Psyllid ID: psy1928


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-----
MIYELFSEFGPLKSAKLHYDRSGRSLGTADLIYERRSDAIKAMKQYNGVPLDGRPMQIQLAADVSVLENTVPRPVARGGRGGASGGYRNGTAPTYRPRGGLKKTL
cHHHHHcccccccEEEEEEccccccccEEEEEEccHHHHHHHHHHHcccccccEEEEEEEEEccccccccccccccccccccccccccccccccccccccccccc
cHHHHHHHHccHHEEEEEEcccccccccEEEEEccHHHHHHHHHHHcccccccccEEEEEEcccccccccccccccccccccccccccccccccccccccccccc
MIYELFsefgplksaklhydrsgrslgtADLIYERRSDAIKAMKqyngvpldgrpmQIQLAADVSVlentvprpvarggrggasggyrngtaptyrprgglkktl
MIYELFSefgplksaklhydrsgrslgTADLIYERRSDAIKAMKQYNGVPLDGRPMQIQLAADVSVLentvprpvarggrggasggyrngtaptyrprgglkktl
MIYELFSEFGPLKSAKLHYDRSGRSLGTADLIYERRSDAIKAMKQYNGVPLDGRPMQIQLAADVSVLENTVPRPVarggrggasggyrngtaPTYRPRGGLKKTL
*****F**F*******LHY*****SLGTADLIYERRSDAIKAMKQYNGVPLDGRPMQIQLAADVSVL**************************************
MIYELFSEFGPLKSAKLHYDRSGRSLGTADLIYERRSDAIKAMKQYNGVPLDGRPMQIQ**********************************************
MIYELFSEFGPLKSAKLHYDRSGRSLGTADLIYERRSDAIKAMKQYNGVPLDGRPMQIQLAADVSVLENTVPRPVARGGRGGASGGYRNGTAPTYRPRGGLKKTL
MIYELFSEFGPLKSAKLHYDRSGRSLGTADLIYERRSDAIKAMKQYNGVPLDGRPMQIQLAADV*****************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIYELFSEFGPLKSAKLHYDRSGRSLGTADLIYERRSDAIKAMKQYNGVPLDGRPMQIQLAADVSVLENTVPRPVARGGRGGASGGYRNGTAPTYRPRGGLKKTL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query105 2.2.26 [Sep-21-2011]
O08583255 THO complex subunit 4 OS= yes N/A 0.761 0.313 0.638 5e-23
Q3T0I4257 THO complex subunit 4 OS= yes N/A 0.761 0.311 0.638 5e-23
B5FXN8254 THO complex subunit 4 OS= no N/A 0.761 0.314 0.638 5e-23
Q58EA2256 THO complex subunit 4-A O N/A N/A 0.819 0.335 0.575 6e-23
Q28FB9260 THO complex subunit 4 OS= yes N/A 0.819 0.330 0.575 8e-23
Q86V81257 THO complex subunit 4 OS= yes N/A 0.761 0.311 0.626 2e-22
Q6GLW1256 THO complex subunit 4-B O N/A N/A 0.742 0.304 0.629 1e-21
Q9JJW6218 RNA and export factor-bin no N/A 0.761 0.366 0.626 2e-21
Q6PFR5281 Transformer-2 protein hom no N/A 0.552 0.206 0.423 4e-06
Q13595282 Transformer-2 protein hom no N/A 0.552 0.205 0.423 4e-06
>sp|O08583|THOC4_MOUSE THO complex subunit 4 OS=Mus musculus GN=Alyref PE=1 SV=3 Back     alignment and function desciption
 Score =  106 bits (264), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 63/83 (75%), Gaps = 3/83 (3%)

Query: 2   IYELFSEFGPLKSAKLHYDRSGRSLGTADLIYERRSDAIKAMKQYNGVPLDGRPMQIQLA 61
           I ELF+EFG LK A +HYDRSGRSLGTAD+ +ER++DA+KAMKQYNGVPLDGRPM IQL 
Sbjct: 121 IQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQL- 179

Query: 62  ADVSVLENTVPRPVARGGRGGAS 84
             V+   +T  RP     RGG +
Sbjct: 180 --VTSQIDTQRRPAQSINRGGMT 200




Component of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Plays a role in mRNA processing and export. Acts as chaperone and promotes the dimerization of transcription factors containing basic leucine zipper (bZIP) domains and thereby promotes transcriptional activation. May function as scaffold that mediates interactions between proteins and/or RNA. Integral part of the THO/TREX complex that is recruited to transcribed genes and travels with the RNA polymerase during elongation. Is part of the exon junction complex that remains associated with spliced mRNA and plays an important role in mRNA export and nonsense-mediated RNA decay.
Mus musculus (taxid: 10090)
>sp|Q3T0I4|THOC4_BOVIN THO complex subunit 4 OS=Bos taurus GN=ALYREF PE=2 SV=1 Back     alignment and function description
>sp|B5FXN8|THOC4_TAEGU THO complex subunit 4 OS=Taeniopygia guttata GN=ALYREF PE=2 SV=1 Back     alignment and function description
>sp|Q58EA2|THO4A_XENLA THO complex subunit 4-A OS=Xenopus laevis GN=alyref-a PE=2 SV=1 Back     alignment and function description
>sp|Q28FB9|THOC4_XENTR THO complex subunit 4 OS=Xenopus tropicalis GN=alyref PE=2 SV=1 Back     alignment and function description
>sp|Q86V81|THOC4_HUMAN THO complex subunit 4 OS=Homo sapiens GN=ALYREF PE=1 SV=3 Back     alignment and function description
>sp|Q6GLW1|THO4B_XENLA THO complex subunit 4-B OS=Xenopus laevis GN=alyref-b PE=2 SV=1 Back     alignment and function description
>sp|Q9JJW6|REFP2_MOUSE RNA and export factor-binding protein 2 OS=Mus musculus GN=Refbp2 PE=1 SV=1 Back     alignment and function description
>sp|Q6PFR5|TRA2A_MOUSE Transformer-2 protein homolog alpha OS=Mus musculus GN=Tra2a PE=1 SV=1 Back     alignment and function description
>sp|Q13595|TRA2A_HUMAN Transformer-2 protein homolog alpha OS=Homo sapiens GN=TRA2A PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query105
312379595 836 hypothetical protein AND_08500 [Anophele 0.695 0.087 0.756 9e-25
158286924 271 AGAP006733-PA [Anopheles gambiae str. PE 0.695 0.269 0.729 6e-24
170043665 290 RNA and export factor binding protein [C 0.771 0.279 0.682 7e-24
112983092 254 ALY [Bombyx mori] gi|95115188|gb|ABF5596 0.866 0.358 0.63 1e-23
91090428 234 PREDICTED: similar to RNA and export fac 0.790 0.354 0.638 1e-23
198455576 284 GA10707 [Drosophila pseudoobscura pseudo 0.695 0.257 0.717 2e-23
195158116 284 GL12678 [Drosophila persimilis] gi|19411 0.695 0.257 0.717 2e-23
21356157 266 RNA and export factor binding protein 1 0.847 0.334 0.627 2e-23
304441001 254 ALY [Bombyx mori] 0.866 0.358 0.62 4e-23
195109702 277 GI23076 [Drosophila mojavensis] gi|19391 0.8 0.303 0.647 4e-23
>gi|312379595|gb|EFR25817.1| hypothetical protein AND_08500 [Anopheles darlingi] Back     alignment and taxonomy information
 Score =  117 bits (293), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 56/74 (75%), Positives = 62/74 (83%), Gaps = 1/74 (1%)

Query: 2   IYELFSEFGPLKSAKLHYDRSGRSLGTADLIYERRSDAIKAMKQYNGVPLDGRPMQIQLA 61
           I ELF+EFGPLKSA +HYDRSGRSLGTAD+I+ER+SDAIKAMKQYNGVPLDGRPM IQLA
Sbjct: 704 INELFAEFGPLKSASVHYDRSGRSLGTADVIFERKSDAIKAMKQYNGVPLDGRPMSIQLA 763

Query: 62  ADVSVLENTVPRPV 75
               +     PRPV
Sbjct: 764 TS-EIPSARPPRPV 776




Source: Anopheles darlingi

Species: Anopheles darlingi

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|158286924|ref|XP_309011.3| AGAP006733-PA [Anopheles gambiae str. PEST] gi|157020700|gb|EAA04421.3| AGAP006733-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|170043665|ref|XP_001849498.1| RNA and export factor binding protein [Culex quinquefasciatus] gi|167867015|gb|EDS30398.1| RNA and export factor binding protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|112983092|ref|NP_001037596.1| ALY [Bombyx mori] gi|95115188|gb|ABF55960.1| ALY [Bombyx mori] Back     alignment and taxonomy information
>gi|91090428|ref|XP_971598.1| PREDICTED: similar to RNA and export factor binding protein [Tribolium castaneum] gi|270013379|gb|EFA09827.1| hypothetical protein TcasGA2_TC011974 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|198455576|ref|XP_001360055.2| GA10707 [Drosophila pseudoobscura pseudoobscura] gi|198133305|gb|EAL29208.2| GA10707 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|195158116|ref|XP_002019940.1| GL12678 [Drosophila persimilis] gi|194116531|gb|EDW38574.1| GL12678 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|21356157|ref|NP_651968.1| RNA and export factor binding protein 1 [Drosophila melanogaster] gi|5679350|gb|AAD46930.1|AF172637_1 LD24793p [Drosophila melanogaster] gi|7298863|gb|AAF54070.1| RNA and export factor binding protein 1 [Drosophila melanogaster] gi|220953584|gb|ACL89335.1| Aly-PA [synthetic construct] Back     alignment and taxonomy information
>gi|304441001|gb|ADM33940.1| ALY [Bombyx mori] Back     alignment and taxonomy information
>gi|195109702|ref|XP_001999422.1| GI23076 [Drosophila mojavensis] gi|193916016|gb|EDW14883.1| GI23076 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query105
FB|FBgn0010774266 Ref1 "RNA and export factor bi 0.666 0.263 0.718 1e-22
UNIPROTKB|E1C2L5258 THOC4 "Uncharacterized protein 0.561 0.228 0.779 1e-20
UNIPROTKB|Q3T0I4257 ALYREF "THO complex subunit 4" 0.561 0.229 0.779 1e-20
UNIPROTKB|F1PL92257 ALYREF "Uncharacterized protei 0.561 0.229 0.779 1e-20
UNIPROTKB|E9PB61264 ALYREF "THO complex subunit 4" 0.561 0.223 0.779 1e-20
UNIPROTKB|Q86V81257 ALYREF "THO complex subunit 4" 0.561 0.229 0.779 1e-20
MGI|MGI:1341044255 Alyref "Aly/REF export factor" 0.561 0.231 0.779 1e-20
ZFIN|ZDB-GENE-070928-29280 alyref "Aly/REF export factor" 0.561 0.210 0.779 1e-20
MGI|MGI:1913144218 Alyref2 "Aly/REF export factor 0.580 0.279 0.754 7.2e-20
RGD|1594679189 Thoc4 "THO complex 4" [Rattus 0.628 0.349 0.632 3.2e-17
FB|FBgn0010774 Ref1 "RNA and export factor binding protein 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 263 (97.6 bits), Expect = 1.0e-22, P = 1.0e-22
 Identities = 51/71 (71%), Positives = 63/71 (88%)

Query:     2 IYELFSEFGPLKSAKLHYDRSGRSLGTADLIYERRSDAIKAMKQYNGVPLDGRPMQIQLA 61
             I ELF++FGP+K A +HYDRSGRSLGTAD+I+ERR+DA+KA+KQY+GVPLDGRPM IQLA
Sbjct:   125 IKELFNDFGPIKKAAVHYDRSGRSLGTADVIFERRADALKAIKQYHGVPLDGRPMTIQLA 184

Query:    62 -ADVSVLENTV 71
              +DV+VL   V
Sbjct:   185 VSDVAVLTRPV 195




GO:0003713 "transcription coactivator activity" evidence=ISS
GO:0003729 "mRNA binding" evidence=ISS
GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0005654 "nucleoplasm" evidence=IDA
GO:0031965 "nuclear membrane" evidence=IDA
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
GO:0071011 "precatalytic spliceosome" evidence=IDA
UNIPROTKB|E1C2L5 THOC4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0I4 ALYREF "THO complex subunit 4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PL92 ALYREF "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E9PB61 ALYREF "THO complex subunit 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q86V81 ALYREF "THO complex subunit 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1341044 Alyref "Aly/REF export factor" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070928-29 alyref "Aly/REF export factor" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1913144 Alyref2 "Aly/REF export factor 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1594679 Thoc4 "THO complex 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q86V81THOC4_HUMANNo assigned EC number0.62650.76190.3112yesN/A
O08583THOC4_MOUSENo assigned EC number0.63850.76190.3137yesN/A
Q28FB9THOC4_XENTRNo assigned EC number0.57570.81900.3307yesN/A
Q3T0I4THOC4_BOVINNo assigned EC number0.63850.76190.3112yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 2e-37
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 1e-28
cd1268169 cd12681, RRM_SKAR, RNA recognition motif in S6K1 A 5e-16
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 3e-14
smart0036073 smart00360, RRM, RNA recognition motif 9e-14
pfam0007670 pfam00076, RRM_1, RNA recognition motif 9e-13
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 1e-11
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 7e-10
cd1226777 cd12267, RRM_YRA1_MLO3, RNA recognition motif in y 4e-09
pfam1389356 pfam13893, RRM_5, RNA recognition motif 5e-09
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 7e-09
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 8e-09
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 8e-09
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 3e-08
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 3e-08
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 3e-08
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 3e-08
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 5e-08
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 1e-07
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 2e-07
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 2e-07
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 3e-07
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 4e-07
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 4e-07
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 4e-07
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 4e-07
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 4e-07
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 5e-07
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 5e-07
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 8e-07
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 8e-07
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 9e-07
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 1e-06
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 1e-06
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 1e-06
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 3e-06
cd1266076 cd12660, RRM2_MYEF2, RNA recognition motif 2 in ve 3e-06
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 3e-06
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 3e-06
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 4e-06
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 6e-06
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 7e-06
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 8e-06
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 8e-06
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 1e-05
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 1e-05
cd1247891 cd12478, RRM1_U2B, RNA recognition motif 1 in U2 s 3e-05
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 4e-05
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 4e-05
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 4e-05
cd1265976 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in v 5e-05
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 6e-05
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 7e-05
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 1e-04
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 1e-04
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 1e-04
cd1227884 cd12278, RRM_eIF3B, RNA recognition motif in eukar 2e-04
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 2e-04
TIGR01661 352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 2e-04
cd1230493 cd12304, RRM_Set1, RNA recognition motif in the Se 2e-04
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 2e-04
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 2e-04
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 2e-04
TIGR01648 578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 2e-04
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 4e-04
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 4e-04
cd1249883 cd12498, RRM3_ACF, RNA recognition motif 3 in vert 4e-04
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 6e-04
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 6e-04
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 7e-04
cd1247789 cd12477, RRM1_U1A, RNA recognition motif 1 found i 0.001
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 0.001
cd1250675 cd12506, RRM3_hnRNPH_CRSF1_like, RNA recognition m 0.001
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 0.001
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 0.002
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 0.002
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 0.002
cd1249472 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v 0.002
cd1277384 cd12773, RRM2_HuR, RNA recognition motif 2 in vert 0.002
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 0.002
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 0.003
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 0.003
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 0.003
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 0.003
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 0.003
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 0.003
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 0.003
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 0.004
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 0.004
cd1233380 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 0.004
cd1247678 cd12476, RRM1_SNF, RNA recognition motif 1 found i 0.004
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 0.004
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
 Score =  120 bits (304), Expect = 2e-37
 Identities = 47/59 (79%), Positives = 55/59 (93%)

Query: 2  IYELFSEFGPLKSAKLHYDRSGRSLGTADLIYERRSDAIKAMKQYNGVPLDGRPMQIQL 60
          I ELF+EFG LK A +HYDRSGRSLGTAD+++ERR+DA+KAMKQYNGVPLDGRPM+IQL
Sbjct: 17 IKELFAEFGALKKAAVHYDRSGRSLGTADVVFERRADALKAMKQYNGVPLDGRPMKIQL 75


This subgroup corresponds to the RRM of THOC4, also termed transcriptional coactivator Aly/REF, or ally of AML-1 and LEF-1, or bZIP-enhancing factor BEF, an mRNA transporter protein with a well conserved RNA recognition motif (RRM), also termed RBD (RNA binding domain) or RNP (ribonucleoprotein domain). It is involved in RNA transportation from the nucleus. THOC4 was initially identified as a transcription coactivator of LEF-1 and AML-1 for the TCRalpha enhancer function. In addition, THOC4 specifically binds to rhesus (RH) promoter in erythroid. It might be a novel transcription cofactor for erythroid-specific genes. . Length = 75

>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|241125 cd12681, RRM_SKAR, RNA recognition motif in S6K1 Aly/REF-like target (SKAR) and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240713 cd12267, RRM_YRA1_MLO3, RNA recognition motif in yeast RNA annealing protein YRA1 (Yra1p), yeast mRNA export protein mlo3 and similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|241104 cd12660, RRM2_MYEF2, RNA recognition motif 2 in vertebrate myelin expression factor 2 (MEF-2) Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240922 cd12478, RRM1_U2B, RNA recognition motif 1 in U2 small nuclear ribonucleoprotein B" (U2B") and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|241103 cd12659, RRM2_hnRNPM, RNA recognition motif 2 in vertebrate heterogeneous nuclear ribonucleoprotein M (hnRNP M) Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240724 cd12278, RRM_eIF3B, RNA recognition motif in eukaryotic translation initiation factor 3 subunit B (eIF-3B) and similar proteins Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240750 cd12304, RRM_Set1, RNA recognition motif in the Set1-like family of histone-lysine N-methyltransferases Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|240942 cd12498, RRM3_ACF, RNA recognition motif 3 in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240921 cd12477, RRM1_U1A, RNA recognition motif 1 found in vertebrate U1 small nuclear ribonucleoprotein A (U1A) Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240950 cd12506, RRM3_hnRNPH_CRSF1_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein hnRNP H protein family, G-rich sequence factor 1 (GRSF-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240779 cd12333, RRM2_p54nrb_like, RNA recognition motif 2 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240920 cd12476, RRM1_SNF, RNA recognition motif 1 found in Drosophila melanogaster sex determination protein SNF and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 105
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.77
KOG4207|consensus 256 99.64
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.57
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.5
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.5
KOG0122|consensus270 99.48
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.41
smart0036170 RRM_1 RNA recognition motif. 99.4
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 99.4
KOG0148|consensus 321 99.37
KOG0145|consensus 360 99.36
KOG0107|consensus195 99.36
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.36
KOG0105|consensus 241 99.34
KOG0125|consensus 376 99.29
KOG0113|consensus 335 99.28
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.27
smart0036071 RRM RNA recognition motif. 99.25
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.25
KOG0130|consensus170 99.25
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.24
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.23
KOG0121|consensus153 99.21
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.21
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.19
KOG4212|consensus 608 99.19
PLN03120 260 nucleic acid binding protein; Provisional 99.17
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.17
KOG0144|consensus 510 99.17
smart0036272 RRM_2 RNA recognition motif. 99.15
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.15
KOG0117|consensus 506 99.14
KOG0146|consensus371 99.13
KOG0126|consensus219 99.12
KOG0149|consensus 247 99.1
KOG0144|consensus 510 99.1
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.07
KOG0148|consensus321 99.04
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.03
PLN03121 243 nucleic acid binding protein; Provisional 99.03
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.03
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.02
KOG0127|consensus 678 99.02
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.01
KOG0108|consensus 435 99.0
KOG0145|consensus360 99.0
KOG0146|consensus 371 98.99
KOG0111|consensus 298 98.98
KOG0124|consensus 544 98.97
PLN03213 759 repressor of silencing 3; Provisional 98.96
KOG0415|consensus 479 98.96
KOG0116|consensus419 98.94
KOG4661|consensus 940 98.93
COG0724306 RNA-binding proteins (RRM domain) [General functio 98.92
KOG0117|consensus 506 98.88
KOG0131|consensus203 98.86
KOG0123|consensus 369 98.83
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 98.83
KOG0123|consensus 369 98.82
KOG0109|consensus 346 98.79
KOG4208|consensus214 98.74
KOG0147|consensus 549 98.71
KOG0131|consensus203 98.69
KOG4206|consensus221 98.6
KOG0114|consensus124 98.6
KOG0124|consensus 544 98.59
KOG0127|consensus 678 98.55
KOG0109|consensus 346 98.55
KOG0533|consensus243 98.5
KOG0110|consensus725 98.5
KOG0110|consensus725 98.49
KOG0153|consensus377 98.43
KOG4209|consensus231 98.37
KOG0132|consensus 894 98.35
KOG0226|consensus290 98.26
KOG1190|consensus492 98.21
KOG2314|consensus 698 98.15
KOG0106|consensus 216 98.09
KOG0147|consensus 549 98.04
KOG4205|consensus 311 98.02
KOG4205|consensus311 97.95
KOG0120|consensus500 97.91
KOG1995|consensus 351 97.89
KOG4660|consensus 549 97.79
KOG4212|consensus608 97.61
KOG4454|consensus 267 97.59
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.59
KOG1548|consensus 382 97.51
KOG4211|consensus 510 97.5
KOG2202|consensus260 97.47
KOG0120|consensus500 97.39
KOG1457|consensus 284 97.37
KOG1548|consensus382 97.33
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 97.29
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 97.29
KOG0151|consensus 877 97.2
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.18
KOG4211|consensus 510 97.16
KOG1456|consensus494 97.15
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 97.1
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 97.1
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.07
KOG0106|consensus216 97.07
KOG1456|consensus 494 96.85
KOG4210|consensus285 96.83
KOG4307|consensus944 96.78
KOG1855|consensus 484 96.67
KOG1996|consensus378 96.21
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 95.87
KOG4849|consensus 498 95.77
KOG1190|consensus 492 95.7
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 95.51
KOG1365|consensus 508 95.42
KOG4206|consensus221 95.34
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 95.02
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 95.02
KOG4285|consensus350 94.78
KOG2068|consensus 327 94.59
KOG2135|consensus526 94.25
KOG0105|consensus241 93.93
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 93.93
PF15023166 DUF4523: Protein of unknown function (DUF4523) 93.9
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 91.7
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 91.51
KOG0112|consensus 975 91.13
KOG1457|consensus284 90.66
KOG3152|consensus278 90.23
KOG0128|consensus881 90.12
KOG4676|consensus 479 89.53
KOG0128|consensus881 87.83
KOG4574|consensus 1007 87.83
KOG1365|consensus 508 87.68
KOG0129|consensus520 87.03
KOG4660|consensus549 87.0
KOG4307|consensus 944 86.19
smart0059669 PRE_C2HC PRE_C2HC domain. 86.14
KOG2193|consensus 584 86.08
KOG2416|consensus 718 85.53
PF1551362 DUF4651: Domain of unknown function (DUF4651) 81.19
PF0753068 PRE_C2HC: Associated with zinc fingers; InterPro: 80.62
KOG0115|consensus 275 80.13
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
Probab=99.77  E-value=1.8e-17  Score=102.85  Aligned_cols=68  Identities=28%  Similarity=0.461  Sum_probs=62.7

Q ss_pred             CHHHHhccCCCeeEEEEEeCC-CCCcccEEEEEeCCHHHHHHHHHHhCCcccCCeeEEEEEeeccCCCC
Q psy1928           1 MIYELFSEFGPLKSAKLHYDR-SGRSLGTADLIYERRSDAIKAMKQYNGVPLDGRPMQIQLAADVSVLE   68 (105)
Q Consensus         1 ~l~~~f~~~G~i~~~~i~~~~-~~~~~g~~fv~f~~~~~a~~ai~~l~~~~i~~~~i~V~~~~~~~~~~   68 (105)
                      +|+++|++||.|.++.|+.++ ++++++||||+|.+.++|++||+.||+..|.++.|+|+++..++..+
T Consensus        50 ~L~~~F~~~G~I~~v~i~~d~~tg~~kGfaFV~F~~~e~A~~Al~~lng~~i~Gr~l~V~~a~~~~~~~  118 (144)
T PLN03134         50 SLRDAFAHFGDVVDAKVIVDRETGRSRGFGFVNFNDEGAATAAISEMDGKELNGRHIRVNPANDRPSAP  118 (144)
T ss_pred             HHHHHHhcCCCeEEEEEEecCCCCCcceEEEEEECCHHHHHHHHHHcCCCEECCEEEEEEeCCcCCCCC
Confidence            589999999999999999998 99999999999999999999999999999999999999988555443



>KOG4207|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>smart00596 PRE_C2HC PRE_C2HC domain Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>PF15513 DUF4651: Domain of unknown function (DUF4651) Back     alignment and domain information
>PF07530 PRE_C2HC: Associated with zinc fingers; InterPro: IPR006579 This domain is present in proteins found exclusively in the arthropods, including a number of Drosophila species, the silk moth and the gypsy moth Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
1no8_A106 Solution Structure Of The Nuclear Factor Aly Rbd Do 6e-23
2kt5_A124 Rrm Domain Of Mrna Export Adaptor Ref2-I Bound To H 5e-22
2yka_A124 Rrm Domain Of Mrna Export Adaptor Ref2-I Bound To H 5e-22
2f3j_A177 The Solution Structure Of The Ref2-I Mrna Export Fa 9e-22
3ulh_A107 Crystal Structure Of A Rna Binding Domain Of Tho Co 2e-21
2rra_A99 Solution Structure Of Rna Binding Domain In Human T 3e-05
2rrb_A96 Refinement Of Rna Binding Domain In Human Tra2 Beta 3e-05
2kxn_B129 Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit 4e-05
2cqc_A95 Solution Structure Of The Rna Recognition Motif In 6e-05
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 8e-05
2fy1_A116 A Dual Mode Of Rna Recognition By The Rbmy Protein 1e-04
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 2e-04
2do0_A114 Solution Structure Of The Rna Binding Domain Of Het 4e-04
1h6k_Z98 Nuclear Cap Binding Complex Length = 98 5e-04
>pdb|1NO8|A Chain A, Solution Structure Of The Nuclear Factor Aly Rbd Domain Length = 106 Back     alignment and structure

Iteration: 1

Score = 102 bits (254), Expect = 6e-23, Method: Compositional matrix adjust. Identities = 46/59 (77%), Positives = 53/59 (89%) Query: 2 IYELFSEFGPLKSAKLHYDRSGRSLGTADLIYERRSDAIKAMKQYNGVPLDGRPMQIQL 60 I ELF+EFG LK A +HYDRSGRSLGTAD+ +ER++DA+KAMKQYNGVPLDGRPM IQL Sbjct: 45 IQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQL 103
>pdb|2KT5|A Chain A, Rrm Domain Of Mrna Export Adaptor Ref2-I Bound To Hsv-1 Icp27 Peptide Length = 124 Back     alignment and structure
>pdb|2YKA|A Chain A, Rrm Domain Of Mrna Export Adaptor Ref2-I Bound To Hvs Orf57 Peptide Length = 124 Back     alignment and structure
>pdb|2F3J|A Chain A, The Solution Structure Of The Ref2-I Mrna Export Factor (Residues 1-155) Length = 177 Back     alignment and structure
>pdb|3ULH|A Chain A, Crystal Structure Of A Rna Binding Domain Of Tho Complex Subunit 4 Protein (Thoc4) From Homo Sapiens At 2.54 A Resolution Length = 107 Back     alignment and structure
>pdb|2RRA|A Chain A, Solution Structure Of Rna Binding Domain In Human Tra2 Beta Protein In Complex With Rna (Gaagaa) Length = 99 Back     alignment and structure
>pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 Back     alignment and structure
>pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 Back     alignment and structure
>pdb|2CQC|A Chain A, Solution Structure Of The Rna Recognition Motif In ArginineSERINE-Rich Splicing Factor 10 Length = 95 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|2FY1|A Chain A, A Dual Mode Of Rna Recognition By The Rbmy Protein Length = 116 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|2DO0|A Chain A, Solution Structure Of The Rna Binding Domain Of Heterogeneous Nuclear Ribonucleoprotein M Length = 114 Back     alignment and structure
>pdb|1H6K|Z Chain Z, Nuclear Cap Binding Complex Length = 98 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query105
2kt5_A124 RNA and export factor-binding protein 2; chaperone 7e-26
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 1e-25
2f3j_A177 RNA and export factor binding protein 2; RRM domai 1e-23
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 8e-20
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-14
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-11
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 6e-14
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 2e-13
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 3e-13
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 3e-13
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 3e-09
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 3e-13
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 1e-10
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 3e-13
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 1e-09
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 4e-13
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 4e-13
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 1e-05
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 5e-13
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 6e-13
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 8e-13
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 9e-13
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 2e-12
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-12
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 7e-06
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 2e-12
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 4e-12
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 4e-12
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 5e-12
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 8e-12
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 8e-12
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 8e-12
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 9e-12
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 1e-11
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 1e-11
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 1e-11
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 4e-11
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 8e-08
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 2e-11
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 2e-11
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 2e-11
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 2e-11
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 3e-11
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 3e-11
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 3e-11
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 3e-11
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 3e-11
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 4e-11
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 4e-11
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 4e-11
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 4e-11
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 9e-11
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-09
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 9e-11
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 1e-05
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-10
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 1e-10
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 2e-10
1x5o_A114 RNA binding motif, single-stranded interacting pro 2e-10
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 3e-10
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 7e-04
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 3e-10
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 4e-10
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 4e-10
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 5e-10
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 5e-10
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 7e-10
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 7e-10
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 4e-07
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 8e-10
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 8e-10
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 1e-09
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 1e-09
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 2e-09
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 2e-09
2krb_A81 Eukaryotic translation initiation factor 3 subunit 2e-09
2la6_A99 RNA-binding protein FUS; structural genomics, nort 2e-09
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 3e-09
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 3e-09
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 4e-09
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 5e-09
2cph_A107 RNA binding motif protein 19; RNA recognition moti 5e-09
3q2s_C229 Cleavage and polyadenylation specificity factor S; 5e-09
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 5e-09
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 3e-07
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 6e-09
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 6e-09
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-08
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 8e-07
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 1e-08
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 1e-08
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 2e-08
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 2e-08
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 3e-08
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 5e-08
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-05
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 5e-08
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 7e-08
1x4e_A85 RNA binding motif, single-stranded interacting pro 7e-08
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 9e-08
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 1e-07
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 1e-07
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 2e-07
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 2e-07
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 2e-07
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 4e-06
2div_A99 TRNA selenocysteine associated protein; structural 2e-07
3p5t_L90 Cleavage and polyadenylation specificity factor S; 3e-07
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 3e-07
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 3e-07
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 4e-07
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 4e-07
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 4e-07
3n9u_C156 Cleavage and polyadenylation specificity factor S; 4e-07
2cpj_A99 Non-POU domain-containing octamer-binding protein; 5e-07
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 6e-07
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 7e-07
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 9e-07
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 9e-07
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 1e-06
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 1e-06
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 2e-06
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 2e-06
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 3e-06
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 3e-06
1x5p_A97 Negative elongation factor E; structure genomics, 3e-06
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 3e-06
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 3e-06
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 4e-06
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 5e-06
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 5e-06
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 5e-06
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 8e-06
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 8e-06
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 8e-06
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 9e-06
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 9e-06
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 1e-05
2cqd_A116 RNA-binding region containing protein 1; RNA recog 2e-05
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 3e-05
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 5e-05
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 6e-05
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 3e-04
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 7e-05
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 1e-04
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 1e-04
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 1e-04
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 1e-04
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 1e-04
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 2e-04
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 2e-04
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 2e-04
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 2e-04
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 3e-04
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 3e-04
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 3e-04
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 3e-04
2i2y_A150 Fusion protein consists of immunoglobin G- binding 4e-04
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 5e-04
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
 Score = 92.1 bits (229), Expect = 7e-26
 Identities = 46/63 (73%), Positives = 52/63 (82%)

Query: 1   MIYELFSEFGPLKSAKLHYDRSGRSLGTADLIYERRSDAIKAMKQYNGVPLDGRPMQIQL 60
            I ELF+EFG LK A + YDRSGRSLGTAD+ +ERR+DA+KAMKQY GVPLDGRPM IQL
Sbjct: 51  DIQELFAEFGTLKKAAVDYDRSGRSLGTADVHFERRADALKAMKQYKGVPLDGRPMDIQL 110

Query: 61  AAD 63
            A 
Sbjct: 111 VAS 113


>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query105
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.74
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.71
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.68
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.66
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.66
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.65
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.65
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.65
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.65
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.65
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.64
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.64
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.64
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.63
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.63
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.63
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.63
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.63
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.63
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.63
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.62
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.62
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.62
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.62
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.61
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.61
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.61
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.61
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.6
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.6
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.6
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.6
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.6
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.6
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.6
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.59
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.59
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.59
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.59
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.59
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.59
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.59
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.59
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.58
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.58
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.58
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.58
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.58
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.58
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.57
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.57
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.57
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.57
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.56
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.56
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.56
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.56
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.56
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.56
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.56
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.56
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.56
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.56
2div_A99 TRNA selenocysteine associated protein; structural 99.56
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.55
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.55
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.55
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.55
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.54
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.54
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.54
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.54
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.54
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.54
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.53
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.53
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.53
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.53
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.52
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.52
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.52
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.52
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.52
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.51
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.51
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.51
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.51
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.51
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.5
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.5
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.25
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.5
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.5
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.49
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.49
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.49
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.48
1x5p_A97 Negative elongation factor E; structure genomics, 99.48
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.48
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.48
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.48
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.48
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.47
2dis_A109 Unnamed protein product; structural genomics, RRM 99.47
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.47
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.47
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.47
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.47
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.47
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.47
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.46
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.46
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.46
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.45
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.45
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.45
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.45
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.45
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.44
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.44
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.44
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.44
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.44
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.44
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.43
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.43
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.43
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.43
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.42
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.42
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.42
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.42
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.41
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.41
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.41
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.4
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.4
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.4
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.4
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.4
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.4
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.39
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.39
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.39
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.39
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.39
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.39
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.38
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.38
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.38
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.38
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.38
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.38
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.38
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.37
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.37
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.37
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.37
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.37
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.37
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.36
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.36
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.36
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.35
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.35
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.35
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.35
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.35
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.34
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.34
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.34
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.34
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.34
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.32
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.32
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.3
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.3
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.29
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.28
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.28
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.28
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.27
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.26
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.24
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.23
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.18
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.18
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.17
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.16
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.15
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.13
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.12
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.11
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 99.11
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.11
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.09
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.08
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.08
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.04
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.03
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.03
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 99.0
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 98.89
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 98.88
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 98.86
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 98.82
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 98.79
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 98.55
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 97.69
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.17
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 96.94
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 96.59
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 96.17
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 96.0
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 95.9
2i2y_A150 Fusion protein consists of immunoglobin G- binding 95.76
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 89.2
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 89.18
2g0c_A76 ATP-dependent RNA helicase DBPA; RNA recognition m 83.16
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 80.32
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
Probab=99.74  E-value=1.1e-17  Score=103.65  Aligned_cols=65  Identities=34%  Similarity=0.468  Sum_probs=60.9

Q ss_pred             CHHHHhccCCCeeEEEEEeCC-CCCcccEEEEEeCCHHHHHHHHHHhCCcccCCeeEEEEEeeccC
Q psy1928           1 MIYELFSEFGPLKSAKLHYDR-SGRSLGTADLIYERRSDAIKAMKQYNGVPLDGRPMQIQLAADVS   65 (105)
Q Consensus         1 ~l~~~f~~~G~i~~~~i~~~~-~~~~~g~~fv~f~~~~~a~~ai~~l~~~~i~~~~i~V~~~~~~~   65 (105)
                      +|+++|++||.|..|.|+.++ ++.+++||||+|.+.++|++||+.||+..|.++.|+|+++....
T Consensus        55 ~l~~~F~~~G~i~~v~i~~~~~~~~~~g~afV~f~~~~~A~~Ai~~l~g~~~~g~~l~V~~a~~~~  120 (156)
T 1h2v_Z           55 QIYELFSKSGDIKKIIMGLDKMKKTACGFCFVEYYSRADAENAMRYINGTRLDDRIIRTDWDAGFK  120 (156)
T ss_dssp             HHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHHHHTTTSEETTEECEEEEESCCC
T ss_pred             HHHHHHHhcCCeEEEEEEecCCCCccceEEEEEECCHHHHHHHHHHhCCCEECCeEEEEEECCCCC
Confidence            488999999999999999998 89999999999999999999999999999999999999998443



>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2g0c_A ATP-dependent RNA helicase DBPA; RNA recognition motif, hydrolase; 1.70A {Bacillus subtilis} PDB: 3moj_B Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 105
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 2e-13
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 4e-12
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 9e-12
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 1e-10
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 2e-10
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 4e-10
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 6e-10
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 9e-10
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 1e-09
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 2e-09
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 4e-09
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 7e-09
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 7e-09
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 9e-09
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 9e-09
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 1e-08
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 1e-08
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 2e-08
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-08
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 2e-08
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 3e-08
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 3e-08
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 4e-08
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 5e-08
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 6e-08
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 6e-08
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 3e-07
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 5e-07
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 7e-07
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 1e-06
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 1e-06
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 2e-06
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 2e-06
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 2e-06
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 2e-06
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 2e-06
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 3e-06
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 3e-06
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 3e-06
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 9e-06
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 1e-05
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 1e-05
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 3e-05
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 3e-05
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 4e-05
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 4e-05
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 5e-05
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 8e-05
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 8e-05
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-04
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 2e-04
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 3e-04
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 4e-04
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 4e-04
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 4e-04
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 8e-04
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 0.001
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 0.001
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear factor Aly
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 58.0 bits (140), Expect = 2e-13
 Identities = 46/61 (75%), Positives = 53/61 (86%)

Query: 1  MIYELFSEFGPLKSAKLHYDRSGRSLGTADLIYERRSDAIKAMKQYNGVPLDGRPMQIQL 60
           I ELF+EFG LK A +HYDRSGRSLGTAD+ +ER++DA+KAMKQYNGVPLDGRPM IQL
Sbjct: 16 DIQELFAEFGTLKKAAVHYDRSGRSLGTADVHFERKADALKAMKQYNGVPLDGRPMNIQL 75

Query: 61 A 61
           
Sbjct: 76 V 76


>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query105
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.71
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.7
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.69
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.68
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.68
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.68
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.68
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.67
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.67
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.67
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.67
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.67
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.65
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.64
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.64
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.63
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.63
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.62
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.62
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.61
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.61
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.61
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.61
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.61
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.6
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.6
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.6
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.59
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.59
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.58
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.58
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.57
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.56
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.56
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.55
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.55
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.54
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.54
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.54
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.53
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.53
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.52
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.52
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.51
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.51
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.51
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.51
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.51
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.5
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.48
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.48
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.47
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.47
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.46
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.45
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.45
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.45
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.44
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.44
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.44
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.43
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.41
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.4
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.4
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.39
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.39
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.38
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.37
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.37
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.36
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.36
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.35
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.35
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.35
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.34
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.34
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.32
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.32
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.31
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.31
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.28
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.24
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.1
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.03
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.03
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.01
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.83
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.83
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.49
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 92.69
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Probable RNA-binding protein 19, Rbm19
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.71  E-value=2.2e-17  Score=94.20  Aligned_cols=67  Identities=22%  Similarity=0.332  Sum_probs=61.7

Q ss_pred             CHHHHhccCCCeeEEEEEeCC-CCCcccEEEEEeCCHHHHHHHHHHhCCcccCCeeEEEEEeeccCCC
Q psy1928           1 MIYELFSEFGPLKSAKLHYDR-SGRSLGTADLIYERRSDAIKAMKQYNGVPLDGRPMQIQLAADVSVL   67 (105)
Q Consensus         1 ~l~~~f~~~G~i~~~~i~~~~-~~~~~g~~fv~f~~~~~a~~ai~~l~~~~i~~~~i~V~~~~~~~~~   67 (105)
                      +|+++|++||.|..+.|+.++ ++.+++||||+|.+.++|++||+.||+..+.++.|+|+++..+...
T Consensus        24 ~l~~~F~~~g~v~~v~i~~d~~tg~~~g~afV~f~~~~~a~~A~~~l~g~~~~gr~i~V~~a~~~~~~   91 (99)
T d1whwa_          24 DLEKLFSAYGPLSELHYPIDSLTKKPKGFAFVTFMFPEHAVKAYAEVDGQVFQGRMLHVLPSTIKKEA   91 (99)
T ss_dssp             HHHHHHHTTSCEEEEECCCCTTTCCCCSEEEEEESSHHHHHHHHHHTTTEESSSCEEEEEECCCCSTT
T ss_pred             HHHHHHHhcCCceeeeecccccccccCcceEEEECCHHHHHHHHHHcCCCEECCEEEEEEECCCCCcc
Confidence            588999999999999999988 8999999999999999999999999999999999999998855433



>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure