGNDPDKVPTYEQLQKLDLLNRVIKETMRLYPAVPIVARSSPEELHLCGYTI 60
           V  E+ +I G+D +   T + L  +  L   IK+++RL+P+VP++AR   E++++ G  +
Sbjct: 368 VVEELDSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNIGGKIV 427

Query: 61  PAGVTIAVFIYGLHRHPQHWPNPEQFNPDRFLPSESSKRHPNAFMPFSLGARNCLGYKYA 120
           PAG    +  Y LHR+P+ +P PEQFNPD FLP   + RHP A++PFS G RNC+G K+A
Sbjct: 428 PAGTQAIIMTYALHRNPRVFPKPEQFNPDNFLPENCAGRHPFAYIPFSAGPRNCIGQKFA 487

Query: 121 MLQMKVTVSTILRRYKVLVGDRCKTMEDIRFQFGLTLKTLPGNDIKLEPR 170
           +L+ K  +ST+LR+YK+   DR    ED+     L L+   G  +K+ PR
Sbjct: 488 ILEEKAVISTVLRKYKIEAVDR---REDLTLLGELILRPKDGLRVKITPR 534
May be involved in the metabolism of insect hormones and in the breakdown of synthetic insecticides.
Drosophila melanogaster (taxid: 7227)
EC: 1EC: .EC: 1EC: 4EC: .EC: -EC: .EC: -
>sp|Q9V3S0|CP4G1_DROME Cytochrome P450 4g1 OS=Drosophila melanogaster GN=Cyp4g1 PE=2 SV=1 Back     alignment and function description
>sp|Q9VMS9|C4AC1_DROME Probable cytochrome P450 4ac1 OS=Drosophila melanogaster GN=Cyp4ac1 PE=2 SV=1 Back     alignment and function description
>sp|P29981|CP4C1_BLADI Cytochrome P450 4C1 OS=Blaberus discoidalis GN=CYP4C1 PE=2 SV=1 Back     alignment and function description
>sp|Q9V559|CP4P3_DROME Probable cytochrome P450 4p3 OS=Drosophila melanogaster GN=Cyp4p3 PE=2 SV=3 Back     alignment and function description
>sp|Q9VMS7|C4AC3_DROME Probable cytochrome P450 4ac3 OS=Drosophila melanogaster GN=Cyp4ac3 PE=2 SV=2 Back     alignment and function description
>sp|Q9V557|CP4P2_DROME Probable cytochrome P450 4p2 OS=Drosophila melanogaster GN=Cyp4p2 PE=2 SV=1 Back     alignment and function description
>sp|Q9VYY4|C4G15_DROME Cytochrome P450 4g15 OS=Drosophila melanogaster GN=Cyp4g15 PE=2 SV=1 Back     alignment and function description
>sp|Q5RCN6|CP4V2_PONAB Cytochrome P450 4V2 OS=Pongo abelii GN=CYP4V2 PE=2 SV=1 Back     alignment and function description
>sp|Q6ZWL3|CP4V2_HUMAN Cytochrome P450 4V2 OS=Homo sapiens GN=CYP4V2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query170
241694810 422 P450 CYP319A1, putative [Ixodes scapular 0.976 0.393 0.461 5e-38
350416638 560 PREDICTED: cytochrome P450 4g15-like [Bo 0.970 0.294 0.468 5e-36
170069354 528 cytochrome P450 [Culex quinquefasciatus] 0.976 0.314 0.435 5e-36
427785159 529 hypothetical protein [Rhipicephalus pulc 0.982 0.315 0.441 8e-36
340722435 560 PREDICTED: cytochrome P450 4g15-like [Bo 0.976 0.296 0.459 9e-36
427779689 566 hypothetical protein [Rhipicephalus pulc 0.982 0.295 0.441 9e-36
270009257 501 cytochrome P450-like protein [Tribolium 0.988 0.335 0.458 1e-35
198436000 503 PREDICTED: similar to cytochrome P450, f 0.982 0.332 0.423 2e-35
357614194 592 putative cytochrome P450 [Danaus plexipp 0.958 0.275 0.456 2e-35
170070780 514 cytochrome P450 [Culex quinquefasciatus] 0.958 0.317 0.437 2e-35
>gi|241694810|ref|XP_002413005.1| P450 CYP319A1, putative [Ixodes scapularis] gi|215506819|gb|EEC16313.1| P450 CYP319A1, putative [Ixodes scapularis] Back     alignment and taxonomy information
 Score =  162 bits (410), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 114/171 (66%), Gaps = 5/171 (2%)

Query: 1   VYNEIQAILGNDPDKVPTYEQLQKLDLLNRVIKETMRLYPAVPIVARSSPEELHLCGYTI 60
           V+ E+ AI+G++P+K  T E L+KL  L+RVIKE  RLYP+VP++ R++ E+  + G+ I
Sbjct: 248 VHEELDAIVGDEPEKNITLEDLKKLTYLDRVIKECQRLYPSVPLIGRTASEDFEMGGHLI 307

Query: 61  PAGVTIAVFIYGLHRHPQHWPNPEQFNPDRFLPSESSKRHPNAFMPFSLGARNCLGYKYA 120
           PAG  I VFIY LHR P  +P PE+F+PDRFLP  S KRHP +++PFS G RNC+G K+A
Sbjct: 308 PAGANIGVFIYALHRDPDVFPKPEEFDPDRFLPENSEKRHPLSYLPFSAGPRNCIGQKFA 367

Query: 121 MLQMKVTVSTILRRYKVLVGD-RCKTMEDIRFQFGLTLKTLPGNDIKLEPR 170
            +++K+ V  I+R + V   D R K +  +     + L+   G  IK+ PR
Sbjct: 368 SMEVKIIVGHIMRSFIVQSMDPRDKLLVSLE----IVLRVANGLRIKVVPR 414

Source: Ixodes scapularis

Species: Ixodes scapularis

Genus: Ixodes

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350416638|ref|XP_003491030.1| PREDICTED: cytochrome P450 4g15-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|170069354|ref|XP_001869200.1| cytochrome P450 [Culex quinquefasciatus] gi|167865214|gb|EDS28597.1| cytochrome P450 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|427785159|gb|JAA58031.1| hypothetical protein [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|340722435|ref|XP_003399611.1| PREDICTED: cytochrome P450 4g15-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|427779689|gb|JAA55296.1| hypothetical protein [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|270009257|gb|EFA05705.1| cytochrome P450-like protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|198436000|ref|XP_002132121.1| PREDICTED: similar to cytochrome P450, family 4, subfamily V, polypeptide 2 [Ciona intestinalis] Back     alignment and taxonomy information
>gi|357614194|gb|EHJ68958.1| putative cytochrome P450 [Danaus plexippus] Back     alignment and taxonomy information
>gi|170070780|ref|XP_001869710.1| cytochrome P450 [Culex quinquefasciatus] gi|167866700|gb|EDS30083.1| cytochrome P450 [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query170
FB|FBgn0015032535 Cyp4c3 "Cytochrome P450-4c3" [ 0.982 0.312 0.411 1.1e-33
ZFIN|ZDB-GENE-061103-88510 cyp4v7 "cytochrome P450, famil 0.976 0.325 0.423 3.2e-33
FB|FBgn0031693509 Cyp4ac1 "Cyp4ac1" [Drosophila 0.964 0.322 0.396 1.4e-31
FB|FBgn0010019556 Cyp4g1 "Cytochrome P450-4g1" [ 0.982 0.300 0.430 4.1e-31
WB|WBGene00013585511 cyp-42A1 [Caenorhabditis elega 0.964 0.320 0.388 7.8e-31
FB|FBgn0033397515 Cyp4p3 "Cyp4p3" [Drosophila me 0.970 0.320 0.429 1.1e-30
FB|FBgn0030304574 Cyp4g15 "Cyp4g15" [Drosophila 0.976 0.289 0.424 1.4e-30
FB|FBgn0033395520 Cyp4p2 "Cyp4p2" [Drosophila me 0.941 0.307 0.431 1.6e-30
FB|FBgn0031695509 Cyp4ac3 "Cyp4ac3" [Drosophila 0.964 0.322 0.402 2.2e-30
UNIPROTKB|Q6ZWL3525 CYP4V2 "Cytochrome P450 4V2" [ 0.976 0.316 0.4 3.8e-30
FB|FBgn0015032 Cyp4c3 "Cytochrome P450-4c3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 367 (134.2 bits), Expect = 1.1e-33, P = 1.1e-33
 Identities = 70/170 (41%), Positives = 107/170 (62%)

Query:     1 VYNEIQAILGNDPDKVPTYEQLQKLDLLNRVIKETMRLYPAVPIVARSSPEELHLCGYTI 60
             V  E+ +I G+D +   T + L  +  L   IK+++RL+P+VP++AR   E++++ G  +
Sbjct:   368 VVEELDSIFGDDKETPATMKNLMDMRYLECCIKDSLRLFPSVPMMARMVGEDVNIGGKIV 427

Query:    61 PAGVTIAVFIYGLHRHPQHWPNPEQFNPDRFLPSESSKRHPNAFMPFSLGARNCLGYKYA 120
             PAG    +  Y LHR+P+ +P PEQFNPD FLP   + RHP A++PFS G RNC+G K+A
Sbjct:   428 PAGTQAIIMTYALHRNPRVFPKPEQFNPDNFLPENCAGRHPFAYIPFSAGPRNCIGQKFA 487

Query:   121 MLQMKVTVSTILRRYKVLVGDRCKTMEDIRFQFGLTLKTLPGNDIKLEPR 170
             +L+ K  +ST+LR+YK+   DR    ED+     L L+   G  +K+ PR
Sbjct:   488 ILEEKAVISTVLRKYKIEAVDR---REDLTLLGELILRPKDGLRVKITPR 534
GO:0043231 "intracellular membrane-bounded organelle" evidence=NAS
GO:0009055 "electron carrier activity" evidence=IEA;NAS
GO:0016020 "membrane" evidence=NAS
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0020037 "heme binding" evidence=IEA
GO:0005506 "iron ion binding" evidence=IEA
ZFIN|ZDB-GENE-061103-88 cyp4v7 "cytochrome P450, family 4, subfamily V, polypeptide 7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0031693 Cyp4ac1 "Cyp4ac1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0010019 Cyp4g1 "Cytochrome P450-4g1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00013585 cyp-42A1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
FB|FBgn0033397 Cyp4p3 "Cyp4p3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030304 Cyp4g15 "Cyp4g15" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0033395 Cyp4p2 "Cyp4p2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0031695 Cyp4ac3 "Cyp4ac3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZWL3 CYP4V2 "Cytochrome P450 4V2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query170
pfam00067461 pfam00067, p450, Cytochrome P450 6e-50
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 1e-30
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 2e-28
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 1e-27
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 1e-25
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 1e-25
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 3e-25
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 2e-20
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 2e-20
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 8e-19
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 4e-17
PLN02196463 PLN02196, PLN02196, abscisic acid 8'-hydroxylase 1e-16
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 1e-16
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 5e-16
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 5e-16
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 6e-16
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 2e-15
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 5e-15
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 2e-14
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 4e-13
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 7e-11
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 2e-10
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 2e-10
PLN02774463 PLN02774, PLN02774, brassinosteroid-6-oxidase 7e-10
PLN02971543 PLN02971, PLN02971, tryptophan N-hydroxylase 8e-09
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 1e-06
PLN02648480 PLN02648, PLN02648, allene oxide synthase 2e-04
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information 
 Score =  166 bits (422), Expect = 6e-50
 Identities = 63/163 (38%), Positives = 97/163 (59%), Gaps = 4/163 (2%)

Query: 1   VYNEIQAILGNDPDKVPTYEQLQKLDLLNRVIKETMRLYPAVPI-VARSSPEELHLCGYT 59
           +  EI  ++G+   + PTY+ LQ +  L+ VIKET+RL+P VP+ + R   ++  + GY 
Sbjct: 298 LREEIDEVIGDK--RSPTYDDLQNMPYLDAVIKETLRLHPVVPLLLPREVTKDTVIPGYL 355

Query: 60  IPAGVTIAVFIYGLHRHPQHWPNPEQFNPDRFLPSESSKRHPNAFMPFSLGARNCLGYKY 119
           IP G  + V +Y LHR P+ +PNPE+F+P+RFL      R   AF+PF  G RNCLG + 
Sbjct: 356 IPKGTLVIVNLYALHRDPEVFPNPEEFDPERFLDENGKFRKSFAFLPFGAGPRNCLGERL 415

Query: 120 AMLQMKVTVSTILRRYKVLVGDRCKTMEDIRFQFGLTLKTLPG 162
           A ++MK+ ++T+L+ ++V +        DI    GL L   P 
Sbjct: 416 ARMEMKLFLATLLQNFEVEL-PPGTDPPDIDETPGLLLPPKPY 457

Cytochrome P450s are haem-thiolate proteins involved in the oxidative degradation of various compounds. They are particularly well known for their role in the degradation of environmental toxins and mutagens. They can be divided into 4 classes, according to the method by which electrons from NAD(P)H are delivered to the catalytic site. Sequence conservation is relatively low within the family - there are only 3 absolutely conserved residues - but their general topography and structural fold are highly conserved. The conserved core is composed of a coil termed the 'meander', a four-helix bundle, helices J and K, and two sets of beta-sheets. These constitute the haem-binding loop (with an absolutely conserved cysteine that serves as the 5th ligand for the haem iron), the proton-transfer groove and the absolutely conserved EXXR motif in helix K. While prokaryotic P450s are soluble proteins, most eukaryotic P450s are associated with microsomal membranes. their general enzymatic function is to catalyze regiospecific and stereospecific oxidation of non-activated hydrocarbons at physiological temperatures. Length = 461
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|177847 PLN02196, PLN02196, abscisic acid 8'-hydroxylase Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information
>gnl|CDD|178373 PLN02774, PLN02774, brassinosteroid-6-oxidase Back     alignment and domain information
>gnl|CDD|166612 PLN02971, PLN02971, tryptophan N-hydroxylase Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|215350 PLN02648, PLN02648, allene oxide synthase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 170
KOG0158|consensus499 100.0
KOG0156|consensus489 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
KOG0157|consensus497 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
PLN02738633 carotene beta-ring hydroxylase 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 100.0
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN02426502 cytochrome P450, family 94, subfamily C protein 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
KOG0159|consensus519 100.0
PLN03195516 fatty acid omega-hydroxylase; Provisional 100.0
PLN02687517 flavonoid 3'-monooxygenase 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PLN02966502 cytochrome P450 83A1 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
PLN02936489 epsilon-ring hydroxylase 100.0
KOG0684|consensus486 100.0
PLN02648480 allene oxide synthase 100.0
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.97
>KOG0158|consensus Back     alignment and domain information 
Probab=100.00  E-value=7.9e-45  Score=298.78  Aligned_cols=167  Identities=37%  Similarity=0.739  Sum_probs=148.3

Q ss_pred             CHHHHHHHhCCCCCCCCCHHHhcCCHHHHHHHHHHccCCCCCccceeccCCceeec-CEEeCCCCEEEEechhhccCCCC
Q psy1886           1 VYNEIQAILGNDPDKVPTYEQLQKLDLLNRVIKETMRLYPAVPIVARSSPEELHLC-GYTIPAGVTIAVFIYGLHRHPQH   79 (170)
Q Consensus         1 l~~Ei~~~~~~~~~~~~~~~~~~~lp~l~~~i~E~lRl~~~~~~~~r~~~~~~~~~-g~~ip~g~~v~~~~~~~~~d~~~   79 (170)
                      |||||+++..+.  ..++++.+++|+||++||+||||+||+++.+.|.+++|+++. ++.|++|+.|.++.+++|+||++
T Consensus       331 LreEI~~~~~~~--~~ltyd~l~~L~YLd~Vi~ETLR~yP~~~~~~R~C~k~~~i~~~~~i~kG~~V~Ip~~alH~Dp~~  408 (499)
T KOG0158|consen  331 LREEIDEVLEEK--EGLTYDSLSKLKYLDMVIKETLRLYPPAPFLNRECTKDYEIPGGFVIPKGTPVMIPTYALHHDPEY  408 (499)
T ss_pred             HHHHHHHHhccc--CCCCHHHHhCCcHHHHHHHHHHhhCCCcccccceecCceecCCCeEeCCCCEEEeecccccCCccc
Confidence            689999997764  339999999999999999999999999999999999999999 99999999999999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCccccCCCCCCCcccHHHHHHHHHHHHHHHhhccEEeecCcCCcccceeeecceeeec
Q psy1886          80 WPNPEQFNPDRFLPSESSKRHPNAFMPFSLGARNCLGYKYAMLQMKVTVSTILRRYKVLVGDRCKTMEDIRFQFGLTLKT  159 (170)
Q Consensus        80 ~~~p~~f~p~R~l~~~~~~~~~~~~~~Fg~G~r~C~G~~la~~e~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~p  159 (170)
                      ||+|++|+||||.+++.+...+..|+|||.|||+|+|++||++|+|++|+.||++|+++.+. ...........++++.|
T Consensus       409 ~p~Pe~F~PERF~~~~~~~~~~~~ylPFG~GPR~CIGmRfa~mq~K~~L~~lL~~f~~~~~~-~t~~~~~~~~~~~~l~p  487 (499)
T KOG0158|consen  409 WPEPEKFKPERFEEENNKSRHPGAYLPFGVGPRNCIGMRFALMEAKLALAHLLRNFSFEVCP-TTIIPLEGDPKGFTLSP  487 (499)
T ss_pred             CCCcccCCCccCCCCcccccCCccccCCCCCccccHHHHHHHHHHHHHHHHHHhhCEEecCC-cccCcccCCccceeeec
Confidence            99999999999998877777889999999999999999999999999999999999996544 11122111123678899


Q ss_pred             CCCceeEEeeC
Q psy1886         160 LPGNDIKLEPR  170 (170)
Q Consensus       160 ~~~~~v~~~~R  170 (170)
                      +.++++++++|
T Consensus       488 k~gi~Lkl~~r  498 (499)
T KOG0158|consen  488 KGGIWLKLEPR  498 (499)
T ss_pred             CCceEEEEEeC
Confidence            99999999987

>KOG0156|consensus Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>KOG0157|consensus Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>KOG0159|consensus Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>KOG0684|consensus Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query170
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 2e-21
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 2e-21
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 2e-21
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 3e-18
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 3e-18
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 4e-18
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 6e-18
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 7e-16
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 7e-16
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 3e-15
2pg6_A476 Crystal Structure Of Human Microsomal P450 2a6 L240 5e-15
1z10_A476 Crystal Structure Of Human Microsomal P450 2a6 With 5e-15
3ebs_A476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 5e-15
2pg7_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 5e-15
2pg5_A476 Crystal Structure Of Human Microsomal P450 2a6 N297 5e-15
4dvq_A483 Structure Of Human Aldosterone Synthase, Cyp11b2, I 3e-14
3eqm_A503 Crystal Structure Of Human Placental Aromatase Cyto 4e-14
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 8e-14
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 1e-13
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 1e-13
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 2e-13
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 2e-13
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 2e-13
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 2e-13
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 2e-13
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 2e-13
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 2e-13
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 2e-13
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 2e-13
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 2e-13
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 2e-13
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 2e-13
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 2e-13
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 2e-13
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 2e-13
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 2e-13
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 2e-13
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 2e-13
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 2e-13
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 2e-13
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 2e-13
1fah_A471 Structure Of Cytochrome P450 Length = 471 2e-13
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 2e-13
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 2e-13
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 2e-13
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 2e-13
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 2e-13
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 2e-13
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 2e-13
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 3e-13
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 3e-13
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 4e-13
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 4e-13
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 5e-13
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 5e-13
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 6e-13
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 7e-13
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 7e-13
1ea1_A455 Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) 8e-13
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 8e-13
3ibd_A476 Crystal Structure Of A Cytochrome P450 2b6 Genetic 8e-13
1x8v_A455 Estriol-Bound And Ligand-Free Structures Of Sterol 9e-13
2w0a_A455 Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[( 9e-13
1u13_A455 Crystal Structure Analysis Of The C37lC151TC442A-Tr 9e-13
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 1e-12
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 1e-12
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 2e-12
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 2e-12
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 2e-12
4h1n_A479 Crystal Structure Of P450 2b4 F297a Mutant In Compl 3e-12
2q6n_A478 Structure Of Cytochrome P450 2b4 With Bound 1-(4- C 3e-12
1suo_A476 Structure Of Mammalian Cytochrome P450 2b4 With Bou 4e-12
1po5_A476 Structure Of Mammalian Cytochrome P450 2b4 Length = 4e-12
3e4e_A476 Human Cytochrome P450 2e1 In Complex With The Inhib 8e-12
3tk3_A476 Cytochrome P450 2b4 Mutant L437a In Complex With 4- 2e-11
3pm0_A507 Structural Characterization Of The Complex Between 4e-11
3khm_A464 Crystal Structure Of Sterol 14alpha-Demethylase (Cy 6e-11
1pq2_A476 Crystal Structure Of Human Drug Metabolizing Cytoch 6e-11
2wuz_A473 X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In 6e-11
3k1o_A458 Crystal Structure Of Sterol 14-alpha Demethylase (c 6e-11
3qm4_A479 Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Compl 1e-10
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 1e-10
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 1e-10
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 1e-10
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 2e-10
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 3e-10
1n97_A389 Crystal Stucture Of Cyp175a1 From Thermus Thermophi 3e-10
3l4d_A453 Crystal Structure Of Sterol 14-Alpha Demethylase (C 3e-10
3r9c_A418 Crystal Structure Of Mycobacterium Smegmatis Cyp164 3e-10
3ejb_B404 Crystal Structure Of P450bioi In Complex With Tetra 4e-10
1wiy_A389 Crystal Structure Analysis Of A 6-Coordinated Cytoc 2e-09
3tik_A454 Sterol 14-Alpha Demethylase (Cyp51) From Trypanosom 7e-09
3gw9_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 7e-09
3g1q_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 7e-09
3p99_A453 Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma 8e-09
2wv2_A475 X-Ray Structure Of Cyp51 From The Human Pathogen Tr 8e-09
2x2n_A475 X-Ray Structure Of Cyp51 From Trypanosoma Brucei In 8e-09
3tyw_A417 Crystal Structure Of Cyp105n1 From Streptomyces Coe 2e-08
3tkt_A450 Crystal Structure Of Cyp108d1 From Novosphingobium 2e-08
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 2e-08
2jjn_A411 Structure Of Closed Cytochrome P450 Eryk Length = 4 3e-08
2vrv_A431 Structure Of Histidine Tagged Cytochrome P450 Eryk 4e-08
1f4t_A368 Thermophilic P450: Cyp119 From Sulfolobus Solfactar 7e-08
1io8_A368 Thermophilic Cytochrome P450 (Cyp119) From Sulfolob 7e-08
4i8v_A491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 7e-08
2bvj_A436 Ligand-Free Structure Of Cytochrome P450 Pikc (Cyp1 2e-07
2whw_A436 Selective Oxidation Of Carbolide C-H Bonds By Engin 2e-07
2vz7_A436 Crystal Structure Of The Yc-17-Bound Pikc D50n Muta 3e-07
1ue8_A367 Crystal Structure Of Thermophilic Cytochrome P450 F 1e-06
3voo_A407 Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Len 2e-06
3vno_A407 Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Len 2e-06
3vm4_A407 Cytochrome P450sp Alpha (Cyp152b1) In Complex With 2e-06
3awq_A415 Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Leng 2e-06
3awm_A415 Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With P 2e-06
4dnz_A410 The Crystal Structures Of Cyp199a4 Length = 410 4e-06
3awp_A415 Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Len 4e-06
2fr7_A412 Crystal Structure Of Cytochrome P450 Cyp199a2 Lengt 4e-06
3dax_A491 Crystal Structure Of Human Cyp7a1 Length = 491 6e-06
3sn5_A491 Crystal Structure Of Human Cyp7a1 In Complex With C 6e-06
2rch_A495 Crystal Structure Of Arabidopsis Thaliana Allene Ox 7e-06
2rcm_A495 Crystal Structure Of Arabidopsis Thaliana Allene Ox 8e-06
2uuq_A414 Crystal Structure Of Cyp130 From Mycobacterium Tube 1e-05
2wh8_A413 Interaction Of Mycobacterium Tuberculosis Cyp130 Wi 1e-05
2wgy_A413 Crystal Structure Of The G243a Mutant Of Cyp130 Fro 1e-05
3mgx_A415 Crystal Structure Of P450 Oxyd That Is Involved In 1e-05
1cpt_A428 Crystal Structure And Refinement Of Cytochrome P450 1e-05
2yoo_A407 Cholest-4-en-3-one Bound Structure Of Cyp142 From M 3e-05
2z3t_A425 Crystal Structure Of Substrate Free Cytochrome P450 6e-05
4aw3_A417 Structure Of The Mixed-Function P450 Mycg F286v Mut 7e-05
1jip_A403 P450eryf(A245s)KETOCONAZOLE Length = 403 1e-04
1jio_A403 P450eryf/6deb Length = 403 1e-04
1z8q_A404 Ferrous Dioxygen Complex Of The A245t Cytochrome P4 1e-04
1z8p_A404 Ferrous Dioxygen Complex Of The A245s Cytochrome P4 1e-04
1z8o_A404 Ferrous Dioxygen Complex Of The Wild-Type Cytochrom 1e-04
1t93_A406 Evidence For Multiple Substrate Recognition And Mol 1e-04
3tzo_A410 The Role Of I87 Of Cyp158a2 In Oxidative Coupling R 1e-04
1s1f_A406 Crystal Structure Of Streptomyces Coelicolor A3(2) 1e-04
3zsn_A417 Structure Of The Mixed-Function P450 Mycg F286a Mut 1e-04
3tnk_A407 Crystal Structure Of Mutant I87r In Cyp158a2 Length 1e-04
2d0e_A407 Substrate Assited In Oxygen Activation In Cytochrom 1e-04
3p3o_A416 Crystal Structure Of The Cytochrome P450 Monooxygen 1e-04
2d09_A407 A Role For Active Site Water Molecules And Hydroxyl 1e-04
1se6_A406 Crystal Structure Of Streptomyces Coelicolor A3(2) 1e-04
3p3l_A406 Crystal Structure Of The Cytochrome P450 Monooxygen 1e-04
1egy_A403 Cytochrome P450eryf With 9-Aminophenanthrene Bound 1e-04
3e5l_A403 Crystal Structure Of Cyp105p1 H72a Mutant Length = 2e-04
3e5j_A403 Crystal Structure Of Cyp105p1 Wild-type Ligand-free 2e-04
3aba_A403 Crystal Structure Of Cyp105p1 In Complex With Filip 2e-04
2y46_A417 Structure Of The Mixed-Function P450 Mycg In Comple 2e-04
2xkr_A398 Crystal Structure Of Mycobacterium Tuberculosis Cyp 4e-04
3b98_A475 Crystal Structure Of Zebrafish Prostacyclin Synthas 5e-04
3b6h_A498 Crystal Structure Of Human Prostacyclin Synthase In 5e-04
2iag_A482 Crystal Structure Of Human Prostacyclin Synthase Le 6e-04
2nz5_A413 Structure And Function Studies Of Cytochrome P450 1 7e-04
2dkk_A411 Structure/function Studies Of Cytochrome P450 158a1 8e-04
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure 
Iteration: 1

 Score = 98.6 bits (244), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 79/133 (59%), Gaps = 4/133 (3%)
Query: 4   EIQAILGNDPDKVP-TYEQLQKLDLLNRVIKETMRLYPAVPIVARSSPEELHLCGYTIPA 62
           EI A+L   P+K P TY+ + +++ L+ V+ ET+RL+P    + R   +++ + G  IP 
Sbjct: 313 EIDAVL---PNKAPPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPK 369
Query: 63  GVTIAVFIYGLHRHPQHWPNPEQFNPDRFLPSESSKRHPNAFMPFSLGARNCLGYKYAML 122
           GV + +  Y LHR P++W  PE+F P+RF         P  + PF  G RNC+G ++A++
Sbjct: 370 GVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALM 429
Query: 123 QMKVTVSTILRRY 135
            MK+ +  +L+ +
Sbjct: 430 NMKLALIRVLQNF 442
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|4DVQ|A Chain A, Structure Of Human Aldosterone Synthase, Cyp11b2, In Complex With Deoxycorticosterone Length = 483 Back     alignment and structure
>pdb|3EQM|A Chain A, Crystal Structure Of Human Placental Aromatase Cytochrome P450 In Complex With Androstenedione Length = 503 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1EA1|A Chain A, Cytochrome P450 14 Alpha-Sterol Demethylase (Cyp51) From Mycobacterium Tuberculosis In Complex With Fluconazole Length = 455 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|3IBD|A Chain A, Crystal Structure Of A Cytochrome P450 2b6 Genetic Variant In Complex With The Inhibitor 4-(4-Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1X8V|A Chain A, Estriol-Bound And Ligand-Free Structures Of Sterol 14alpha- Demethylase (Cyp51) Length = 455 Back     alignment and structure
>pdb|2W0A|A Chain A, Cyp51 Of M. Tuberculosis Bound To An Inhibitor N-[(1s)-2-Methyl-1-(Pyridin-4-Ylcarbamoyl)propyl] Cyclohexanecarboxamide Length = 455 Back     alignment and structure
>pdb|1U13|A Chain A, Crystal Structure Analysis Of The C37lC151TC442A-Triple Mutant Of Cyp51 From Mycobacterium Tuberculosis Length = 455 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|4H1N|A Chain A, Crystal Structure Of P450 2b4 F297a Mutant In Complex With Anti- Platelet Drug Clopidogrel Length = 479 Back     alignment and structure
>pdb|2Q6N|A Chain A, Structure Of Cytochrome P450 2b4 With Bound 1-(4- Cholorophenyl)imidazole Length = 478 Back     alignment and structure
>pdb|1SUO|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 With Bound 4-(4- Chlorophenyl)imidazole Length = 476 Back     alignment and structure
>pdb|1PO5|A Chain A, Structure Of Mammalian Cytochrome P450 2b4 Length = 476 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|3TK3|A Chain A, Cytochrome P450 2b4 Mutant L437a In Complex With 4-(4-Chlorophenyl) Imidazole Length = 476 Back     alignment and structure
>pdb|3PM0|A Chain A, Structural Characterization Of The Complex Between Alpha- Naphthoflavone And Human Cytochrome P450 1b1 (Cyp1b1) Length = 507 Back     alignment and structure
>pdb|3KHM|A Chain A, Crystal Structure Of Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Cruzi In Complex With Inhibitor Fluconazole Length = 464 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|2WUZ|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In Complex With Fluconazole In Alternative Conformation Length = 473 Back     alignment and structure
>pdb|3K1O|A Chain A, Crystal Structure Of Sterol 14-alpha Demethylase (cyp51) From Trypanosoma Cruzi In Complex With A Potential Antichagasic Drug, Posaconazole Length = 458 Back     alignment and structure
>pdb|3QM4|A Chain A, Human Cytochrome P450 (Cyp) 2d6 - Prinomastat Complex Length = 479 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure
>pdb|1N97|A Chain A, Crystal Stucture Of Cyp175a1 From Thermus Thermophillus Strain Hb27 Length = 389 Back     alignment and structure
>pdb|3L4D|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Leishmania Infantum In Complex With Fluconazole Length = 453 Back     alignment and structure
>pdb|3R9C|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Cyp164a2 With Econazole Bound Length = 418 Back     alignment and structure
>pdb|3EJB|B Chain B, Crystal Structure Of P450bioi In Complex With Tetradecanoic Acid Ligated Acyl Carrier Protein Length = 404 Back     alignment and structure
>pdb|1WIY|A Chain A, Crystal Structure Analysis Of A 6-Coordinated Cytochorome P450 From Thermus Thermophilus Hb8 Length = 389 Back     alignment and structure
>pdb|3TIK|A Chain A, Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Complex With The Tipifarnib Derivative 6-((4-Chlorophenyl)(Methoxy)(1-Methyl- 1h-Imidazol-5-Yl)methyl)-4-(2, 6-Difluorophenyl)-1-Methylquinolin- 2(1h)-One Length = 454 Back     alignment and structure
>pdb|3GW9|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei Bound To An Inhibitor N-(1-(2,4- Dichlorophenyl)-2-(1h-Imidazol-1-Yl)ethyl)-4-(5-Phenyl- 1,3, 4-Oxaziazol-2-Yl)benzamide Length = 450 Back     alignment and structure
>pdb|3G1Q|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Ligand Free State Length = 450 Back     alignment and structure
>pdb|3P99|A Chain A, Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Brucei In Complex With Delta7-14alpha-Methylene-Cyclopropyl-Dihydrolanosterol Length = 453 Back     alignment and structure
>pdb|2WV2|A Chain A, X-Ray Structure Of Cyp51 From The Human Pathogen Trypanosoma Brucei In Complex With Fluconazole Length = 475 Back     alignment and structure
>pdb|2X2N|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Brucei In Complex With Posaconazole In Two Different Conformations Length = 475 Back     alignment and structure
>pdb|3TYW|A Chain A, Crystal Structure Of Cyp105n1 From Streptomyces Coelicolor A3(2) Length = 417 Back     alignment and structure
>pdb|3TKT|A Chain A, Crystal Structure Of Cyp108d1 From Novosphingobium Aromaticivorans Dsm12444 Length = 450 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|2JJN|A Chain A, Structure Of Closed Cytochrome P450 Eryk Length = 411 Back     alignment and structure
>pdb|2VRV|A Chain A, Structure Of Histidine Tagged Cytochrome P450 Eryk In Complex With Inhibitor Clotrimazole (Clt) Length = 431 Back     alignment and structure
>pdb|1F4T|A Chain A, Thermophilic P450: Cyp119 From Sulfolobus Solfactaricus With 4- Phenylimidazole Bound Length = 368 Back     alignment and structure
>pdb|1IO8|A Chain A, Thermophilic Cytochrome P450 (Cyp119) From Sulfolobus Solfataricus: High Resolution Structural Origin Of Its Thermostability And Functional Properties Length = 368 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure
>pdb|2BVJ|A Chain A, Ligand-Free Structure Of Cytochrome P450 Pikc (Cyp107l1) Length = 436 Back     alignment and structure
>pdb|2WHW|A Chain A, Selective Oxidation Of Carbolide C-H Bonds By Engineered Macrolide P450 Monooxygenase Length = 436 Back     alignment and structure
>pdb|2VZ7|A Chain A, Crystal Structure Of The Yc-17-Bound Pikc D50n Mutant Length = 436 Back     alignment and structure
>pdb|1UE8|A Chain A, Crystal Structure Of Thermophilic Cytochrome P450 From Sulfolobus Tokodaii Length = 367 Back     alignment and structure
>pdb|3VOO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant A245e Length = 407 Back     alignment and structure
>pdb|3VNO|A Chain A, Cytochrome P450sp Alpha (cyp152b1) Mutant R241e Length = 407 Back     alignment and structure
>pdb|3VM4|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) In Complex With (R)-Ibuprophen Length = 407 Back     alignment and structure
>pdb|3AWQ|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant L78f Length = 415 Back     alignment and structure
>pdb|3AWM|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Wild-Type With Palmitic Acid Length = 415 Back     alignment and structure
>pdb|4DNZ|A Chain A, The Crystal Structures Of Cyp199a4 Length = 410 Back     alignment and structure
>pdb|3AWP|A Chain A, Cytochrome P450sp Alpha (Cyp152b1) Mutant F288g Length = 415 Back     alignment and structure
>pdb|2FR7|A Chain A, Crystal Structure Of Cytochrome P450 Cyp199a2 Length = 412 Back     alignment and structure
>pdb|3DAX|A Chain A, Crystal Structure Of Human Cyp7a1 Length = 491 Back     alignment and structure
>pdb|3SN5|A Chain A, Crystal Structure Of Human Cyp7a1 In Complex With Cholest-4-En-3-One Length = 491 Back     alignment and structure
>pdb|2RCH|A Chain A, Crystal Structure Of Arabidopsis Thaliana Allene Oxide Synthase (Aos, Cytochrome P450 74a, Cyp74a) Complexed With 13(S)-Hod At 1.85 A Resolution Length = 495 Back     alignment and structure
>pdb|2RCM|A Chain A, Crystal Structure Of Arabidopsis Thaliana Allene Oxide Synthase Variant (F137l) (At-Aos(F137l), Cytochrome P450 74a) At 1.73 A Resolution Length = 495 Back     alignment and structure
>pdb|2UUQ|A Chain A, Crystal Structure Of Cyp130 From Mycobacterium Tuberculosis In The Ligand-Free Form Length = 414 Back     alignment and structure
>pdb|2WH8|A Chain A, Interaction Of Mycobacterium Tuberculosis Cyp130 With Heterocyclic Arylamines Length = 413 Back     alignment and structure
>pdb|2WGY|A Chain A, Crystal Structure Of The G243a Mutant Of Cyp130 From M. Tuberculosis Length = 413 Back     alignment and structure
>pdb|3MGX|A Chain A, Crystal Structure Of P450 Oxyd That Is Involved In The Biosynthesis Of Vancomycin-Type Antibiotics Length = 415 Back     alignment and structure
>pdb|1CPT|A Chain A, Crystal Structure And Refinement Of Cytochrome P450-Terp At 2.3 Angstroms Resolution Length = 428 Back     alignment and structure
>pdb|2YOO|A Chain A, Cholest-4-en-3-one Bound Structure Of Cyp142 From Mycobacterium Smegmatis Length = 407 Back     alignment and structure
>pdb|2Z3T|A Chain A, Crystal Structure Of Substrate Free Cytochrome P450 Stap (cyp245a1) Length = 425 Back     alignment and structure
>pdb|4AW3|A Chain A, Structure Of The Mixed-Function P450 Mycg F286v Mutant In Complex With Mycinamicin V In P1 Space Group Length = 417 Back     alignment and structure
>pdb|1JIP|A Chain A, P450eryf(A245s)KETOCONAZOLE Length = 403 Back     alignment and structure
>pdb|1JIO|A Chain A, P450eryf/6deb Length = 403 Back     alignment and structure
>pdb|1Z8Q|A Chain A, Ferrous Dioxygen Complex Of The A245t Cytochrome P450eryf Length = 404 Back     alignment and structure
>pdb|1Z8P|A Chain A, Ferrous Dioxygen Complex Of The A245s Cytochrome P450eryf Length = 404 Back     alignment and structure
>pdb|1Z8O|A Chain A, Ferrous Dioxygen Complex Of The Wild-Type Cytochrome P450eryf Length = 404 Back     alignment and structure
>pdb|1T93|A Chain A, Evidence For Multiple Substrate Recognition And Molecular Mechanism Of C-C Reaction By Cytochrome P450 Cyp158a2 From Streptomyces Coelicolor A3(2) Length = 406 Back     alignment and structure
>pdb|3TZO|A Chain A, The Role Of I87 Of Cyp158a2 In Oxidative Coupling Reaction Length = 410 Back     alignment and structure
>pdb|1S1F|A Chain A, Crystal Structure Of Streptomyces Coelicolor A3(2) Cyp158a2 From Antibiotic Biosynthetic Pathways Length = 406 Back     alignment and structure
>pdb|3ZSN|A Chain A, Structure Of The Mixed-Function P450 Mycg F286a Mutant In Complex With Mycinamicin Iv Length = 417 Back     alignment and structure
>pdb|3TNK|A Chain A, Crystal Structure Of Mutant I87r In Cyp158a2 Length = 407 Back     alignment and structure
>pdb|2D0E|A Chain A, Substrate Assited In Oxygen Activation In Cytochrome P450 158a2 Length = 407 Back     alignment and structure
>pdb|3P3O|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Ntermii) From Streptomyces Thioluteus Length = 416 Back     alignment and structure
>pdb|2D09|A Chain A, A Role For Active Site Water Molecules And Hydroxyl Groups Of Substrate For Oxygen Activation In Cytochrome P450 158a2 Length = 407 Back     alignment and structure
>pdb|1SE6|A Chain A, Crystal Structure Of Streptomyces Coelicolor A3(2) Cyp158a2 From Antibiotic Biosynthetic Pathways Length = 406 Back     alignment and structure
>pdb|3P3L|A Chain A, Crystal Structure Of The Cytochrome P450 Monooxygenase Aurh (Wildtype) From Streptomyces Thioluteus Length = 406 Back     alignment and structure
>pdb|1EGY|A Chain A, Cytochrome P450eryf With 9-Aminophenanthrene Bound Length = 403 Back     alignment and structure
>pdb|3E5L|A Chain A, Crystal Structure Of Cyp105p1 H72a Mutant Length = 403 Back     alignment and structure
>pdb|3E5J|A Chain A, Crystal Structure Of Cyp105p1 Wild-type Ligand-free Form Length = 403 Back     alignment and structure
>pdb|3ABA|A Chain A, Crystal Structure Of Cyp105p1 In Complex With Filipin I Length = 403 Back     alignment and structure
>pdb|2Y46|A Chain A, Structure Of The Mixed-Function P450 Mycg In Complex With Mycinamicin Iv In C 2 2 21 Space Group Length = 417 Back     alignment and structure
>pdb|2XKR|A Chain A, Crystal Structure Of Mycobacterium Tuberculosis Cyp142: A Novel Cholesterol Oxidase Length = 398 Back     alignment and structure
>pdb|3B98|A Chain A, Crystal Structure Of Zebrafish Prostacyclin Synthase (Cytochrome P450 8a1) Length = 475 Back     alignment and structure
>pdb|3B6H|A Chain A, Crystal Structure Of Human Prostacyclin Synthase In Complex With Inhibitor Minoxidil Length = 498 Back     alignment and structure
>pdb|2IAG|A Chain A, Crystal Structure Of Human Prostacyclin Synthase Length = 482 Back     alignment and structure
>pdb|2NZ5|A Chain A, Structure And Function Studies Of Cytochrome P450 158a1 From Streptomyces Coelicolor A3(2) Length = 413 Back     alignment and structure
>pdb|2DKK|A Chain A, Structure/function Studies Of Cytochrome P450 158a1 From Streptomyces Coelicolor A3(2) Length = 411 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query170
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 2e-70
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 1e-65
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 8e-64
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 7e-62
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 1e-59
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 4e-58
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 6e-58
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 8e-58
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 1e-55
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 4e-55
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 1e-54
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 5e-52
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 2e-51
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 5e-48
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 6e-48
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 5e-45
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 3e-43
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 2e-42
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 3e-37
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 2e-30
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 3e-30
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 4e-30
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 5e-30
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 3e-29
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 1e-28
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 2e-28
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 2e-28
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 3e-28
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 3e-28
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 5e-17
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 2e-15
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 2e-15
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 5e-15
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 1e-14
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 2e-14
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 3e-14
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 4e-14
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 1e-13
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 2e-13
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 2e-13
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 3e-13
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 3e-13
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 3e-13
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 6e-13
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 7e-13
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 1e-12
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 1e-12
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 2e-12
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 2e-12
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 5e-12
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 5e-12
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 8e-12
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 8e-12
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 9e-12
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 1e-11
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 1e-11
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 1e-11
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 1e-11
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 1e-11
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 1e-11
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 1e-11
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 2e-11
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 2e-11
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 2e-11
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 2e-11
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 2e-11
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 2e-11
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 1e-10
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 2e-10
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 2e-10
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 3e-10
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 7e-10
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 1e-09
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 1e-09
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 1e-08
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
 Score =  219 bits (559), Expect = 2e-70
 Identities = 49/170 (28%), Positives = 84/170 (49%), Gaps = 8/170 (4%)

Query: 1   VYNEIQAILGNDPDKVPTYEQLQKLDLLNRVIKETMRLYPAVPIVARSSPEELHLCGYTI 60
           +  E+  ++G+       +E L +L  L++V+KE++RLYP      R   EE  + G  +
Sbjct: 280 LQAEVDEVIGSKRY--LDFEDLGRLQYLSQVLKESLRLYPPAWGTFRLLEEETLIDGVRV 337

Query: 61  PAGVTIAVFIYGLHRHPQHWPNPEQFNPDRFLPSESSKRHPNAFMPFSLGARNCLGYKYA 120
           P    +    Y + R   ++ +P  FNPDRF P     +    + PFSLG R+C+G ++A
Sbjct: 338 PGNTPLLFSTYVMGRMDTYFEDPLTFNPDRFGPGA--PKPRFTYFPFSLGHRSCIGQQFA 395

Query: 121 MLQMKVTVSTILRRYKVLVGDRCKTMEDIRFQFGLTLKTLPGNDIKLEPR 170
            +++KV ++ +L+R +  +       +    Q   TLK L      L PR
Sbjct: 396 QMEVKVVMAKLLQRLEFRLVPG----QRFGLQEQATLKPLDPVLCTLRPR 441
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query170
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 100.0
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 100.0
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 100.0
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 100.0
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 100.0
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 100.0
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 100.0
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 100.0
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 100.0
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 100.0
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 100.0
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 100.0
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 100.0
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 100.0
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 100.0
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 100.0
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 100.0
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 100.0
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 100.0
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 99.98
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.98
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 99.98
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.98
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.98
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.98
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 99.98
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.98
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 99.98
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.98
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.98
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.97
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.97
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 99.97
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.97
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.97
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.97
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.97
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.97
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.97
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.97
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 99.97
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 99.97
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.97
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 99.97
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 99.97
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.97
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.97
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.97
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.96
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.96
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.94
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=100.00  E-value=1.3e-44  Score=296.19  Aligned_cols=166  Identities=23%  Similarity=0.461  Sum_probs=146.4

Q ss_pred             CHHHHHHHhCCCCCCCCCHHHhcCCHHHHHHHHHHccCCCCCccc-eeccCCceeecCEEeCCCCEEEEechhhccCCCC
Q psy1886           1 VYNEIQAILGNDPDKVPTYEQLQKLDLLNRVIKETMRLYPAVPIV-ARSSPEELHLCGYTIPAGVTIAVFIYGLHRHPQH   79 (170)
Q Consensus         1 l~~Ei~~~~~~~~~~~~~~~~~~~lp~l~~~i~E~lRl~~~~~~~-~r~~~~~~~~~g~~ip~g~~v~~~~~~~~~d~~~   79 (170)
                      |++||+++++.+  ..++++++++||||+|||+|+||++|+++.. .|.+.+|++++||.||+|+.|+++.+++|+||++
T Consensus       309 l~~Ei~~~~~~~--~~~~~~~l~~lpyl~avi~EtlRl~p~~~~~~~~~~~~d~~~~g~~IP~Gt~V~~~~~~~h~d~~~  386 (479)
T 3tbg_A          309 VQQEIDDVIGQV--RRPEMGDQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAV  386 (479)
T ss_dssp             HHHHHHHHTCSS--SCCCHHHHTTCHHHHHHHHHHHHHHCSSTTCCCEECSSCEEETTEEECTTCEEEEEHHHHHTCTTT
T ss_pred             HHHHHHHHHhhc--cccchhhhccccccccceeeeccccccccccceeecCCCceECCEEecCCCeeeechhhhcCChhh
Confidence            579999999875  7789999999999999999999999999876 5567889999999999999999999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCCccccCCCCCCCcccHHHHHHHHHHHHHHHhhccEEeecCcCCcccceeeecceeeec
Q psy1886          80 WPNPEQFNPDRFLPSESSKRHPNAFMPFSLGARNCLGYKYAMLQMKVTVSTILRRYKVLVGDRCKTMEDIRFQFGLTLKT  159 (170)
Q Consensus        80 ~~~p~~f~p~R~l~~~~~~~~~~~~~~Fg~G~r~C~G~~la~~e~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~p  159 (170)
                      |+||++|+||||+++++....+..|+|||+|+|.|+|++||++|+++++|.||++|+|++++.... .......+++..|
T Consensus       387 ~~dP~~F~PeRfl~~~~~~~~~~~~~pFG~G~R~C~G~~lA~~e~~~~la~ll~~f~~~~~~~~~~-~~~~~~~~~~~~P  465 (479)
T 3tbg_A          387 WEKPFRFHPEHFLDAQGHFVKPEAFLPFSAGRRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPR-PSHHGVFAFLVSP  465 (479)
T ss_dssp             SSSTTSCCGGGGBCTTCCBCCCTTCCTTCCSTTSCTTHHHHHHHHHHHHHHHHHHEEEECCTTSCC-CCSCEEESSSEEE
T ss_pred             CCCccccCccccCCCCcccCCCCceecCCCCCcCChhHHHHHHHHHHHHHHHHHccEEEeCCCCCC-ccccccceeeecC
Confidence            999999999999988877777889999999999999999999999999999999999976443221 2233345667778


Q ss_pred             CCCceeEEeeC
Q psy1886         160 LPGNDIKLEPR  170 (170)
Q Consensus       160 ~~~~~v~~~~R  170 (170)
                      + +++|++++|
T Consensus       466 ~-~~~v~~~pR  475 (479)
T 3tbg_A          466 S-PYELCAVPR  475 (479)
T ss_dssp             C-CCCBEEEEC
T ss_pred             C-CeEEEEEEC
Confidence            6 899999998
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 170
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 1e-40
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 7e-39
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 1e-34
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 5e-28
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 3e-26
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 1e-23
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 7e-22
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 5e-21
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 7e-21
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 1e-20
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 3e-20
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 2e-19
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 3e-19
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 1e-18
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 2e-18
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 6e-18
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 1e-17
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 2e-17
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 7e-17
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 6e-16
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 7e-16
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  140 bits (353), Expect = 1e-40
 Identities = 51/169 (30%), Positives = 89/169 (52%), Gaps = 4/169 (2%)

Query: 2   YNEIQAILGNDPDKVPTYEQLQKLDLLNRVIKETMRLYPAVPIVARSSPEELHLCGYTIP 61
             EI A+L N     PTY+ + +++ L+ V+ ET+RL+P    + R   +++ + G  IP
Sbjct: 305 QEEIDAVLPNKAP--PTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIP 362

Query: 62  AGVTIAVFIYGLHRHPQHWPNPEQFNPDRFLPSESSKRHPNAFMPFSLGARNCLGYKYAM 121
            GV + +  Y LHR P++W  PE+F P+RF         P  + PF  G RNC+G ++A+
Sbjct: 363 KGVVVMIPSYALHRDPKYWTEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFAL 422

Query: 122 LQMKVTVSTILRRYKVLVGDRCKTMEDIRFQFGLTLKTLPGNDIKLEPR 170
           + MK+ +  +L+ +        +T   ++   G  L+      +K+E R
Sbjct: 423 MNMKLALIRVLQNFSFKPCK--ETQIPLKLSLGGLLQPEKPVVLKVESR 469
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query170
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 100.0
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.97
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.97
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.97
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.97
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.96
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.96
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.96
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.96
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.95
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.95
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.95
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.95
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.95
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.94
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.2e-43  Score=285.35  Aligned_cols=166  Identities=31%  Similarity=0.639  Sum_probs=149.1

Q ss_pred             CHHHHHHHhCCCCCCCCCHHHhcCCHHHHHHHHHHccCCCCCccceeccCCceeecCEEeCCCCEEEEechhhccCCCCC
Q psy1886           1 VYNEIQAILGNDPDKVPTYEQLQKLDLLNRVIKETMRLYPAVPIVARSSPEELHLCGYTIPAGVTIAVFIYGLHRHPQHW   80 (170)
Q Consensus         1 l~~Ei~~~~~~~~~~~~~~~~~~~lp~l~~~i~E~lRl~~~~~~~~r~~~~~~~~~g~~ip~g~~v~~~~~~~~~d~~~~   80 (170)
                      +++||+++++.+  ...+.+.+.++|||+||++|++|++|+++.+.|.+.+|+.++|+.||||+.|+++.+++|+||++|
T Consensus       304 lr~Ei~~~~~~~--~~~~~~~l~~~~~l~a~i~E~lRl~p~~~~~~r~~~~d~~~~g~~ipkGt~v~~~~~~~~~d~~~~  381 (472)
T d1tqna_         304 LQEEIDAVLPNK--APPTYDTVLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYALHRDPKYW  381 (472)
T ss_dssp             HHHHHHHHSTTT--CCCCHHHHHHCHHHHHHHHHHHHHCCTTCCEEEECCSCEEETTEEECTTCEEEECHHHHHTCTTTS
T ss_pred             ccceeheecccc--ccchHHHhhccccccceeeeccccCCcccccccccccCccccCceeCCCCEEEEechhhhcCchhC
Confidence            479999999875  678899999999999999999999999888899999999999999999999999999999999999


Q ss_pred             CCCCCCCCCCCCCCCCCCCCCCccccCCCCCCCcccHHHHHHHHHHHHHHHhhccEEeecCcCCcccceeeecceeeecC
Q psy1886          81 PNPEQFNPDRFLPSESSKRHPNAFMPFSLGARNCLGYKYAMLQMKVTVSTILRRYKVLVGDRCKTMEDIRFQFGLTLKTL  160 (170)
Q Consensus        81 ~~p~~f~p~R~l~~~~~~~~~~~~~~Fg~G~r~C~G~~la~~e~~~~l~~ll~~f~~~~~~~~~~~~~~~~~~~~~~~p~  160 (170)
                      +||++|+||||++++.....++.|+|||+|+|.|+|++||.+|++++++.|+++|||++++.  ...+.....++++.|+
T Consensus       382 ~dp~~F~PeRfl~~~~~~~~~~~~~~FG~G~r~C~G~~~A~~~~~~~la~ll~~f~~~~~~~--~~~~~~~~~~~~~~p~  459 (472)
T d1tqna_         382 TEPEKFLPERFSKKNKDNIDPYIYTPFGSGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKE--TQIPLKLSLGGLLQPE  459 (472)
T ss_dssp             SSTTSCCGGGGSTTTGGGCCTTTSCTTCCSTTSCTTHHHHHHHHHHHHHHHHTTEEEECCTT--CCSSCCBCSSSSCCBS
T ss_pred             CCccccCccccCCCCcccCCCceecCCCCCCccChhHHHHHHHHHHHHHHHHHhCEEEeCCC--CCCCceeccceEEeeC
Confidence            99999999999988777667888999999999999999999999999999999999975432  2333444456677888


Q ss_pred             CCceeEEeeC
Q psy1886         161 PGNDIKLEPR  170 (170)
Q Consensus       161 ~~~~v~~~~R  170 (170)
                      .+++|++++|
T Consensus       460 ~~~~~~~~~R  469 (472)
T d1tqna_         460 KPVVLKVESR  469 (472)
T ss_dssp             SCCEEEEEET
T ss_pred             CCEEEEEEEC
Confidence            8999999998
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure