Psyllid ID: psy1917

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210--
MEPRDPLSSLGKVGQLLNSKKQGVSGESSTNGQTANDIQIQRYDKDFRSKQLIKAAIMDNDFLKNLDTLQVKEMVESMHQAEYKADSYVITEGEAGNDLFVSAEGEFQVIKDGKILAVMGPGKAFGELAILYNCTRTASIRGFLTVLHFNFSVSAEGEFQVIKDGKILAVMGPGKAFGELAILYNCTRTASIRALTPCKVWMLDRRVFQKSA
cccccccccccccccccccccccEEEEEccccccccccEEEEEcccHHHHHHHHHHHHcccccccccHHHHHHHHHccEEEEEccccEEEEccccccEEEEEEccEEEEEEccEEEEEccccccHHHHHHHHcccccEEEEEEccEEEEEEEEccccEEEEEEccEEEEEcccccEEEEEEHHHcccccEEEEEcccEEEEEEEcccccccc
cccccccccccHHHHHcccccEEEEEccccccHcccccccccccccHHHHHHHHHHHHcccHHHcccHHHHHHHHHHHcccEcccccEEEEEcccccEEEEEEccEEEEEEccEEEEEEccccccEEHHHHcccccEEEEEEEcccEEEEEEEEccccEEEEccccEEEEcccccccHHHHHHcccccEEEEEEccccEEEEEccccEEccc
meprdplsslgkvgqllnskkqgvsgesstngqtandiqIQRYDKDFRSKQLIKAAIMDNDFLKNLDTLQVKEMVESMHQAeykadsyvitegeagndlfvsaegefqvikdgkilavmgpgkafGELAILYNCTRTASIRGFLTVLHFNFsvsaegefqvikdgkilavmgpgkafGELAILYNCTrtasiraltpckvwmldrrvfqksa
meprdplsslgkvgqllnskkqgvsgesstngqtandiqiqrYDKDFRSKQLIKAAIMDNDFLKNLDTLQVKEMVESMHQAEYKADSYVITEGEAGNDLFVSAEGEFQVIKDGKILAVMGPGKAFGELAILYNCTRTASIRGFLTVLHFNFSVSAEGEFQVIKDGKILAVMGPGKAFGELAILYNCTRTasiraltpckvwmldrrvfqksa
MEPRDPLSSLGKVGQLLNSKKQGVSGESSTNGQTANDIQIQRYDKDFRSKQLIKAAIMDNDFLKNLDTLQVKEMVESMHQAEYKADSYVITEGEAGNDLFVSAEGEFQVIKDGKILAVMGPGKAFGELAILYNCTRTASIRGFLTVLHFNFSVSAEGEFQVIKDGKILAVMGPGKAFGELAILYNCTRTASIRALTPCKVWMLDRRVFQKSA
***************************************IQRYDKDFRSKQLIKAAIMDNDFLKNLDTLQVKEMVESMHQAEYKADSYVITEGEAGNDLFVSAEGEFQVIKDGKILAVMGPGKAFGELAILYNCTRTASIRGFLTVLHFNFSVSAEGEFQVIKDGKILAVMGPGKAFGELAILYNCTRTASIRALTPCKVWMLDRRVF****
******L****KV**LLNSKKQGVSGESSTNGQTANDIQIQRYDKDFRSKQLIKAAIMDNDFLKNLDTLQVKEMVESMHQAEYKADSYVITEGEAGNDLFVSAEGEFQVIKDGKILAVMGPGKAFGELAILYNCTRTASIRGFLTVLHFNFSVSAEGEFQVIKDGKILAVMGPGKAFGELAILYNCTRTASIRALTPCKVWMLDRRVFQKSA
**********GKVGQLLN**************QTANDIQIQRYDKDFRSKQLIKAAIMDNDFLKNLDTLQVKEMVESMHQAEYKADSYVITEGEAGNDLFVSAEGEFQVIKDGKILAVMGPGKAFGELAILYNCTRTASIRGFLTVLHFNFSVSAEGEFQVIKDGKILAVMGPGKAFGELAILYNCTRTASIRALTPCKVWMLDRRVFQKSA
*******SSLGKVGQLLNSKKQGVSGESSTNGQTANDIQIQRYDKDFRSKQLIKAAIMDNDFLKNLDTLQVKEMVESMHQAEYKADSYVITEGEAGNDLFVSAEGEFQVIKDGKILAVMGPGKAFGELAILYNCTRTASIRGFLTVLHFNFSVSAEGEFQVIKDGKILAVMGPGKAFGELAILYNCTRTASIRALTPCKVWMLDRRVFQK**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEPRDPLSSLGKVGQLLNSKKQGVSGESSTNGQTANDIQIQRYDKDFRSKQLIKAAIMDNDFLKNLDTLQVKEMVESMHQAEYKADSYVITEGEAGNDLFVSAEGEFQVIKDGKILAVMGPGKAFGELAILYNCTRTASIRGFLTVLHFNFSVSAEGEFQVIKDGKILAVMGPGKAFGELAILYNCTRTASIRALTPCKVWMLDRRVFQKSA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query212 2.2.26 [Sep-21-2011]
Q03042 768 cGMP-dependent protein ki yes N/A 0.575 0.158 0.617 3e-35
P0C605 671 cGMP-dependent protein ki yes N/A 0.603 0.190 0.458 7e-28
Q13976 671 cGMP-dependent protein ki yes N/A 0.603 0.190 0.458 7e-28
P00516 671 cGMP-dependent protein ki yes N/A 0.603 0.190 0.458 8e-28
O77676 671 cGMP-dependent protein ki yes N/A 0.603 0.190 0.458 4e-27
Q03043 1088 cGMP-dependent protein ki no N/A 0.556 0.108 0.453 3e-25
O76360 780 cGMP-dependent protein ki yes N/A 0.594 0.161 0.460 7e-23
Q13237 762 cGMP-dependent protein ki no N/A 0.594 0.165 0.442 1e-22
A8X6H1 749 cGMP-dependent protein ki N/A N/A 0.594 0.168 0.460 1e-22
Q64595 762 cGMP-dependent protein ki no N/A 0.594 0.165 0.427 4e-22
>sp|Q03042|KGP1_DROME cGMP-dependent protein kinase, isozyme 1 OS=Drosophila melanogaster GN=Pkg21D PE=1 SV=2 Back     alignment and function desciption
 Score =  148 bits (373), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 76/123 (61%), Positives = 89/123 (72%), Gaps = 1/123 (0%)

Query: 20  KKQGVSGESSTNG-QTANDIQIQRYDKDFRSKQLIKAAIMDNDFLKNLDTLQVKEMVESM 78
           KKQGVS ES     Q +  I I +Y+KDF  KQ IK AIMDNDFLKN+D  QV+E+V+SM
Sbjct: 142 KKQGVSAESCVQSMQQSYSIPIPKYEKDFSDKQQIKDAIMDNDFLKNIDASQVRELVDSM 201

Query: 79  HQAEYKADSYVITEGEAGNDLFVSAEGEFQVIKDGKILAVMGPGKAFGELAILYNCTRTA 138
           +     A  +VI EGE G  L+VSA GEF V++ GK+L  MG GKAFGELAILYNCTRTA
Sbjct: 202 YSKSIAAGEFVIREGEVGAHLYVSAAGEFAVMQQGKVLDKMGAGKAFGELAILYNCTRTA 261

Query: 139 SIR 141
           SIR
Sbjct: 262 SIR 264

Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1EC: 2
>sp|P0C605|KGP1_MOUSE cGMP-dependent protein kinase 1 OS=Mus musculus GN=Prkg1 PE=1 SV=1 Back     alignment and function description
>sp|Q13976|KGP1_HUMAN cGMP-dependent protein kinase 1 OS=Homo sapiens GN=PRKG1 PE=1 SV=3 Back     alignment and function description
>sp|P00516|KGP1_BOVIN cGMP-dependent protein kinase 1 OS=Bos taurus GN=PRKG1 PE=1 SV=2 Back     alignment and function description
>sp|O77676|KGP1_RABIT cGMP-dependent protein kinase 1 OS=Oryctolagus cuniculus GN=PRKG1 PE=1 SV=3 Back     alignment and function description
>sp|Q03043|KGP24_DROME cGMP-dependent protein kinase, isozyme 2 forms cD4/T1/T3A/T3B OS=Drosophila melanogaster GN=for PE=1 SV=3 Back     alignment and function description
>sp|O76360|EGL4_CAEEL cGMP-dependent protein kinase egl-4 OS=Caenorhabditis elegans GN=egl-4 PE=1 SV=2 Back     alignment and function description
>sp|Q13237|KGP2_HUMAN cGMP-dependent protein kinase 2 OS=Homo sapiens GN=PRKG2 PE=1 SV=1 Back     alignment and function description
>sp|A8X6H1|EGL4_CAEBR cGMP-dependent protein kinase egl-4 OS=Caenorhabditis briggsae GN=egl-4 PE=3 SV=2 Back     alignment and function description
>sp|Q64595|KGP2_RAT cGMP-dependent protein kinase 2 OS=Rattus norvegicus GN=Prkg2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query212
242024535 1045 cGMP-dependent protein kinase, isozyme, 0.646 0.131 0.608 3e-42
91094575 948 PREDICTED: similar to cgmp-dependent pro 0.542 0.121 0.704 2e-41
158293332 1289 AGAP008585-PA [Anopheles gambiae str. PE 0.575 0.094 0.666 8e-41
157111148 1288 cgmp-dependent protein kinase [Aedes aeg 0.584 0.096 0.615 8e-41
312385007 1271 hypothetical protein AND_01288 [Anophele 0.575 0.095 0.650 1e-40
170061338 790 cGMP-dependent protein kinase [Culex qui 0.594 0.159 0.626 1e-39
195437534 779 GK24624 [Drosophila willistoni] gi|19416 0.641 0.174 0.576 3e-35
195388398 769 GJ19652 [Drosophila virilis] gi|19414932 0.575 0.158 0.634 4e-35
195118190292 GI18015 [Drosophila mojavensis] gi|19391 0.575 0.417 0.617 1e-34
125986381 770 GA17377 [Drosophila pseudoobscura pseudo 0.575 0.158 0.626 1e-34
>gi|242024535|ref|XP_002432683.1| cGMP-dependent protein kinase, isozyme, putative [Pediculus humanus corporis] gi|212518153|gb|EEB19945.1| cGMP-dependent protein kinase, isozyme, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  177 bits (448), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 90/148 (60%), Positives = 115/148 (77%), Gaps = 11/148 (7%)

Query: 5   DPLSSL-------GKVGQLLN----SKKQGVSGESSTNGQTANDIQIQRYDKDFRSKQLI 53
           D LSSL       G+  Q++N    +KKQGVSGESS +GQ  + I+IQR++KDFRSKQLI
Sbjct: 403 DLLSSLQESHGMPGQFQQVINIPNPNKKQGVSGESSDHGQNHHQIEIQRFEKDFRSKQLI 462

Query: 54  KAAIMDNDFLKNLDTLQVKEMVESMHQAEYKADSYVITEGEAGNDLFVSAEGEFQVIKDG 113
           K AI++N+FLKNLDT+QV+E+VES++  ++    YV+ EGEAG+ L+VSAEGE +VIKD 
Sbjct: 463 KDAILENNFLKNLDTVQVREIVESVYPKKFSKGDYVVREGEAGSHLYVSAEGELEVIKDQ 522

Query: 114 KILAVMGPGKAFGELAILYNCTRTASIR 141
            +L  MGPGKAFGELAILYNC RTASI+
Sbjct: 523 NVLGRMGPGKAFGELAILYNCRRTASIK 550

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|91094575|ref|XP_968718.1| PREDICTED: similar to cgmp-dependent protein kinase [Tribolium castaneum] gi|270016394|gb|EFA12840.1| hypothetical protein TcasGA2_TC006940 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|158293332|ref|XP_314690.4| AGAP008585-PA [Anopheles gambiae str. PEST] gi|157016654|gb|EAA10189.4| AGAP008585-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157111148|ref|XP_001651409.1| cgmp-dependent protein kinase [Aedes aegypti] gi|108878512|gb|EAT42737.1| AAEL005754-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|312385007|gb|EFR29602.1| hypothetical protein AND_01288 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|170061338|ref|XP_001866192.1| cGMP-dependent protein kinase [Culex quinquefasciatus] gi|167879593|gb|EDS42976.1| cGMP-dependent protein kinase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195437534|ref|XP_002066695.1| GK24624 [Drosophila willistoni] gi|194162780|gb|EDW77681.1| GK24624 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195388398|ref|XP_002052867.1| GJ19652 [Drosophila virilis] gi|194149324|gb|EDW65022.1| GJ19652 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195118190|ref|XP_002003623.1| GI18015 [Drosophila mojavensis] gi|193914198|gb|EDW13065.1| GI18015 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|125986381|ref|XP_001356954.1| GA17377 [Drosophila pseudoobscura pseudoobscura] gi|54645280|gb|EAL34020.1| GA17377 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query212
FB|FBgn0000442 768 Pkg21D "cGMP-dependent protein 0.575 0.158 0.617 8.5e-37
UNIPROTKB|F1NE85 685 F1NE85 "cGMP-dependent protein 0.603 0.186 0.457 3.4e-30
UNIPROTKB|Q5SQU3 659 PRKG1 "cGMP-dependent protein 0.599 0.192 0.461 3.5e-30
UNIPROTKB|Q13976 671 PRKG1 "cGMP-dependent protein 0.599 0.189 0.461 3.8e-30
UNIPROTKB|P00516 671 PRKG1 "cGMP-dependent protein 0.599 0.189 0.461 4.9e-30
MGI|MGI:108174 671 Prkg1 "protein kinase, cGMP-de 0.599 0.189 0.461 4.9e-30
ZFIN|ZDB-GENE-040426-1308 667 prkg1a "protein kinase, cGMP-d 0.570 0.181 0.483 9.7e-30
UNIPROTKB|F1MY76 686 PRKG1 "cGMP-dependent protein 0.603 0.186 0.457 1.9e-29
UNIPROTKB|O77676 671 PRKG1 "cGMP-dependent protein 0.599 0.189 0.461 2.2e-29
FB|FBgn0000721 1088 for "foraging" [Drosophila mel 0.608 0.118 0.435 5.7e-27
FB|FBgn0000442 Pkg21D "cGMP-dependent protein kinase 21D" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 367 (134.2 bits), Expect = 8.5e-37, Sum P(2) = 8.5e-37
 Identities = 76/123 (61%), Positives = 89/123 (72%)

Query:    20 KKQGVSGESSTNG-QTANDIQIQRYDKDFRSKQLIKAAIMDNDFLKNLDTLQVKEMVESM 78
             KKQGVS ES     Q +  I I +Y+KDF  KQ IK AIMDNDFLKN+D  QV+E+V+SM
Sbjct:   142 KKQGVSAESCVQSMQQSYSIPIPKYEKDFSDKQQIKDAIMDNDFLKNIDASQVRELVDSM 201

Query:    79 HQAEYKADSYVITEGEAGNDLFVSAEGEFQVIKDGKILAVMGPGKAFGELAILYNCTRTA 138
             +     A  +VI EGE G  L+VSA GEF V++ GK+L  MG GKAFGELAILYNCTRTA
Sbjct:   202 YSKSIAAGEFVIREGEVGAHLYVSAAGEFAVMQQGKVLDKMGAGKAFGELAILYNCTRTA 261

Query:   139 SIR 141
             SIR
Sbjct:   262 SIR 264
GO:0004692 "cGMP-dependent protein kinase activity" evidence=ISS;NAS;IDA
GO:0006468 "protein phosphorylation" evidence=NAS;IDA
GO:0004674 "protein serine/threonine kinase activity" evidence=NAS
GO:0030551 "cyclic nucleotide binding" evidence=NAS
GO:0005524 "ATP binding" evidence=IEA
UNIPROTKB|F1NE85 F1NE85 "cGMP-dependent protein kinase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5SQU3 PRKG1 "cGMP-dependent protein kinase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q13976 PRKG1 "cGMP-dependent protein kinase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P00516 PRKG1 "cGMP-dependent protein kinase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:108174 Prkg1 "protein kinase, cGMP-dependent, type I" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1308 prkg1a "protein kinase, cGMP-dependent, type Ia" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MY76 PRKG1 "cGMP-dependent protein kinase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O77676 PRKG1 "cGMP-dependent protein kinase 1" [Oryctolagus cuniculus (taxid:9986)] Back     alignment and assigned GO terms
FB|FBgn0000721 for "foraging" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q03042KGP1_DROME2, ., 7, ., 1, 1, ., 1, 20.61780.57540.1588yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query212
cd00038115 cd00038, CAP_ED, effector domain of the CAP family 2e-19
smart00100120 smart00100, cNMP, Cyclic nucleotide-monophosphate 1e-14
pfam0002791 pfam00027, cNMP_binding, Cyclic nucleotide-binding 5e-12
COG0664 214 COG0664, Crp, cAMP-binding proteins - catabolite g 8e-08
>gnl|CDD|237999 cd00038, CAP_ED, effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information 
 Score = 79.3 bits (196), Expect = 2e-19
 Identities = 32/149 (21%), Positives = 60/149 (40%), Gaps = 47/149 (31%)

Query: 62  FLKNLDTLQVKEMVESMHQAEYKADSYVITEGEAGNDLFVSAEGEFQVIKDGKILAVMGP 121
               LD  +++E+ +++ +  + A   +I +G+  + L++   G  +V K          
Sbjct: 1   LFSGLDDEELEELADALEERRFPAGEVIIRQGDPADSLYIVLSGSVEVYKLD-------- 52

Query: 122 GKAFGELAILYNCTRTASIRGFLTVLHFNFSVSAEGEFQVIKDGKILAVMGPGKAFGELA 181
                                             +G  Q      I+  +GPG  FGELA
Sbjct: 53  ---------------------------------EDGREQ------IVGFLGPGDLFGELA 73

Query: 182 ILYNCTRTASIRALTPCKVWMLDRRVFQK 210
           +L N  R+A++RALT  ++ +L R  F++
Sbjct: 74  LLGNGPRSATVRALTDSELLVLPRSDFRR 102

In all cases binding of the effector leads to conformational changes and the ability to activate transcription. Cyclic nucleotide-binding domain similar to CAP are also present in cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) and vertebrate cyclic nucleotide-gated ion-channels. Cyclic nucleotide-monophosphate binding domain; proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues; the best studied is the prokaryotic catabolite gene activator, CAP, where such a domain is known to be composed of three alpha-helices and a distinctive eight-stranded, antiparallel beta-barrel structure; three conserved glycine residues are thought to be essential for maintenance of the structural integrity of the beta-barrel; CooA is a homodimeric transcription factor that belongs to CAP family; cAMP- and cGMP-dependent protein kinases (cAPK and cGPK) contain two tandem copies of the cyclic nucleotide-binding domain; cAPK's are composed of two different subunits, a catalytic chain and a regulatory chain, which contains both copies of the domain; cGPK's are single chain enzymes that include the two copies of the domain in their N-terminal section; also found in vertebrate cyclic nucleotide-gated ion-channels. Length = 115
>gnl|CDD|197516 smart00100, cNMP, Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>gnl|CDD|215664 pfam00027, cNMP_binding, Cyclic nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|223736 COG0664, Crp, cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 212
KOG1113|consensus368 100.0
KOG0614|consensus 732 99.96
KOG1113|consensus368 99.83
KOG0614|consensus 732 99.78
PRK09392 236 ftrB transcriptional activator FtrB; Provisional 99.69
KOG0498|consensus 727 99.66
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.63
cd00038115 CAP_ED effector domain of the CAP family of transc 99.63
PRK11753 211 DNA-binding transcriptional dual regulator Crp; Pr 99.61
PLN02868 413 acyl-CoA thioesterase family protein 99.6
COG0664 214 Crp cAMP-binding proteins - catabolite gene activa 99.6
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 99.58
smart00100120 cNMP Cyclic nucleotide-monophosphate binding domai 99.58
KOG0500|consensus 536 99.55
PRK10402 226 DNA-binding transcriptional activator YeiL; Provis 99.53
PRK11161 235 fumarate/nitrate reduction transcriptional regulat 99.51
COG2905 610 Predicted signal-transduction protein containing c 99.41
KOG0499|consensus 815 99.41
PRK13918 202 CRP/FNR family transcriptional regulator; Provisio 99.38
PRK09391 230 fixK transcriptional regulator FixK; Provisional 99.3
TIGR03697 193 NtcA_cyano global nitrogen regulator NtcA, cyanoba 99.28
KOG0501|consensus 971 98.88
KOG2968|consensus 1158 98.74
KOG2968|consensus 1158 98.42
KOG3542|consensus 1283 97.9
PRK11832 207 putative DNA-binding transcriptional regulator; Pr 97.59
KOG3542|consensus 1283 97.26
PF04831153 Popeye: Popeye protein conserved region; InterPro: 97.15
COG0664214 Crp cAMP-binding proteins - catabolite gene activa 92.21
PF0002791 cNMP_binding: Cyclic nucleotide-binding domain; In 90.41
PF0788371 Cupin_2: Cupin domain; InterPro: IPR013096 This fa 89.76
PLN03192 823 Voltage-dependent potassium channel; Provisional 85.07
PRK13290125 ectC L-ectoine synthase; Reviewed 82.93
COG1917131 Uncharacterized conserved protein, contains double 80.82
PRK10402226 DNA-binding transcriptional activator YeiL; Provis 80.75
>KOG1113|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.6e-34  Score=238.44  Aligned_cols=191  Identities=29%  Similarity=0.477  Sum_probs=170.6

Q ss_pred             CCCCcEEeeccCCCCCCCcceeecccCCHHHHHHHHHHhhcCccCCCCCHHHHHHHHhhceEEEecCCCeEEccCCCCCe
Q psy1917          19 SKKQGVSGESSTNGQTANDIQIQRYDKDFRSKQLIKAAIMDNDFLKNLDTLQVKEMVESMHQAEYKADSYVITEGEAGND   98 (212)
Q Consensus        19 ~~r~~v~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~lf~~l~~~~~~~l~~~~~~~~~~~g~~I~~~Gd~~~~   98 (212)
                      .||++||+|..++..  +.+....+||++++++.+.+++++.-+|.+|+++++.+++++|..+++++|++|++||+.+++
T Consensus        88 ~RRssV~aE~~tp~~--d~~~~~~~pKd~e~~~~L~~a~r~~~LF~~Ld~eq~~~v~dam~~~~v~~G~~Vi~qGdeGd~  165 (368)
T KOG1113|consen   88 VRRSSVSAEEITPDD--DEFKRKYIPKDDETRRRLEEAFRKNLLFANLDDEQLSQVLDAMFEKRVKAGETVIKQGDEGDN  165 (368)
T ss_pred             cccceeeeeecCccc--hhhhhcCCCCCHHHHHHHHHHHHhccccccCCHHHHHHHHHhhceeeecCCcEEEecCCcCCc
Confidence            789999999998766  455667789999999999999999999999999999999999999999999999999999999


Q ss_pred             eEEEecCEEEEEECCEEEEEeCCCCcchhhhhhhCCCcceEEEEEeeeeee-----------------------------
Q psy1917          99 LFVSAEGEFQVIKDGKILAVMGPGKAFGELAILYNCTRTASIRGFLTVLHF-----------------------------  149 (212)
Q Consensus        99 ~yiI~~G~v~v~~~~~~~~~l~~g~~fGe~~ll~~~~r~a~v~a~~~~~~~-----------------------------  149 (212)
                      ||+|-+|++.|++++..+..+++|++|||+||+||.||.|||+|.+++..|                             
T Consensus       166 fYvI~kGt~dVyv~~~~v~~~~~g~sFGElALmyn~PRaATv~a~t~~klWgldr~SFrrIi~~s~~kkrkMy~~~l~s~  245 (368)
T KOG1113|consen  166 FYVIDKGTFDVYVNGTYVTTYSPGGSFGELALMYNPPRAATVVAKSLKKLWGLDRTSFRRIIMKSCIKKRKMYEPFLESV  245 (368)
T ss_pred             EEEEecceEEEEECCeEEeeeCCCCchhhhHhhhCCCcccceeeccccceEEEeeceeEEEeeccchhhhhhhhhhhhcc
Confidence            999999999999999999999999999999999999999999998776654                             


Q ss_pred             -------------------------------------eeEEeecceEEEEECC--eEEEEeCCCCeeeHhhhhcCCCcee
Q psy1917         150 -------------------------------------NFSVSAEGEFQVIKDG--KILAVMGPGKAFGELAILYNCTRTA  190 (212)
Q Consensus       150 -------------------------------------~~~i~~~g~~~~~~~~--~~~~~l~~G~~fGe~~ll~~~~r~~  190 (212)
                                                           .||++.+|+..+.+.+  ..+ .+++||||||.+++.+.+|.+
T Consensus       246 pil~~l~k~er~kv~dal~~k~y~~G~~Vi~qg~~ge~f~~i~eGEvdv~~~~~~v~v-kl~~~dyfge~al~~~~pr~A  324 (368)
T KOG1113|consen  246 PILESLEKLERAKVADALGTKSYKDGERVIVQGDQGEHFYIIEEGEVDVLKKRDGVEV-KLKKGDYFGELALLKNLPRAA  324 (368)
T ss_pred             hhhHHHHHHHHHhhhcccceeeccCCceEEeccCCcceEEEecccccchhhccCCeEE-EechhhhcchHHHHhhchhhc
Confidence                                                 2344555544433222  234 899999999999999999999


Q ss_pred             EEEEeccEEEEEEchhhhhccC
Q psy1917         191 SIRALTPCKVWMLDRRVFQKSA  212 (212)
Q Consensus       191 sv~a~~~~~~~~l~~~~f~~i~  212 (212)
                      +|.|.++..|+.+++..|++++
T Consensus       325 tv~a~~~~kc~~~dk~~ferll  346 (368)
T KOG1113|consen  325 TVVAKGRLKCAKLDKPRFERLL  346 (368)
T ss_pred             eeeccCCceeeeeChHHHHHHh
Confidence            9999999999999999999875

>KOG0614|consensus Back     alignment and domain information
>KOG1113|consensus Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>PRK09392 ftrB transcriptional activator FtrB; Provisional Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>cd00038 CAP_ED effector domain of the CAP family of transcription factors; members include CAP (or cAMP receptor protein (CRP)), which binds cAMP, FNR (fumarate and nitrate reduction), which uses an iron-sulfur cluster to sense oxygen) and CooA, a heme containing CO sensor Back     alignment and domain information
>PRK11753 DNA-binding transcriptional dual regulator Crp; Provisional Back     alignment and domain information
>PLN02868 acyl-CoA thioesterase family protein Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>smart00100 cNMP Cyclic nucleotide-monophosphate binding domain Back     alignment and domain information
>KOG0500|consensus Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information
>PRK11161 fumarate/nitrate reduction transcriptional regulator; Provisional Back     alignment and domain information
>COG2905 Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG0499|consensus Back     alignment and domain information
>PRK13918 CRP/FNR family transcriptional regulator; Provisional Back     alignment and domain information
>PRK09391 fixK transcriptional regulator FixK; Provisional Back     alignment and domain information
>TIGR03697 NtcA_cyano global nitrogen regulator NtcA, cyanobacterial Back     alignment and domain information
>KOG0501|consensus Back     alignment and domain information
>KOG2968|consensus Back     alignment and domain information
>KOG2968|consensus Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>PRK11832 putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>PF04831 Popeye: Popeye protein conserved region; InterPro: IPR006916 The Popeye (POP) family of proteins, is restricted to vertebrates and is preferentially expressed in developing and adult striated muscle Back     alignment and domain information
>COG0664 Crp cAMP-binding proteins - catabolite gene activator and regulatory subunit of cAMP-dependent protein kinases [Signal transduction mechanisms] Back     alignment and domain information
>PF00027 cNMP_binding: Cyclic nucleotide-binding domain; InterPro: IPR000595 Proteins that bind cyclic nucleotides (cAMP or cGMP) share a structural domain of about 120 residues [, , ] Back     alignment and domain information
>PF07883 Cupin_2: Cupin domain; InterPro: IPR013096 This family represents the conserved barrel domain of the cupin superfamily [] (cupa is the Latin term for a small barrel) Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PRK13290 ectC L-ectoine synthase; Reviewed Back     alignment and domain information
>COG1917 Uncharacterized conserved protein, contains double-stranded beta-helix domain [Function unknown] Back     alignment and domain information
>PRK10402 DNA-binding transcriptional activator YeiL; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query212
3ocp_A139 Crystal Structure Of Camp Bound Cgmp-Dependent Prot 2e-27
3shr_A 299 Crystal Structure Of Cgmp-Dependent Protein Kinase 2e-27
4din_B381 Novel Localization And Quaternary Structure Of The 9e-09
4din_B 381 Novel Localization And Quaternary Structure Of The 1e-06
1ne4_A283 Crystal Structure Of Rp-Camp Binding R1a Subunit Of 1e-08
1ne4_A 283 Crystal Structure Of Rp-Camp Binding R1a Subunit Of 1e-06
1rl3_A288 Crystal Structure Of Camp-free R1a Subunit Of Pka L 1e-08
1rl3_A 288 Crystal Structure Of Camp-free R1a Subunit Of Pka L 1e-06
2qcs_B291 A Complex Structure Between The Catalytic And Regul 1e-08
2qcs_B 291 A Complex Structure Between The Catalytic And Regul 1e-06
3pvb_B160 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 2e-08
3pvb_B160 Crystal Structure Of (73-244)ria:c Holoenzyme Of Ca 8e-07
3fhi_B154 Crystal Structure Of A Complex Between The Catalyti 2e-08
3fhi_B154 Crystal Structure Of A Complex Between The Catalyti 6e-07
3of1_A 246 Crystal Structure Of Bcy1, The Yeast Regulatory Sub 2e-07
2qvs_B 310 Crystal Structure Of Type Iia Holoenzyme Of Camp-De 2e-07
3idc_B164 Crystal Structure Of (102-265)riib:c Holoenzyme Of 1e-06
3idb_B161 Crystal Structure Of (108-268)riib:c Holoenzyme Of 1e-06
1cx4_A 305 Crystal Structure Of A Deletion Mutant Of The Type 1e-06
3tnp_B 416 Structure And Allostery Of The Pka Riib Tetrameric 3e-06
3tnq_A 416 Structure And Allostery Of The Pka Riib Tetrameric 4e-06
3r6s_A247 Crystal Structure Of Glxr Transcription Factor From 1e-05
1u12_A138 M. Loti Cyclic Nucleotide Binding Domain Mutant Len 3e-04
1vp6_A138 M.Loti Ion Channel Cylic Nucleotide Binding Domain 3e-04
3beh_A355 Structure Of A Bacterial Cyclic Nucleotide Regulate 4e-04
2k0g_A142 Solution Structure Of A Bacterial Cyclic Nucleotide 4e-04
3cl1_A140 M. Loti Cyclic-Nucleotide Binding Domain, Cyclic-Gm 4e-04
3h3u_A224 Crystal Structure Of Crp (Camp Receptor Protein) Fr 4e-04
3mzh_A225 Crystal Structure Of Camp Receptor Protein From Myc 5e-04
3d0s_A227 Camp Receptor Protein From M.Tuberculosis, Camp-Fre 5e-04
3i54_A249 Crystal Structure Of Mtbcrp In Complex With Camp Le 5e-04
2pqq_A149 Structural Genomics, The Crystal Structure Of The N 7e-04
>pdb|3OCP|A Chain A, Crystal Structure Of Camp Bound Cgmp-Dependent Protein Kinase(92-227) Length = 139 Back     alignment and structure 
Iteration: 1

 Score =  118 bits (296), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 54/113 (47%), Positives = 80/113 (70%)
Query: 34  TANDIQIQRYDKDFRSKQLIKAAIMDNDFLKNLDTLQVKEMVESMHQAEYKADSYVITEG 93
           + + + +  Y K  +SK LIK AI+DNDF+KNL+  Q++E+V+ M+  EY  DS +I EG
Sbjct: 2   SGSHVTLPFYPKSPQSKDLIKEAILDNDFMKNLELSQIQEIVDCMYPVEYGKDSCIIKEG 61
Query: 94  EAGNDLFVSAEGEFQVIKDGKILAVMGPGKAFGELAILYNCTRTASIRGFLTV 146
           + G+ ++V  +G+ +V K+G  L  MGPGK FGELAILYNCTRTA+++  + V
Sbjct: 62  DVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTATVKTLVNV 114
>pdb|3SHR|A Chain A, Crystal Structure Of Cgmp-Dependent Protein Kinase Reveals Novel Site Of Interchain Communication Length = 299 Back     alignment and structure
>pdb|4DIN|B Chain B, Novel Localization And Quaternary Structure Of The Pka Ri Beta Holoenzyme Length = 381 Back     alignment and structure
>pdb|4DIN|B Chain B, Novel Localization And Quaternary Structure Of The Pka Ri Beta Holoenzyme Length = 381 Back     alignment and structure
>pdb|1NE4|A Chain A, Crystal Structure Of Rp-Camp Binding R1a Subunit Of Camp- Dependent Protein Kinase Length = 283 Back     alignment and structure
>pdb|1NE4|A Chain A, Crystal Structure Of Rp-Camp Binding R1a Subunit Of Camp- Dependent Protein Kinase Length = 283 Back     alignment and structure
>pdb|1RL3|A Chain A, Crystal Structure Of Camp-free R1a Subunit Of Pka Length = 288 Back     alignment and structure
>pdb|1RL3|A Chain A, Crystal Structure Of Camp-free R1a Subunit Of Pka Length = 288 Back     alignment and structure
>pdb|2QCS|B Chain B, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 291 Back     alignment and structure
>pdb|2QCS|B Chain B, A Complex Structure Between The Catalytic And Regulatory Subunit Of Protein Kinase A That Represents The Inhibited State Length = 291 Back     alignment and structure
>pdb|3PVB|B Chain B, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 160 Back     alignment and structure
>pdb|3PVB|B Chain B, Crystal Structure Of (73-244)ria:c Holoenzyme Of Camp-Dependent Protein Kinase Length = 160 Back     alignment and structure
>pdb|3FHI|B Chain B, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 154 Back     alignment and structure
>pdb|3FHI|B Chain B, Crystal Structure Of A Complex Between The Catalytic And Regulatory (Ri{alpha}) Subunits Of Pka Length = 154 Back     alignment and structure
>pdb|3OF1|A Chain A, Crystal Structure Of Bcy1, The Yeast Regulatory Subunit Of Pka Length = 246 Back     alignment and structure
>pdb|2QVS|B Chain B, Crystal Structure Of Type Iia Holoenzyme Of Camp-Dependent Protein Kinase Length = 310 Back     alignment and structure
>pdb|3IDC|B Chain B, Crystal Structure Of (102-265)riib:c Holoenzyme Of Camp- Dependent Protein Kinase Length = 164 Back     alignment and structure
>pdb|3IDB|B Chain B, Crystal Structure Of (108-268)riib:c Holoenzyme Of Camp- Dependent Protein Kinase Length = 161 Back     alignment and structure
>pdb|1CX4|A Chain A, Crystal Structure Of A Deletion Mutant Of The Type Ii Beta Regulatory Subunit Of Camp-Dependent Protein Kinase Length = 305 Back     alignment and structure
>pdb|3TNP|B Chain B, Structure And Allostery Of The Pka Riib Tetrameric Holoenzyme Length = 416 Back     alignment and structure
>pdb|3TNQ|A Chain A, Structure And Allostery Of The Pka Riib Tetrameric Holoenzyme Length = 416 Back     alignment and structure
>pdb|3R6S|A Chain A, Crystal Structure Of Glxr Transcription Factor From Corynebacterium Glutamicum With Camp Length = 247 Back     alignment and structure
>pdb|1U12|A Chain A, M. Loti Cyclic Nucleotide Binding Domain Mutant Length = 138 Back     alignment and structure
>pdb|1VP6|A Chain A, M.Loti Ion Channel Cylic Nucleotide Binding Domain Length = 138 Back     alignment and structure
>pdb|3BEH|A Chain A, Structure Of A Bacterial Cyclic Nucleotide Regulated Ion Channel Length = 355 Back     alignment and structure
>pdb|2K0G|A Chain A, Solution Structure Of A Bacterial Cyclic Nucleotide- Activated K+ Channel Binding Domain In Complex With Camp Length = 142 Back     alignment and structure
>pdb|3CL1|A Chain A, M. Loti Cyclic-Nucleotide Binding Domain, Cyclic-Gmp Bound Length = 140 Back     alignment and structure
>pdb|3H3U|A Chain A, Crystal Structure Of Crp (Camp Receptor Protein) From Mycoba Tuberculosis Length = 224 Back     alignment and structure
>pdb|3MZH|A Chain A, Crystal Structure Of Camp Receptor Protein From Mycobacterium Tuberculosis In Complex With Camp And Its Dna Binding Element Length = 225 Back     alignment and structure
>pdb|3D0S|A Chain A, Camp Receptor Protein From M.Tuberculosis, Camp-Free Form Length = 227 Back     alignment and structure
>pdb|3I54|A Chain A, Crystal Structure Of Mtbcrp In Complex With Camp Length = 249 Back     alignment and structure
>pdb|2PQQ|A Chain A, Structural Genomics, The Crystal Structure Of The N-Terminal Domain Of A Transcriptional Regulator From Streptomyces Coelicolor A3(2) Length = 149 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query212
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 2e-43
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 6e-41
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 5e-40
3tnp_B 416 CAMP-dependent protein kinase type II-beta regula 2e-32
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 4e-18
3shr_A 299 CGMP-dependent protein kinase 1; cyclic nucleotide 6e-32
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 4e-18
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 3e-29
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 2e-20
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 2e-28
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 1e-17
4din_B381 CAMP-dependent protein kinase type I-beta regulat 2e-27
4din_B381 CAMP-dependent protein kinase type I-beta regulat 2e-17
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 3e-20
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 8e-18
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 1e-16
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 9e-18
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 4e-17
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 7e-15
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 1e-14
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 4e-11
2pqq_A149 Putative transcriptional regulator; APC7345, strep 1e-14
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 6e-14
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 7e-14
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 9e-14
3ukn_A212 Novel protein similar to vertebrate potassium VOL 3e-13
3ukn_A212 Novel protein similar to vertebrate potassium VOL 3e-10
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 4e-12
3d0s_A 227 Transcriptional regulatory protein; CAMP receptor 5e-12
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 7e-12
3e97_A 231 Transcriptional regulator, CRP/FNR family; YP_6044 1e-11
4ev0_A 216 Transcription regulator, CRP family; CAMP binding, 5e-11
3fx3_A 237 Cyclic nucleotide-binding protein; helix_TURN_heli 1e-10
3kcc_A 260 Catabolite gene activator; helix-turn-helix, CAMP, 1e-10
3ryp_A 210 Catabolite gene activator; CAMP receptor protein ( 8e-10
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 2e-09
3iwz_A 230 CAP-like, catabolite activation-like protein; XCC, 2e-09
2oz6_A 207 Virulence factor regulator; winged helix, helix-tu 4e-09
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 6e-09
3e6c_C 250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 1e-08
3dkw_A 227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 1e-08
1ft9_A 222 Carbon monoxide oxidation system transcription reg 3e-08
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 5e-08
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 1e-07
3dv8_A 220 Transcriptional regulator, CRP/FNR family; cyclic 8e-08
1zyb_A 232 Transcription regulator, CRP family; NP_813211.1, 1e-07
2fmy_A220 COOA, carbon monoxide oxidation system transcripti 2e-07
3la7_A 243 Global nitrogen regulator; activator, DNA-binding, 2e-07
2zcw_A 202 TTHA1359, transcriptional regulator, FNR/CRP famil 2e-06
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 5e-05
3b02_A 195 Transcriptional regulator, CRP family; structural 2e-06
3b02_A195 Transcriptional regulator, CRP family; structural 3e-06
2bgc_A238 PRFA; bacterial infection, human pathogen, transcr 3e-06
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Length = 161 Back     alignment and structure
 Score =  142 bits (359), Expect = 2e-43
 Identities = 37/193 (19%), Positives = 72/193 (37%), Gaps = 49/193 (25%)

Query: 19  SKKQGVSGESST-NGQTANDIQIQRYDKDFRSKQLIKAAIMDNDFLKNLDTLQVKEMVES 77
           +++  V  E+   + +  +      + K    +  ++ A  D    KNLD  Q+ +++++
Sbjct: 1   TRRASVCAEAYNPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDA 60

Query: 78  MHQAEYKADSYVITEGEAGNDLFVSAEGEFQVIKDGKILAVMGPGKAFGELAILYNCTRT 137
           M +   K   +VI +G+ G++ +V   G F +                            
Sbjct: 61  MFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCD----------------------- 97

Query: 138 ASIRGFLTVLHFNFSVSAEGEFQVIKDGKILAVMGPGKAFGELAILYNCTRTASIRALTP 197
                                      G+ +       +FGELA++YN  R A+I A +P
Sbjct: 98  -------------------------GVGRCVGNYDNRGSFGELALMYNTPRAATITATSP 132

Query: 198 CKVWMLDRRVFQK 210
             +W LDR  F++
Sbjct: 133 GALWGLDRVTFRR 145
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Length = 154 Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Length = 139 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Length = 416 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Length = 299 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Length = 246 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Length = 291 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Length = 381 Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Length = 469 Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Length = 187 Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Length = 138 Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Length = 142 Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Length = 202 Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Length = 202 Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Length = 149 Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Length = 160 Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Length = 198 Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Length = 137 Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Length = 212 Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Length = 212 Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Length = 154 Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Length = 227 Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Length = 333 Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Length = 231 Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Length = 216 Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Length = 237 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Length = 260 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Length = 210 Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Length = 230 Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Length = 207 Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Length = 213 Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Length = 250 Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Length = 227 Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Length = 222 Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Length = 220 Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Length = 232 Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Length = 220 Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Length = 243 Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Length = 202 Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Length = 202 Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Length = 195 Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Length = 195 Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Length = 238 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query212
4din_B381 CAMP-dependent protein kinase type I-beta regulat 100.0
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 100.0
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 99.97
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.97
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.96
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.94
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 99.93
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 99.93
1o7f_A 469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.92
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 99.89
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 99.85
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 99.84
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 99.83
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 99.82
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 99.82
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 99.82
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 99.82
2pqq_A149 Putative transcriptional regulator; APC7345, strep 99.82
3of1_A246 CAMP-dependent protein kinase regulatory subunit; 99.81
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 99.8
4ev0_A 216 Transcription regulator, CRP family; CAMP binding, 99.79
3d0s_A 227 Transcriptional regulatory protein; CAMP receptor 99.79
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 99.79
3e97_A 231 Transcriptional regulator, CRP/FNR family; YP_6044 99.79
3fx3_A 237 Cyclic nucleotide-binding protein; helix_TURN_heli 99.78
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 99.78
3ukn_A212 Novel protein similar to vertebrate potassium VOL 99.78
1zyb_A 232 Transcription regulator, CRP family; NP_813211.1, 99.78
3shr_A299 CGMP-dependent protein kinase 1; cyclic nucleotide 99.77
3dv8_A 220 Transcriptional regulator, CRP/FNR family; cyclic 99.77
3iwz_A 230 CAP-like, catabolite activation-like protein; XCC, 99.77
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 99.76
2qcs_B291 CAMP-dependent protein kinase type I-alpha regula 99.76
3tnp_B416 CAMP-dependent protein kinase type II-beta regula 99.76
4din_B381 CAMP-dependent protein kinase type I-beta regulat 99.76
3dkw_A 227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 99.74
4f7z_A 999 RAP guanine nucleotide exchange factor 4; cyclic n 99.74
2gau_A 232 Transcriptional regulator, CRP/FNR family; structu 99.73
3ryp_A 210 Catabolite gene activator; CAMP receptor protein ( 99.7
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 99.7
2oz6_A 207 Virulence factor regulator; winged helix, helix-tu 99.69
3kcc_A 260 Catabolite gene activator; helix-turn-helix, CAMP, 99.67
1o5l_A 213 Transcriptional regulator, CRP family; TM1171, str 99.66
2fmy_A 220 COOA, carbon monoxide oxidation system transcripti 99.65
1ft9_A 222 Carbon monoxide oxidation system transcription reg 99.63
1o7f_A469 CAMP-dependent RAP1 guanine-nucleotide exchange fa 99.62
3e6c_C 250 CPRK, cyclic nucleotide-binding protein; CPRK, hal 99.61
3la7_A 243 Global nitrogen regulator; activator, DNA-binding, 99.55
3beh_A355 MLL3241 protein; transmembrane protein, membrane p 99.55
2bgc_A 238 PRFA; bacterial infection, human pathogen, transcr 99.54
3b02_A 195 Transcriptional regulator, CRP family; structural 99.53
2zcw_A 202 TTHA1359, transcriptional regulator, FNR/CRP famil 99.44
3ocp_A139 PRKG1 protein; serine/threonine kinase, TF2I and I 95.38
2ptm_A198 Hyperpolarization-activated (IH) channel; ION chan 95.09
3idb_B161 CAMP-dependent protein kinase type II-beta regulat 94.98
3pna_A154 CAMP-dependent protein kinase type I-alpha regula 94.98
3mdp_A142 Cyclic nucleotide-binding domain (CNMP-BD) protei; 94.88
3gyd_A187 CNMP-BD protein, cyclic nucleotide-binding domain; 94.46
3ukn_A212 Novel protein similar to vertebrate potassium VOL 94.26
4ava_A 333 Lysine acetyltransferase; allosteric regulation, d 93.97
3bpz_A202 Potassium/sodium hyperpolarization-activated cycli 93.92
2pqq_A149 Putative transcriptional regulator; APC7345, strep 93.37
3b02_A195 Transcriptional regulator, CRP family; structural 92.91
1vp6_A138 CNBD, cyclic-nucleotide binding domain of mesorhiz 92.65
4f8a_A160 Potassium voltage-gated channel subfamily H membe; 92.64
2z69_A154 DNR protein; beta barrel, dimerization helix, tran 92.46
3d0s_A227 Transcriptional regulatory protein; CAMP receptor 92.33
4ev0_A216 Transcription regulator, CRP family; CAMP binding, 92.26
1wgp_A137 Probable cyclic nucleotide-gated ION channel 6; cy 91.9
2gau_A232 Transcriptional regulator, CRP/FNR family; structu 91.34
3fjs_A114 Uncharacterized protein with RMLC-like cupin fold; 91.31
3rns_A227 Cupin 2 conserved barrel domain protein; structura 90.66
3e97_A231 Transcriptional regulator, CRP/FNR family; YP_6044 90.55
3fx3_A237 Cyclic nucleotide-binding protein; helix_TURN_heli 90.23
1zyb_A232 Transcription regulator, CRP family; NP_813211.1, 89.72
2ozj_A114 Cupin 2, conserved barrel; cupin superfamily prote 89.42
2d93_A134 RAP guanine nucleotide exchange factor 6; CNMP_bin 89.4
2oz6_A207 Virulence factor regulator; winged helix, helix-tu 89.3
3ryp_A210 Catabolite gene activator; CAMP receptor protein ( 89.23
3kcc_A260 Catabolite gene activator; helix-turn-helix, CAMP, 88.72
3iwz_A230 CAP-like, catabolite activation-like protein; XCC, 88.46
3dn7_A194 Cyclic nucleotide binding regulatory protein; stru 88.26
1o5l_A213 Transcriptional regulator, CRP family; TM1171, str 87.81
2zcw_A202 TTHA1359, transcriptional regulator, FNR/CRP famil 87.17
3dkw_A227 DNR protein; CRP-FNR, HTH, beta barrel, dimerizati 86.66
3dv8_A220 Transcriptional regulator, CRP/FNR family; cyclic 86.31
2fqp_A97 Hypothetical protein BP2299; double-stranded beta- 85.94
2pfw_A116 Cupin 2, conserved barrel domain protein; cupin do 83.98
3la7_A243 Global nitrogen regulator; activator, DNA-binding, 83.34
3lwc_A119 Uncharacterized protein; structural genomics, unkn 82.64
1yhf_A115 Hypothetical protein SPY1581; structural genomics, 82.36
2gu9_A113 Tetracenomycin polyketide synthesis protein; X-RAY 80.18
3cf6_E 694 RAP guanine nucleotide exchange factor (GEF) 4; EP 80.07
1o5u_A101 Novel thermotoga maritima enzyme TM1112; cupin, st 80.05
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=3.3e-32  Score=234.52  Aligned_cols=195  Identities=27%  Similarity=0.471  Sum_probs=176.1

Q ss_pred             cCCCCCcEEeeccCCCCCCCcceeecccCCHHHHHHHHHHhhcCccCCCCCHHHHHHHHhhceEEEecCCCeEEccCCCC
Q psy1917          17 LNSKKQGVSGESSTNGQTANDIQIQRYDKDFRSKQLIKAAIMDNDFLKNLDTLQVKEMVESMHQAEYKADSYVITEGEAG   96 (212)
Q Consensus        17 ~~~~r~~v~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~lf~~l~~~~~~~l~~~~~~~~~~~g~~I~~~Gd~~   96 (212)
                      .+.||++||||+..+... ..+..+.++|+.++.+.+.++|+++++|..|+++++..++..+..+.|++|++|+++||.+
T Consensus        93 ~~~~r~~vsae~~~~~~~-~~~~~~~~~ks~~~~~~i~~~l~~~~lF~~L~~~~l~~l~~~~~~~~~~~ge~I~~~Gd~~  171 (381)
T 4din_B           93 ARRRRGGVSAEVYTEEDA-VSYVRKVIPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGNEG  171 (381)
T ss_dssp             SSCCCCCCBCCCCCHHHH-HTCCCCCCCCCHHHHHHHHHHHTTCTTSSSCCHHHHHHHHHHCEEEECCTTCBSSCTTSBC
T ss_pred             cCCCCCeEecccCCcccc-ccccCCCCCCCHHHHHHHHHHHhCChhhhcCCHHHHHHHHHhceEEEECCCCEEEeCCCCC
Confidence            357888999999875433 3556778999999999999999999999999999999999999999999999999999999


Q ss_pred             CeeEEEecCEEEEEECCEEEEEeCCCCcchhhhhhhCCCcceEEEEEeeeeee---------------------------
Q psy1917          97 NDLFVSAEGEFQVIKDGKILAVMGPGKAFGELAILYNCTRTASIRGFLTVLHF---------------------------  149 (212)
Q Consensus        97 ~~~yiI~~G~v~v~~~~~~~~~l~~g~~fGe~~ll~~~~r~a~v~a~~~~~~~---------------------------  149 (212)
                      +++|+|++|.|+++++++.+..+++|++|||++++++.||.+|++|.+++..+                           
T Consensus       172 ~~~yiI~~G~v~v~~~~~~v~~l~~G~~fGe~all~~~~r~atv~A~~~~~l~~i~~~~f~~ll~~~~~~~~~~~~~~L~  251 (381)
T 4din_B          172 DNFYVVDQGEVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLS  251 (381)
T ss_dssp             CEEEECSSSEEEEEETTEEEEEEESSCCBCGGGGTSCCBCSSEEEESSSCEEEEEEHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CeEEEEEeeEEEEEECCeEeeeCCCCCEEEchHHhcCCCcceEEEECCCEEEEEEchHHHHHhhhhhhHHHHHHHHHHhh
Confidence            99999999999999999999999999999999999999999999997766532                           


Q ss_pred             ---------------------------------------eeEEeecceEEEEEC---C---eEEEEeCCCCeeeHhhhhc
Q psy1917         150 ---------------------------------------NFSVSAEGEFQVIKD---G---KILAVMGPGKAFGELAILY  184 (212)
Q Consensus       150 ---------------------------------------~~~i~~~g~~~~~~~---~---~~~~~l~~G~~fGe~~ll~  184 (212)
                                                             .+|++.+|...++..   +   ..+..+++|++|||.+++.
T Consensus       252 ~v~~f~~Ls~~el~~l~~~~~~~~~~~ge~I~~eGd~~~~~yiI~~G~v~v~~~~~~~~~~~~v~~l~~Gd~fGe~all~  331 (381)
T 4din_B          252 KVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALLL  331 (381)
T ss_dssp             HCSTTTTCCTTHHHHHHTTCBCCCBCSSCBSSCTTSBCCEEEEEEESCEEEECCSSSSSCCCEEEEECTTCEECTTGGGS
T ss_pred             hhHHHHhccHHHHHHHHHhhhhccCCCCCEEEeCCCcCCEEEEEEeCEEEEEEecCCCCceEEEEEeCCCCEechHHHhC
Confidence                                                   568888998877653   2   2689999999999999999


Q ss_pred             CCCceeEEEEeccEEEEEEchhhhhccC
Q psy1917         185 NCTRTASIRALTPCKVWMLDRRVFQKSA  212 (212)
Q Consensus       185 ~~~r~~sv~a~~~~~~~~l~~~~f~~i~  212 (212)
                      +.+|.++|+|.++|.++.|++++|.+++
T Consensus       332 ~~~r~~tv~A~~~~~ll~i~~~~f~~ll  359 (381)
T 4din_B          332 NRPRAATVVARGPLKCVKLDRPRFERVL  359 (381)
T ss_dssp             CCBCSSEEEESSCBEEEEEEHHHHHHHH
T ss_pred             CCCceeEEEEcCCEEEEEEeHHHHHHHH
Confidence            9999999999999999999999998764
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Back     alignment and structure
>3of1_A CAMP-dependent protein kinase regulatory subunit; cyclic nucleotide binding domain, evolution, PKA signaling, transfer; HET: CMP; 2.21A {Saccharomyces cerevisiae} Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3shr_A CGMP-dependent protein kinase 1; cyclic nucleotide binding domains, cyclic nucleotide protein transferase, PKG; HET: CMP; 2.50A {Bos taurus} Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Back     alignment and structure
>2qcs_B CAMP-dependent protein kinase type I-alpha regula subunit, CAMP-dependent protein kinase, alpha-catalytic SU; cyclic adenosine monophosphate; HET: SEP TPO ANP TAM; 2.20A {Bos taurus} PDB: 1rl3_A* 1rgs_A* 1ne6_A* 1ne4_A* Back     alignment and structure
>3tnp_B CAMP-dependent protein kinase type II-beta regula subunit; PKA RIIB tetrameric holoenzyme, transferase; HET: SEP TPO; 2.30A {Mus musculus} PDB: 3tnq_A* 1cx4_A* 2qvs_B* Back     alignment and structure
>4din_B CAMP-dependent protein kinase type I-beta regulat subunit, CAMP-dependent protein kinase catalytic subunit A; isoform diversity; HET: TPO SEP ATP; 3.70A {Homo sapiens} Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>4f7z_A RAP guanine nucleotide exchange factor 4; cyclic nucleotide, regulation, auto-IN CDC25 homology domain, exocytosis; 2.60A {Mus musculus} PDB: 2byv_E Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>2fmy_A COOA, carbon monoxide oxidation system transcription RE COOA-1; DNA transcription regulator, DNA binding protein; HET: HEM; 2.20A {Carboxydothermus hydrogenoformans} PDB: 2hkx_A* Back     alignment and structure
>1ft9_A Carbon monoxide oxidation system transcription regulator; heme sensor, catabolite gene activator protein; HET: HEM; 2.60A {Rhodospirillum rubrum} SCOP: a.4.5.4 b.82.3.1 Back     alignment and structure
>1o7f_A CAMP-dependent RAP1 guanine-nucleotide exchange factor; EPAC2, CAMP-GEF2, campb binding doamin, regulation; 2.5A {Mus musculus} SCOP: a.4.5.31 b.82.3.2 b.82.3.2 Back     alignment and structure
>3e6c_C CPRK, cyclic nucleotide-binding protein; CPRK, halorespiration; HET: DNA 3C4; 1.80A {Desulfitobacterium hafniense} SCOP: a.4.5.4 b.82.3.2 PDB: 3e6b_A* 3e5u_C* 3e6d_A 3e5x_A* 3e5q_A 2h6b_A* 2h6c_A Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>2bgc_A PRFA; bacterial infection, human pathogen, transcriptional regulat transcription; HET: PR3; 2.3A {Listeria monocytogenes} SCOP: a.4.5.4 b.82.3.3 PDB: 2beo_A* 1omi_A Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>3ocp_A PRKG1 protein; serine/threonine kinase, TF2I and IRAG, transferase; HET: CMP; 2.49A {Homo sapiens} PDB: 3od0_A* 3ogj_A* Back     alignment and structure
>2ptm_A Hyperpolarization-activated (IH) channel; ION channel, cyclic nucleotide binding domain, C-linker, CAM SPHCN1, HCN; HET: CMP; 1.93A {Strongylocentrotus purpuratus} Back     alignment and structure
>3idb_B CAMP-dependent protein kinase type II-beta regulatory subunit, CAMP-dependent protein kinase catalytic subunit alpha; PKA, SPR, affinity; HET: TPO SEP ANP; 1.62A {Rattus norvegicus} PDB: 3idc_B* Back     alignment and structure
>3pna_A CAMP-dependent protein kinase type I-alpha regula subunit; beta-barrel, CAMP-binding, catalytic subunit, transferase; HET: CMP; 1.50A {Bos taurus} PDB: 3fhi_B* 3iia_A 3plq_A* 1u7e_B* 3pvb_B* Back     alignment and structure
>3mdp_A Cyclic nucleotide-binding domain (CNMP-BD) protei; structural genomics, joint center for structural genomics; HET: MSE; 1.90A {Geobacter metallireducens} Back     alignment and structure
>3gyd_A CNMP-BD protein, cyclic nucleotide-binding domain; nucleotide binding protein, structural genomics; HET: MSE CMP; 1.79A {Methylobacillus flagellatus KT} Back     alignment and structure
>3ukn_A Novel protein similar to vertebrate potassium VOL channel, subfamily H (EAG-related)...; KCNH, ELK, ERG, CNBD, CNBHD, C-linker, ION channel; 2.20A {Danio rerio} PDB: 3ukt_B 3ukv_B Back     alignment and structure
>4ava_A Lysine acetyltransferase; allosteric regulation, domain coupling; HET: ACO; 1.70A {Mycobacterium tuberculosis} PDB: 4avb_A* 4avc_A* Back     alignment and structure
>3bpz_A Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 2; CNBD, C-linker, pacemaker, HCN, HCN2, CAP, PKA, CAMP, ION channel; HET: CMP; 1.65A {Mus musculus} PDB: 3ffq_A 1q3e_A* 1q43_A* 1q5o_A* 3u10_A* 2q0a_A* 3etq_A* 3u11_A* 3otf_A* 3u0z_A* Back     alignment and structure
>2pqq_A Putative transcriptional regulator; APC7345, streptomyces coelicolor structural genomics, PSI-2, protein structure initiative; 2.00A {Streptomyces coelicolor A3} Back     alignment and structure
>3b02_A Transcriptional regulator, CRP family; structural genomics, riken structural genomics/proteomics in RSGI; 1.92A {Thermus thermophilus} PDB: 2zdb_A Back     alignment and structure
>1vp6_A CNBD, cyclic-nucleotide binding domain of mesorhizobium LOTI CNG potassium channel; dimer helical bundle beta barrel core with cyclic AMP bound; HET: CMP; 1.70A {Mesorhizobium loti} SCOP: b.82.3.2 PDB: 3cl1_A* 2k0g_A* 2kxl_A 3clp_A* 1u12_A 3co2_A Back     alignment and structure
>4f8a_A Potassium voltage-gated channel subfamily H membe; probable regulatory domain of potassium channel, membrane PR transport protein; 2.20A {Mus musculus} Back     alignment and structure
>2z69_A DNR protein; beta barrel, dimerization helix, transcription regulator; 2.10A {Pseudomonas aeruginosa} Back     alignment and structure
>3d0s_A Transcriptional regulatory protein; CAMP receptor protein (CRP), dimer, inactive(APO, unliganded allostery, DNA binding, cyclic AMP; 2.00A {Mycobacterium tuberculosis} PDB: 3i54_A* 3i59_A* 3mzh_A* 3h3u_A* 3r6s_A* Back     alignment and structure
>4ev0_A Transcription regulator, CRP family; CAMP binding, winged helix-turn-helix motif, DNA binding, transcription activator; HET: CMP; 2.40A {Thermus thermophilus} Back     alignment and structure
>1wgp_A Probable cyclic nucleotide-gated ION channel 6; cyclic nucleotide monophosphate, CNMP, CNMP-binding, structural genomics; NMR {Arabidopsis thaliana} SCOP: b.82.3.2 Back     alignment and structure
>2gau_A Transcriptional regulator, CRP/FNR family; structural genomics, porphyromona gingivalis, PSI, protein structure initiative; 1.90A {Porphyromonas gingivalis} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3fjs_A Uncharacterized protein with RMLC-like cupin fold; structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.90A {Ralstonia eutropha JMP134} Back     alignment and structure
>3rns_A Cupin 2 conserved barrel domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 2.07A {Leptotrichia buccalis} Back     alignment and structure
>3e97_A Transcriptional regulator, CRP/FNR family; YP_604437.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.86A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>3fx3_A Cyclic nucleotide-binding protein; helix_TURN_helix, CAMP regulatory protein, structural genomi 2, protein structure initiative; 2.20A {Ruegeria pomeroyi} PDB: 3h3z_A* Back     alignment and structure
>1zyb_A Transcription regulator, CRP family; NP_813211.1, structural genomics, joint center for structura genomics, JCSG; 2.15A {Bacteroides thetaiotaomicron} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>2ozj_A Cupin 2, conserved barrel; cupin superfamily protein, struct genomics, joint center for structural genomics, JCSG; HET: MSE; 1.60A {Desulfitobacterium hafniense} Back     alignment and structure
>2d93_A RAP guanine nucleotide exchange factor 6; CNMP_binding domain, PDZ domain containing guanine nucleotide exchange factor 2, PDZ-GEF2, RA-GEF-2; NMR {Homo sapiens} Back     alignment and structure
>2oz6_A Virulence factor regulator; winged helix, helix-turn-helix, transcription factor, CAMP-B proteins, CAMP receptor protein; HET: CMP; 2.80A {Pseudomonas aeruginosa} SCOP: a.4.5.4 b.82.3.2 Back     alignment and structure
>3ryp_A Catabolite gene activator; CAMP receptor protein (CRP), allostery, DNA binding cyclic A transcription regulator; HET: CMP; 1.60A {Escherichia coli} PDB: 2cgp_A* 3hif_A 1g6n_A* 3ryr_A* 1i5z_A* 1j59_A* 1lb2_A* 1run_A* 1zrc_A* 1zrd_A* 1zre_A* 1zrf_A* 2gzw_A* 2wc2_A 3iyd_G* 3n4m_A* 3qop_A* 3rdi_A* 3rou_A* 3rpq_A* ... Back     alignment and structure
>3kcc_A Catabolite gene activator; helix-turn-helix, CAMP, CAMP-binding, DNA-binding nucleotide-binding, transcription, transcription regulation; HET: CMP; 1.66A {Escherichia coli} Back     alignment and structure
>3iwz_A CAP-like, catabolite activation-like protein; XCC, pathogenicity, CRP, CLP, C-DI-GMP receptor, quorum SENS binding, transcription; 2.30A {Xanthomonas campestris PV} Back     alignment and structure
>3dn7_A Cyclic nucleotide binding regulatory protein; structural genomics, APC88869, cyclic nucleotide binding REG protein, PSI-2; 1.80A {Cytophaga hutchinsonii} Back     alignment and structure
>1o5l_A Transcriptional regulator, CRP family; TM1171, structural GE JCSG, PSI, protein structure initiative, joint center for S genomics; 2.30A {Thermotoga maritima} SCOP: b.82.3.2 Back     alignment and structure
>2zcw_A TTHA1359, transcriptional regulator, FNR/CRP family; stationary phase, DNA-binding, transcription regulation; 1.50A {Thermus thermophilus} Back     alignment and structure
>3dkw_A DNR protein; CRP-FNR, HTH, beta barrel, dimerization helix, homodimer, transcription regulator; 3.60A {Pseudomonas aeruginosa} Back     alignment and structure
>3dv8_A Transcriptional regulator, CRP/FNR family; cyclic nucleotide-binding domain, structural genomics, joint for structural genomics; 2.55A {Eubacterium rectale atcc 33656} Back     alignment and structure
>2fqp_A Hypothetical protein BP2299; double-stranded beta-helix fold, structural genomics, joint for structural genomics, JCSG; HET: 1PE; 1.80A {Bordetella pertussis tohama I} Back     alignment and structure
>2pfw_A Cupin 2, conserved barrel domain protein; cupin domain, struc genomics, joint center for structural genomics, JCSG; 1.90A {Shewanella frigidimarina} Back     alignment and structure
>3la7_A Global nitrogen regulator; activator, DNA-binding, transcription, transcription regulation; HET: BOG; 1.90A {Anabaena} PDB: 3la2_A* 3la3_A* 2xko_A* 2xgx_A* 2xhk_A* 2xkp_A* Back     alignment and structure
>3lwc_A Uncharacterized protein; structural genomics, unknown function, joint center for STRU genomics, JCSG, protein structure initiative; HET: MSE; 1.40A {Rhizobium leguminosarum} Back     alignment and structure
>1yhf_A Hypothetical protein SPY1581; structural genomics, conserved hypothetical protein, PSI, PR structure initiative; 2.00A {Streptococcus pyogenes} SCOP: b.82.1.9 Back     alignment and structure
>2gu9_A Tetracenomycin polyketide synthesis protein; X-RAY diffraction, cupin, immune system; 1.40A {Xanthomonas campestris} PDB: 2ilb_A 3h50_A Back     alignment and structure
>3cf6_E RAP guanine nucleotide exchange factor (GEF) 4; EPAC, rapgef4, CAMP, SP-camps, GEF, gunanine nucleotide exchange factor, G-protein, GTP-binding, nucleotide-binding; HET: SP1; 2.20A {Mus musculus} Back     alignment and structure
>1o5u_A Novel thermotoga maritima enzyme TM1112; cupin, structural genomics center for structural genomics, JCSG, protein structure INI PSI; 1.83A {Thermotoga maritima} SCOP: b.82.1.8 PDB: 1lkn_A 2k9z_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 212
d1ne6a1136 b.82.3.2 (A:109-244) Regulatory subunit of Protein 1e-16
d1cx4a1136 b.82.3.2 (A:130-265) Regulatory subunit of Protein 5e-14
d1cx4a2147 b.82.3.2 (A:266-412) Regulatory subunit of Protein 7e-10
d1ne6a2132 b.82.3.2 (A:245-376) Regulatory subunit of Protein 2e-06
d1ne6a2132 b.82.3.2 (A:245-376) Regulatory subunit of Protein 4e-05
d1o7fa2155 b.82.3.2 (A:13-167) Regulatory domain of Epac2, do 4e-06
d1i5za2132 b.82.3.2 (A:6-137) Catabolite gene activator prote 2e-05
d1vp6a_133 b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizo 3e-04
d1o7fa3124 b.82.3.2 (A:322-445) Regulatory domain of Epac2, d 0.001
d1q3ea_193 b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus mu 0.001
d1wgpa_137 b.82.3.2 (A:) Probable cyclic nucleotide-gated ion 0.001
d2gaua2142 b.82.3.2 (A:10-151) Transcriptional regulator PG03 0.003
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 136 Back     information, alignment and structure

class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Regulatory subunit of Protein kinase A
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 71.3 bits (174), Expect = 1e-16
 Identities = 27/97 (27%), Positives = 53/97 (54%)

Query: 45  KDFRSKQLIKAAIMDNDFLKNLDTLQVKEMVESMHQAEYKADSYVITEGEAGNDLFVSAE 104
           KD+++   +  AI  N    +LD  +  ++ ++M    + A   VI +G+ G++ +V  +
Sbjct: 10  KDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQ 69

Query: 105 GEFQVIKDGKILAVMGPGKAFGELAILYNCTRTASIR 141
           GE  V  + +    +G G +FGELA++Y   R A+++
Sbjct: 70  GEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVK 106
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 147 Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 132 Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Length = 132 Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 155 Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Length = 133 Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 124 Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Length = 193 Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 137 Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Length = 142 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query212
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 99.92
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 99.91
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.89
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 99.89
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 99.88
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 99.87
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 99.85
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 99.84
d1zyba2147 Probable transcription regulator BT4300, N-termina 99.83
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 99.82
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 99.77
d1i5za2132 Catabolite gene activator protein, N-terminal doma 99.73
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 99.71
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 99.66
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 99.66
d3e5ua2139 Chlorophenol reduction protein CprK {Desulfitobact 99.65
d1ft9a2132 CO-sensing protein CooA, N-terminal domain {Rhodos 99.64
d1ne6a1136 Regulatory subunit of Protein kinase A {Cow (Bos t 96.93
d1cx4a2147 Regulatory subunit of Protein kinase A {Rat (Rattu 96.26
d1o7fa3124 Regulatory domain of Epac2, domains 1 and 3 {Mouse 96.16
d1cx4a1136 Regulatory subunit of Protein kinase A {Rat (Rattu 95.79
d1wgpa_137 Probable cyclic nucleotide-gated ion channel 6 {Th 95.56
d1o7fa2155 Regulatory domain of Epac2, domains 1 and 3 {Mouse 95.56
d1q3ea_193 HCN pacemaker channel {Mouse (Mus musculus) [TaxId 95.3
d1ne6a2132 Regulatory subunit of Protein kinase A {Cow (Bos t 95.19
d1yhfa1112 Hypothetical protein SPy1581 {Streptococcus pyogen 94.35
d2zcwa2112 Transcriptional regulator TTHA1359, N-terminal dom 93.97
d1vp6a_133 Putative ion channel CnbD {Mesorhizobium loti [Tax 93.65
d2gaua2142 Transcriptional regulator PG0396, N-terminal domai 93.12
d2b8ma1108 Hypothetical protein MJ0764 {Archaeon Methanococcu 90.37
d1i5za2132 Catabolite gene activator protein, N-terminal doma 89.66
d2oz6a2134 Cyclic AMP receptor-like protein Vfr {Pseudomonas 88.06
d1o5la1129 CRP-like transcriptional regulator TM1171, N-termi 87.56
d1zyba2147 Probable transcription regulator BT4300, N-termina 87.22
d1v70a_105 Hypothetical protein TTHA0104 {Thermus thermophilu 84.57
d1y9qa299 Probable transcriptional regulator VC1968, C-termi 83.2
d2bgca2131 Listeriolysin regulatory protein PrfA, N-terminal 83.18
d2f4pa1134 Hypothetical protein TM1010 {Thermotoga maritima [ 82.69
d1o5ua_88 Hypothetical protein TM1112 {Thermotoga maritima [ 80.96
d1vj2a_114 Hypothetical protein TM1459 {Thermotoga maritima [ 80.88
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: All beta proteins
fold: Double-stranded beta-helix
superfamily: cAMP-binding domain-like
family: cAMP-binding domain
domain: Regulatory subunit of Protein kinase A
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=99.92  E-value=4.5e-24  Score=156.52  Aligned_cols=123  Identities=28%  Similarity=0.487  Sum_probs=112.3

Q ss_pred             cccCCHHHHHHHHHHhhcCccCCCCCHHHHHHHHhhceEEEecCCCeEEccCCCCCeeEEEecCEEEEEECCEEEEEeCC
Q psy1917          42 RYDKDFRSKQLIKAAIMDNDFLKNLDTLQVKEMVESMHQAEYKADSYVITEGEAGNDLFVSAEGEFQVIKDGKILAVMGP  121 (212)
Q Consensus        42 ~~~~~~~~~~~~~~~l~~~~lf~~l~~~~~~~l~~~~~~~~~~~g~~I~~~Gd~~~~~yiI~~G~v~v~~~~~~~~~l~~  121 (212)
                      .++|++++++.+.+.|+++++|.+|+++++..++..++.+.|++|++|+++||+++.+|+|.+|.|.++.+         
T Consensus         3 ~~~kt~~~~~~l~~~l~~~~~F~~l~~~~~~~l~~~~~~~~~~~g~~I~~~G~~~~~~y~I~~G~v~v~~~---------   73 (136)
T d1cx4a1           3 IHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVK---------   73 (136)
T ss_dssp             CCCCCHHHHHHHHHHHTTCGGGTTCCHHHHHHHHHHCEEEEECTTCEEECTTSCCCEEEEEEECEEEEEEE---------
T ss_pred             cccCCHHHHHHHHHHHhCCHhhhcCCHHHHHHHhcceEEEEECCCCEEEECCCcchhhhhhhhheeEEeec---------
Confidence            46899999999999999999999999999999999999999999999999999999999999999999762         


Q ss_pred             CCcchhhhhhhCCCcceEEEEEeeeeeeeeEEeecceEEEEECCeEEEEeCCCCeeeHhhhhcCCCceeEEEEeccEEEE
Q psy1917         122 GKAFGELAILYNCTRTASIRGFLTVLHFNFSVSAEGEFQVIKDGKILAVMGPGKAFGELAILYNCTRTASIRALTPCKVW  201 (212)
Q Consensus       122 g~~fGe~~ll~~~~r~a~v~a~~~~~~~~~~i~~~g~~~~~~~~~~~~~l~~G~~fGe~~ll~~~~r~~sv~a~~~~~~~  201 (212)
                                                       .+|..      ..+..+++|++||+.+++.+.|+.++++|.++|.+|
T Consensus        74 ---------------------------------~~~~~------~~~~~l~~g~~fg~~~l~~~~~~~~s~~a~~~~~~~  114 (136)
T d1cx4a1          74 ---------------------------------CDGVG------RCVGNYDNRGSFGELALMYNTPRAATITATSPGALW  114 (136)
T ss_dssp             ---------------------------------ETTEE------EEEEEEESSCEECHHHHHHCCCCCSEEEESSCEEEE
T ss_pred             ---------------------------------cccce------eeeeccCCccccchHHHhCCCcceEEEEECCCEEEE
Confidence                                             12221      247789999999999999999999999999999999


Q ss_pred             EEchhhhhccC
Q psy1917         202 MLDRRVFQKSA  212 (212)
Q Consensus       202 ~l~~~~f~~i~  212 (212)
                      .|++++|.+++
T Consensus       115 ~i~~~~f~~ll  125 (136)
T d1cx4a1         115 GLDRVTFRRII  125 (136)
T ss_dssp             EEEHHHHHHHH
T ss_pred             EEeHHHHHHHH
Confidence            99999998864
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d3e5ua2 b.82.3.2 (A:9-147) Chlorophenol reduction protein CprK {Desulfitobacterium hafniense [TaxId: 49338]} Back     information, alignment and structure
>d1ft9a2 b.82.3.1 (A:2-133) CO-sensing protein CooA, N-terminal domain {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1ne6a1 b.82.3.2 (A:109-244) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1cx4a2 b.82.3.2 (A:266-412) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1o7fa3 b.82.3.2 (A:322-445) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cx4a1 b.82.3.2 (A:130-265) Regulatory subunit of Protein kinase A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wgpa_ b.82.3.2 (A:) Probable cyclic nucleotide-gated ion channel 6 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1o7fa2 b.82.3.2 (A:13-167) Regulatory domain of Epac2, domains 1 and 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q3ea_ b.82.3.2 (A:) HCN pacemaker channel {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ne6a2 b.82.3.2 (A:245-376) Regulatory subunit of Protein kinase A {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yhfa1 b.82.1.9 (A:1-112) Hypothetical protein SPy1581 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1vp6a_ b.82.3.2 (A:) Putative ion channel CnbD {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d2gaua2 b.82.3.2 (A:10-151) Transcriptional regulator PG0396, N-terminal domain {Porphyromonas gingivalis [TaxId: 837]} Back     information, alignment and structure
>d2b8ma1 b.82.1.18 (A:1-108) Hypothetical protein MJ0764 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1i5za2 b.82.3.2 (A:6-137) Catabolite gene activator protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oz6a2 b.82.3.2 (A:9-142) Cyclic AMP receptor-like protein Vfr {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1o5la1 b.82.3.2 (A:1-129) CRP-like transcriptional regulator TM1171, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zyba2 b.82.3.2 (A:1-147) Probable transcription regulator BT4300, N-terminal domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1v70a_ b.82.1.9 (A:) Hypothetical protein TTHA0104 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1y9qa2 b.82.1.15 (A:83-181) Probable transcriptional regulator VC1968, C-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2bgca2 b.82.3.3 (A:7-137) Listeriolysin regulatory protein PrfA, N-terminal domain {Bacteria (Listeria monocytogenes) [TaxId: 1639]} Back     information, alignment and structure
>d2f4pa1 b.82.1.9 (A:2-135) Hypothetical protein TM1010 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1o5ua_ b.82.1.8 (A:) Hypothetical protein TM1112 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vj2a_ b.82.1.10 (A:) Hypothetical protein TM1459 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure