Psyllid ID: psy1937

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------
QEDGYSVKHVAYARYLRNHRLINEIFSDSVVPDVRSVVTTNRMQVLKRQVQSLTMHQHCQRVSRRGNVSQKMLTAKTDGRGPKAPKPPEKPLMPYMRYSRKVWDQVKAQNLDLKLWEIGKIIGQMWRDLPEDQKTEYVEDYEQEKNLKASTKLASISRPTWRAKAKASKPKQLRKSREARPKDSGEKMQIGRIDIQPAEDEDEQEDGYSVKHVAYARYLRNHRLINEIFSDSVVPDVRSVVTTNRMQVLKRQVQSLTMHQKKLEAELQQIEEKFEAKKRKFVESSEQFQEELKKEKASCSENEPYLF
cccccccHHHHHHHHHHcHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHcccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
ccccccHHHHHHHHHHHHHHHHHHHHccccccccccEccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEccccccccccccHHHHHHHHHHHHcHHHHHHHccccccccccEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc
QEDGYSVKHVAYARYLRNHRLINeifsdsvvpdvrsVVTTNRMQVLKRQVQSLTMHqhcqrvsrrgnvsQKMLtaktdgrgpkapkppekplmpymrysRKVWDQVKAQNLDLKLWEIGKIIGQMWrdlpedqktEYVEDYEQEKNLKAStklasisrptwrakakaskpkqlrksrearpkdsgekmqigridiqpaededeqedgysvkHVAYARYLRNHRLINeifsdsvvpdvrsVVTTNRMQVLKRQVQSLTMHQKKLEAELQQIEEKFEAKKRKFVESSEQFQEELKKEkascsenepylf
qedgysvkHVAYARYLRNHRLINeifsdsvvpdvrSVVTTNRMQVLKRQVqsltmhqhcqrvsrrgnvsqkmltaktdgrgpkapkppekplmpYMRYSRKVWDQVKAQNLDLKLWEIGKIIGQMWRDLPEDQKTEYVEDYeqeknlkastklasisrptwrakakaskpkqlrksrearpkdsgekmqigridiqpaededeqedgYSVKHVAYARYLRNHRLINeifsdsvvpdvrSVVTTNRMQVLKRQVQSLTMHQKKLEAELQQIEEKFEAKKRKFVESSEQFQeelkkekascsenepylf
QEDGYSVKHVAYARYLRNHRLINEIFsdsvvpdvrsvvTTNRMQVLKRQVQSLTMHQHCQRVSRRGNVSQKMLTAKTDGRGPKAPKPPEKPLMPYMRYSRKVWDQVKAQNLDLKLWEIGKIIGQMWRDLPEDQKTEYVEDYEQEKNLKASTKLASISRPTWRAKAKASKPKQLRKSREARPKDSGEKMQIGRIDIQPAEDEDEQEDGYSVKHVAYARYLRNHRLINEIFsdsvvpdvrsvvTTNRMQVLKRQVQSLTMHQKKLEAELQQIEEKFEAKKRKFVESSEQFQEELKKEKASCSENEPYLF
*****SVKHVAYARYLRNHRLINEIFSDSVVPDVRSVVTTNRMQVLKRQVQSLT****************************************YMRYSRKVWDQVKAQNLDLKLWEIGKIIGQMWRDL******************************************************************************YSVKHVAYARYLRNHRLINEIFSDSVVPDVRSVVTTNRMQVLKR********************************************************
*****SV*HVAYARYLRNHRLINEIF*****************************************************************LMPYMRYSRKVWDQVKAQNLDLKLWEIGKIIGQMWRDLPEDQKTEYVEDYEQEKNLKASTKLA******************************************************************************************************************************************KK**ASCS***PYLF
QEDGYSVKHVAYARYLRNHRLINEIFSDSVVPDVRSVVTTNRMQVLKRQ*********************KMLTAK**********PPEKPLMPYMRYSRKVWDQVKAQNLDLKLWEIGKIIGQMWRDLPEDQKTEYVEDYEQEKNLKASTKLASISR*****************************MQIGRIDIQPA*********YSVKHVAYARYLRNHRLINEIFSDSVVPDVRSVVTTNRMQVLKRQVQSLTMHQKKLEAELQQIEEKFEAKKRK***************************
***GYSVKHVAYARYLRNHRLINEIFSDSVVPDVRSVVTTNRMQVLKRQVQSLTMHQHCQRVSR********************PKPPEKPLMPYMRYSRKVWDQVKAQNLDLKLWEIGKIIGQMWRDLPEDQKTEYVEDYEQEKNLKASTKLASISRPTWRAKAKASKPKQ*******************RIDIQPAEDEDEQEDGYSVKHVAYARYLRNHRLINEIFSDSVVPDVRSVVTTNRMQVLKRQVQSLTMHQKKLEAELQQIEEKFEAKKRKFVESSEQFQEELKKEKA**********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
QEDGYSVKHVAYARYLRNHRLINEIFSDSVVPDVRSVVTTNRMQVLKRQVQSLTMHQHCQRVSRRGNVSQKMLTAKTDGRGPKAPKPPEKPLMPYMRYSRKVWDQVKAQNLDLKLWEIGKIIGQMWRDLPEDQKTEYVEDYEQEKNLKASTKLASISRPTWRAKAKASKPKQLRKSREARPKDSGEKMQIGRIDIQPAEDEDEQEDGYSVKHVAYARYLRNHRLINEIFSDSVVPDVRSVVTTNRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxFQEELKKEKASCSENEPYLF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query307 2.2.26 [Sep-21-2011]
O54941 411 SWI/SNF-related matrix-as yes N/A 0.654 0.489 0.595 7e-61
Q969G3 411 SWI/SNF-related matrix-as yes N/A 0.654 0.489 0.595 1e-60
Q56A18 376 SWI/SNF-related matrix-as yes N/A 0.654 0.534 0.595 1e-60
P33417597 Intrastrand cross-link re yes N/A 0.179 0.092 0.4 3e-05
Q6CVH393 Non-histone chromosomal p yes N/A 0.247 0.817 0.337 6e-05
Q6AZF8345 High mobility group prote N/A N/A 0.302 0.269 0.278 0.0001
Q02486183 ARS-binding factor 2, mit no N/A 0.179 0.300 0.368 0.0002
P40630243 Transcription factor A, m no N/A 0.185 0.234 0.385 0.0003
Q75B8294 Non-histone chromosomal p no N/A 0.228 0.744 0.298 0.0003
Q91ZW1244 Transcription factor A, m no N/A 0.185 0.233 0.385 0.0004
>sp|O54941|SMCE1_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Mus musculus GN=Smarce1 PE=1 SV=1 Back     alignment and function desciption
 Score =  234 bits (597), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 122/205 (59%), Positives = 151/205 (73%), Gaps = 4/205 (1%)

Query: 92  LMPYMRYSRKVWDQVKAQNLDLKLWEIGKIIGQMWRDLPEDQKTEYVEDYEQEKNLKAST 151
           LMPYMRYSRKVWDQVKA N DLKLWEIGKIIG MWRDL +++K EY+ +YE EK     +
Sbjct: 70  LMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYEAEKIEYNES 129

Query: 152 KLASISRPTWRAKAKASKPKQLRKSREARPKDSGEKMQIGR--IDIQPAEDEDEQEDGYS 209
             A  + P + A   A    +     E+R + S  +M+ G   + IQPAED D+ +DG+S
Sbjct: 130 MKAYHNSPAYLAYINAKSRAEAALEEESRQRQS--RMEKGEPYMSIQPAEDPDDYDDGFS 187

Query: 210 VKHVAYARYLRNHRLINEIFSDSVVPDVRSVVTTNRMQVLKRQVQSLTMHQKKLEAELQQ 269
           +KH A AR+ RNHRLI+EI S+SVVPDVRSVVTT RMQVLKRQVQSL +HQ+KLEAEL Q
Sbjct: 188 MKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQ 247

Query: 270 IEEKFEAKKRKFVESSEQFQEELKK 294
           IEE+ + KKRKF+ES++ F  ELK+
Sbjct: 248 IEERHQEKKRKFLESTDSFNNELKR 272
Involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). Required for the coactivation of estrogen responsive promoters by Swi/Snf complexes and the SRC/p160 family of histone acetyltransferases (HATs). Also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene (By similarity). Belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The transition from proliferating neural stem/progenitor cells to post-mitotic neurons requires a switch in subunit composition of the npBAF and nBAF complexes. As neural progenitors exit mitosis and differentiate into neurons, npBAF complexes which contain ACTL6A/BAF53A and PHF10/BAF45A, are exchanged for homologous alternative ACTL6B/BAF53B and DPF1/BAF45B or DPF3/BAF45C subunits in neuron-specific complexes (nBAF). The npBAF complex is essential for the self-renewal/proliferative capacity of the multipotent neural stem cells. The nBAF complex along with CREST plays a role regulating the activity of genes essential for dendrite growth.
Mus musculus (taxid: 10090)
>sp|Q969G3|SMCE1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Homo sapiens GN=SMARCE1 PE=1 SV=2 Back     alignment and function description
>sp|Q56A18|SMCE1_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Rattus norvegicus GN=Smarce1 PE=1 SV=1 Back     alignment and function description
>sp|P33417|IXR1_YEAST Intrastrand cross-link recognition protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IXR1 PE=1 SV=2 Back     alignment and function description
>sp|Q6CVH3|NHP6_KLULA Non-histone chromosomal protein 6 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NHP6 PE=3 SV=1 Back     alignment and function description
>sp|Q6AZF8|HM20A_XENLA High mobility group protein 20A OS=Xenopus laevis GN=hmg20a PE=2 SV=1 Back     alignment and function description
>sp|Q02486|ABF2_YEAST ARS-binding factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ABF2 PE=1 SV=1 Back     alignment and function description
>sp|P40630|TFAM_MOUSE Transcription factor A, mitochondrial OS=Mus musculus GN=Tfam PE=1 SV=2 Back     alignment and function description
>sp|Q75B82|NHP6_ASHGO Non-histone chromosomal protein 6 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NHP6 PE=3 SV=1 Back     alignment and function description
>sp|Q91ZW1|TFAM_RAT Transcription factor A, mitochondrial OS=Rattus norvegicus GN=Tfam PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query307
307187667 741 SWI/SNF-related matrix-associated actin- 0.657 0.272 0.694 3e-72
328780490 718 PREDICTED: hypothetical protein LOC41207 0.657 0.281 0.694 3e-72
157127700 689 hypothetical protein AaeL_AAEL010903 [Ae 0.703 0.313 0.641 4e-72
340710108 747 PREDICTED: hypothetical protein LOC10065 0.657 0.270 0.694 4e-72
380014712 716 PREDICTED: uncharacterized protein LOC10 0.657 0.282 0.694 4e-72
383862615 767 PREDICTED: uncharacterized protein LOC10 0.657 0.263 0.694 5e-72
332026217 756 SWI/SNF-related matrix-associated actin- 0.657 0.267 0.694 6e-72
350413525 753 PREDICTED: hypothetical protein LOC10074 0.657 0.268 0.694 6e-72
307195541 777 SWI/SNF-related matrix-associated actin- 0.657 0.259 0.694 2e-71
170042638 694 dalao [Culex quinquefasciatus] gi|167866 0.716 0.317 0.629 4e-70
>gi|307187667|gb|EFN72639.1| SWI/SNF-related matrix-associated actin-dependent regulator chromatin subfamily E member 1 [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  278 bits (710), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 171/216 (79%), Gaps = 14/216 (6%)

Query: 92  LMPYMRYSRKVWDQVKAQNLDLKLWEIGKIIGQMWRDLPEDQKTEYVEDYEQEK-----N 146
           LMPYMRYSRKVWDQVKAQN +LKLWEIGKIIGQMWRDLPE+ KTE++E+YE EK     +
Sbjct: 80  LMPYMRYSRKVWDQVKAQNPELKLWEIGKIIGQMWRDLPEEDKTEFIEEYEAEKVEYEKS 139

Query: 147 LK----ASTKLASISRPTWRAKAKASKPKQLRKSREARPKDSG----EKMQIGRIDIQPA 198
           LK    +   LA I+    R K+     +Q    RE+  + SG    +  Q  RIDI PA
Sbjct: 140 LKTYHNSPAYLAYIAA-KNRGKSALCAAQQSNDDRESHERSSGSSKSQAAQDRRIDILPA 198

Query: 199 EDEDEQEDGYSVKHVAYARYLRNHRLINEIFSDSVVPDVRSVVTTNRMQVLKRQVQSLTM 258
           ED+D+Q+DGYSVKHVAY+RY RNHRLINEIFSD+VVPDVRSVVTT RMQVL+RQVQSLTM
Sbjct: 199 EDDDDQDDGYSVKHVAYSRYTRNHRLINEIFSDTVVPDVRSVVTTQRMQVLRRQVQSLTM 258

Query: 259 HQKKLEAELQQIEEKFEAKKRKFVESSEQFQEELKK 294
           HQKKLEAELQQIEEKFEAKKRKF+E+SE FQEELKK
Sbjct: 259 HQKKLEAELQQIEEKFEAKKRKFIETSEIFQEELKK 294

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328780490|ref|XP_395543.4| PREDICTED: hypothetical protein LOC412077 [Apis mellifera] Back     alignment and taxonomy information
>gi|157127700|ref|XP_001661139.1| hypothetical protein AaeL_AAEL010903 [Aedes aegypti] gi|108872838|gb|EAT37063.1| AAEL010903-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|340710108|ref|XP_003393638.1| PREDICTED: hypothetical protein LOC100651274 [Bombus terrestris] Back     alignment and taxonomy information
>gi|380014712|ref|XP_003691364.1| PREDICTED: uncharacterized protein LOC100865252 [Apis florea] Back     alignment and taxonomy information
>gi|383862615|ref|XP_003706779.1| PREDICTED: uncharacterized protein LOC100879979 [Megachile rotundata] Back     alignment and taxonomy information
>gi|332026217|gb|EGI66359.1| SWI/SNF-related matrix-associated actin-dependent regulator chromatin subfamily E member 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|350413525|ref|XP_003490017.1| PREDICTED: hypothetical protein LOC100744180 [Bombus impatiens] Back     alignment and taxonomy information
>gi|307195541|gb|EFN77427.1| SWI/SNF-related matrix-associated actin-dependent regulator chromatin subfamily E member 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|170042638|ref|XP_001849025.1| dalao [Culex quinquefasciatus] gi|167866152|gb|EDS29535.1| dalao [Culex quinquefasciatus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query307
FB|FBgn0030093 749 dalao "dalao" [Drosophila mela 0.745 0.305 0.566 9.7e-64
UNIPROTKB|F1NCC9 412 SMARCE1 "Uncharacterized prote 0.739 0.550 0.534 1.4e-57
UNIPROTKB|A5PKF6 415 SMARCE1 "SMARCE1 protein" [Bos 0.739 0.546 0.530 2.8e-57
UNIPROTKB|E2QX86 393 SMARCE1 "Uncharacterized prote 0.739 0.577 0.530 2.8e-57
MGI|MGI:1927347 411 Smarce1 "SWI/SNF related, matr 0.739 0.552 0.530 2.8e-57
UNIPROTKB|B4DGM3 393 SMARCE1 "cDNA FLJ55202, highly 0.739 0.577 0.530 2.8e-57
UNIPROTKB|Q969G3 411 SMARCE1 "SWI/SNF-related matri 0.739 0.552 0.530 2.8e-57
RGD|1304726 376 Smarce1 "SWI/SNF related, matr 0.687 0.561 0.553 4.6e-57
UNIPROTKB|B4DFR4 341 SMARCE1 "Smarce1 variant 5" [H 0.651 0.586 0.539 3.1e-51
WB|WBGene00022182 338 swsn-3 [Caenorhabditis elegans 0.661 0.600 0.384 1.9e-35
FB|FBgn0030093 dalao "dalao" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 650 (233.9 bits), Expect = 9.7e-64, P = 9.7e-64
 Identities = 132/233 (56%), Positives = 165/233 (70%)

Query:    76 KTDGRGPKAPKPPEKPLMPYMRYSRKVWDQVKAQNLDLKLWEIGKIIGQMWRDLPEDQKT 135
             + + R PK PKPPEKP++PYMRYS++VWD VKA++ +LKLWE+GK IG MW+ LPED+KT
Sbjct:    77 QNESRLPKPPKPPEKPILPYMRYSKRVWDSVKAKHPELKLWELGKKIGAMWKLLPEDEKT 136

Query:   136 EYVEDYEQEKNLKASTKLASISR-PTWRAKAKA-SKPKQLRKSREARPKDSGEKMQIGR- 192
             E++++YE EK L+    L +  + P ++A   A SK K      E   +  G K Q  R 
Sbjct:   137 EFIDEYEAEK-LEYEKSLKAYHQTPAYQAYMSAKSKVKTDVDMHETPSRGGGSKSQHERR 195

Query:   193 IDIQPAEDEDEQEDGYSVKHVAYARYLRNHRLINEIFXXXXXXXXXXXXTTNRMQVLKRQ 252
             IDIQPAEDED+Q++GY+ KH+AYARYL NHRLINEIF            TT RMQVLKRQ
Sbjct:   196 IDIQPAEDEDDQDEGYTTKHLAYARYLHNHRLINEIFSEAVVPDVRSVVTTTRMQVLKRQ 255

Query:   253 VQSLTMHQKKLEAELQQIEEKFEAKKRKFVESSEQFQEELKKEKASCSENEPY 305
             V SLTMHQ KLEAELQQ+EEKFEAKK++ VESSE FQEELK+      + E +
Sbjct:   256 VSSLTMHQTKLEAELQQMEEKFEAKKQRMVESSEAFQEELKRHCKPAVDEETF 308
GO:0003713 "transcription coactivator activity" evidence=IC
GO:0045893 "positive regulation of transcription, DNA-dependent" evidence=IDA
GO:0035060 "brahma complex" evidence=NAS;IDA;IPI
GO:0005515 "protein binding" evidence=IPI
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=IDA
GO:0006338 "chromatin remodeling" evidence=IGI;IPI
UNIPROTKB|F1NCC9 SMARCE1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A5PKF6 SMARCE1 "SMARCE1 protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QX86 SMARCE1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1927347 Smarce1 "SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|B4DGM3 SMARCE1 "cDNA FLJ55202, highly similar to SWI/SNF-related matrix-associatedactin-dependent regulator of chromatin subfamily E member 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q969G3 SMARCE1 "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1304726 Smarce1 "SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|B4DFR4 SMARCE1 "Smarce1 variant 5" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00022182 swsn-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O54941SMCE1_MOUSENo assigned EC number0.59510.65470.4890yesN/A
Q969G3SMCE1_HUMANNo assigned EC number0.59510.65470.4890yesN/A
Q56A18SMCE1_RATNo assigned EC number0.59510.65470.5345yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query307
cd0139066 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class 4e-13
cd0008466 cd00084, HMG-box, High Mobility Group (HMG)-box is 2e-12
pfam0050569 pfam00505, HMG_box, HMG (high mobility group) box 9e-10
smart0039870 smart00398, HMG, high mobility group 2e-07
COG5648211 COG5648, NHP6B, Chromatin-associated proteins cont 1e-05
cd0138977 cd01389, MATA_HMG-box, MATA_HMG-box, class I membe 6e-04
>gnl|CDD|238686 cd01390, HMGB-UBF_HMG-box, HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information 
 Score = 63.0 bits (154), Expect = 4e-13
 Identities = 20/58 (34%), Positives = 39/58 (67%)

Query: 88  PEKPLMPYMRYSRKVWDQVKAQNLDLKLWEIGKIIGQMWRDLPEDQKTEYVEDYEQEK 145
           P++PL  Y  +S++   ++K +N D  + E+ KI+G+ W++L E++K +Y E  E++K
Sbjct: 1   PKRPLSAYFLFSQEQRPKLKKENPDASVTEVTKILGEKWKELSEEEKKKYEEKAEKDK 58

These proteins bind the minor groove of DNA in a non-sequence specific fashion and contain two or more tandem HMG boxes. Class II members include non-histone chromosomal proteins, HMG1 and HMG2, which bind to bent or distorted DNA such as four-way DNA junctions, synthetic DNA cruciforms, kinked cisplatin-modified DNA, DNA bulges, cross-overs in supercoiled DNA, and can cause looping of linear DNA. Class III members include nucleolar and mitochondrial transcription factors, UBF and mtTF1, which bind four-way DNA junctions. Length = 66
>gnl|CDD|238037 cd00084, HMG-box, High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information
>gnl|CDD|189580 pfam00505, HMG_box, HMG (high mobility group) box Back     alignment and domain information
>gnl|CDD|197700 smart00398, HMG, high mobility group Back     alignment and domain information
>gnl|CDD|227935 COG5648, NHP6B, Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>gnl|CDD|238685 cd01389, MATA_HMG-box, MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 307
KOG4715|consensus 410 100.0
PTZ0019994 high mobility group protein; Provisional 99.81
cd0138977 MATA_HMG-box MATA_HMG-box, class I member of the H 99.72
KOG4715|consensus410 99.68
cd0138872 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of 99.67
PF0050569 HMG_box: HMG (high mobility group) box; InterPro: 99.64
cd0139066 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and II 99.63
smart0039870 HMG high mobility group. 99.62
COG5648211 NHP6B Chromatin-associated proteins containing the 99.61
KOG0527|consensus331 99.58
cd0008466 HMG-box High Mobility Group (HMG)-box is found in 99.54
PF0901173 HMG_box_2: HMG-box domain; InterPro: IPR015101 Thi 99.54
KOG3248|consensus421 99.52
KOG0381|consensus96 99.48
KOG0526|consensus615 99.28
KOG0528|consensus511 98.91
KOG2746|consensus 683 98.34
PF08549 669 SWI-SNF_Ssr4: Fungal domain of unknown function (D 96.74
PF04690170 YABBY: YABBY protein; InterPro: IPR006780 YABBY pr 96.45
PF06382183 DUF1074: Protein of unknown function (DUF1074); In 95.88
COG5648211 NHP6B Chromatin-associated proteins containing the 95.87
PF1488785 HMG_box_5: HMG (high mobility group) box 5; PDB: 1 95.76
PF0807355 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 93.59
PF06320121 GCN5L1: GCN5-like protein 1 (GCN5L1); InterPro: IP 90.51
PF04769201 MAT_Alpha1: Mating-type protein MAT alpha 1; Inter 89.97
PF06244122 DUF1014: Protein of unknown function (DUF1014); In 84.78
>KOG4715|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.5e-69  Score=498.17  Aligned_cols=215  Identities=62%  Similarity=0.921  Sum_probs=206.7

Q ss_pred             CCCCCCCCCCCCCccchhchhHHHHHHHHHHcCCCCHHHHHHHHHhhccCCChHHhHHHHHHHHHHHH-----HHHh---
Q psy1937          79 GRGPKAPKPPEKPLMPYMRYSRKVWDQVKAQNLDLKLWEIGKIIGQMWRDLPEDQKTEYVEDYEQEKN-----LKAS---  150 (307)
Q Consensus        79 ~k~~kdp~~PKRPlsAy~lf~~e~r~~v~~e~P~~~~~eisk~lg~~Wk~Ls~eeK~~Y~~~ae~~K~-----~k~y---  150 (307)
                      ...++.|++|.+|+.+||+|++.+|++|++.||++.+|||+|+||.||..|+++||+.|...|+.+|.     |++|   
T Consensus        56 ~t~pkpPkppekpl~pymrySrkvWd~VkA~nPe~kLWeiGK~Ig~mW~dLpd~EK~ey~~EYeaEKieY~~smkayh~s  135 (410)
T KOG4715|consen   56 ITRPKPPKPPEKPLMPYMRYSRKVWDQVKASNPELKLWEIGKIIGGMWLDLPDEEKQEYLNEYEAEKIEYNESMKAYHNS  135 (410)
T ss_pred             ccCCCCCCCCCcccchhhHHhhhhhhhhhccCcchHHHHHHHHHHHHHhhCcchHHHHHHHHHHHHHHHHHHHHHHhhCC
Confidence            45678899999999999999999999999999999999999999999999999999999999999998     8999   


Q ss_pred             -hhhhccCccchhhhhhccChhhhhhhhhcCCCCccccccCCccccCCCCcccccCCCCccccccccccccchhhHHhhh
Q psy1937         151 -TKLASISRPTWRAKAKASKPKQLRKSREARPKDSGEKMQIGRIDIQPAEDEDEQEDGYSVKHVAYARYLRNHRLINEIF  229 (307)
Q Consensus       151 -~y~~y~~~k~~~~ka~~~~~~q~~~~~e~~~~~~~~~~~~~~~~~~p~ededd~ddg~S~k~~a~~Rf~rNH~l~~Eif  229 (307)
                       +|.+||++| ++++++.        +.++++..++...|+++|+|||++|+||+|||||+||+|.+||+||||||+|||
T Consensus       136 p~y~ayinaK-sra~a~l--------e~~sr~~~sr~~~ge~~~~IQPaeDeDD~ddg~stkhla~arf~rN~rLIsei~  206 (410)
T KOG4715|consen  136 PAYLAYINAK-SRAEAAL--------EEESRQRQSRMEKGEPYMSIQPAEDEDDYDDGFSTKHLATARFQRNHRLISEIL  206 (410)
T ss_pred             chHHHHhhhh-hhhhhhh--------ccccccccchhhcCCcceecccccCccccccccchhhhhhhhhhhhhHHHHHHh
Confidence             899999999 9999888        667777778888899999999999999999999999999999999999999999


Q ss_pred             cccCCCCcchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHhhhhHHHHHHHHhhhccCCCC
Q psy1937         230 SDSVVPDVRSVVTTNRMQVLKRQVQSLTMHQKKLEAELQQIEEKFEAKKRKFVESSEQFQEELKKEKASCSEN  302 (307)
Q Consensus       230 s~~~v~d~rs~~~~~r~~~l~~~~~sL~~hq~kle~el~~~e~~~~~kk~~~~~~s~~f~~~~~~~~~~~~~~  302 (307)
                      |.+||||+|||||+.||+||+|||+||++||+|||+||++||++|++|||+|+++||.|++|||++|+++|++
T Consensus       207 SesvVpDvrsVVtt~RMqvlkrQv~SL~~HQ~KLEaEL~q~Ee~hq~kKrk~~estdsf~~eLKr~c~~kvev  279 (410)
T KOG4715|consen  207 SESVVPDVRSVVTTARMQVLKRQVQSLMVHQRKLEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEV  279 (410)
T ss_pred             ccccccchhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhccHHHHHHHHHhcCCcccc
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999954

>PTZ00199 high mobility group protein; Provisional Back     alignment and domain information
>cd01389 MATA_HMG-box MATA_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>KOG4715|consensus Back     alignment and domain information
>cd01388 SOX-TCF_HMG-box SOX-TCF_HMG-box, class I member of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>PF00505 HMG_box: HMG (high mobility group) box; InterPro: IPR000910 High mobility group (HMG or HMGB) proteins are a family of relatively low molecular weight non-histone components in chromatin Back     alignment and domain information
>cd01390 HMGB-UBF_HMG-box HMGB-UBF_HMG-box, class II and III members of the HMG-box superfamily of DNA-binding proteins Back     alignment and domain information
>smart00398 HMG high mobility group Back     alignment and domain information
>COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0527|consensus Back     alignment and domain information
>cd00084 HMG-box High Mobility Group (HMG)-box is found in a variety of eukaryotic chromosomal proteins and transcription factors Back     alignment and domain information
>PF09011 HMG_box_2: HMG-box domain; InterPro: IPR015101 This domain is predominantly found in Maelstrom homologue proteins Back     alignment and domain information
>KOG3248|consensus Back     alignment and domain information
>KOG0381|consensus Back     alignment and domain information
>KOG0526|consensus Back     alignment and domain information
>KOG0528|consensus Back     alignment and domain information
>KOG2746|consensus Back     alignment and domain information
>PF08549 SWI-SNF_Ssr4: Fungal domain of unknown function (DUF1750); InterPro: IPR013859 This is a fungal protein of unknown function Back     alignment and domain information
>PF04690 YABBY: YABBY protein; InterPro: IPR006780 YABBY proteins are a group of plant-specific transcription factors involved in the specification of abaxial polarity in lateral organs such as leaves and floral organs [, ] Back     alignment and domain information
>PF06382 DUF1074: Protein of unknown function (DUF1074); InterPro: IPR024460 This family consists of several proteins which appear to be specific to Insecta Back     alignment and domain information
>COG5648 NHP6B Chromatin-associated proteins containing the HMG domain [Chromatin structure and dynamics] Back     alignment and domain information
>PF14887 HMG_box_5: HMG (high mobility group) box 5; PDB: 1L8Y_A 1L8Z_A 2HDZ_A Back     alignment and domain information
>PF08073 CHDNT: CHDNT (NUC034) domain; InterPro: IPR012958 The CHD N-terminal domain is found in PHD/RING fingers and chromo domain-associated helicases [] Back     alignment and domain information
>PF06320 GCN5L1: GCN5-like protein 1 (GCN5L1); InterPro: IPR009395 This family consists of several eukaryotic GCN5-like protein 1 (GCN5L1) sequences Back     alignment and domain information
>PF04769 MAT_Alpha1: Mating-type protein MAT alpha 1; InterPro: IPR006856 This family includes Saccharomyces cerevisiae (Baker's yeast) mating type protein alpha 1 (P01365 from SWISSPROT) Back     alignment and domain information
>PF06244 DUF1014: Protein of unknown function (DUF1014); InterPro: IPR010422 This family consists of several hypothetical eukaryotic proteins of unknown function Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query307
3tmm_A238 Tfam Imposes A U-Turn On Mitochondrial Dna Length = 3e-05
3tq6_A214 Crystal Structure Of Human Mitochondrial Transcript 5e-05
2co9_A102 Solution Structure Of The Hmg_box Domain Of Thymus 3e-04
1k99_A99 Solution Structure Of The First Hmg Box In Human Up 4e-04
>pdb|3TMM|A Chain A, Tfam Imposes A U-Turn On Mitochondrial Dna Length = 238 Back     alignment and structure 
Iteration: 1

 Score = 45.4 bits (106), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 23/57 (40%), Positives = 35/57 (61%)
Query: 88  PEKPLMPYMRYSRKVWDQVKAQNLDLKLWEIGKIIGQMWRDLPEDQKTEYVEDYEQE 144
           P+KP+  Y+R+S++     KAQN D K  E+ + I Q WR+LP+ +K  Y + Y  E
Sbjct: 42  PKKPVSSYLRFSKEQLPIFKAQNPDAKTTELIRRIAQRWRELPDSKKKIYQDAYRAE 98
>pdb|3TQ6|A Chain A, Crystal Structure Of Human Mitochondrial Transcription Factor A, Tfam Or Mttfa, Bound To The Light Strand Promoter Lsp Length = 214 Back     alignment and structure
>pdb|2CO9|A Chain A, Solution Structure Of The Hmg_box Domain Of Thymus High Mobility Group Box Protein Tox From Mouse Length = 102 Back     alignment and structure
>pdb|1K99|A Chain A, Solution Structure Of The First Hmg Box In Human Upstream Binding Factor Length = 99 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query307
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 2e-17
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 4e-15
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 1e-14
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 8e-13
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 5e-12
1hme_A77 High mobility group protein fragment-B; DNA-bindin 1e-11
2eqz_A86 High mobility group protein B3; HMG-box domain, mo 2e-11
3tq6_A214 Transcription factor A, mitochondrial; transcripti 2e-11
3tq6_A214 Transcription factor A, mitochondrial; transcripti 6e-06
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 3e-11
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 1e-06
2yrq_A173 High mobility group protein B1; HMG box domain, DN 8e-11
2yrq_A173 High mobility group protein B1; HMG box domain, DN 1e-07
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 1e-10
1wgf_A90 Upstream binding factor 1; transcription factor, D 4e-10
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 1e-09
2lhj_A97 High mobility group protein homolog NHP1; structur 3e-09
1ckt_A71 High mobility group 1 protein; high-mobility group 4e-09
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 4e-09
3fgh_A67 Transcription factor A, mitochondrial; HMG domain, 4e-08
1v63_A101 Nucleolar transcription factor 1; DNA binding, str 4e-08
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 7e-08
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 8e-06
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 8e-07
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 9e-07
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 1e-06
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 3e-06
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 7e-06
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 1e-05
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 2e-05
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 3e-05
1v64_A108 Nucleolar transcription factor 1; DNA binding, str 4e-05
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 7e-05
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 2e-04
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Length = 92 Back     alignment and structure
 Score = 75.1 bits (185), Expect = 2e-17
 Identities = 19/65 (29%), Positives = 36/65 (55%)

Query: 81  GPKAPKPPEKPLMPYMRYSRKVWDQVKAQNLDLKLWEIGKIIGQMWRDLPEDQKTEYVED 140
           G      P+ P+  Y+R+  +  +Q++ ++ DL   EI K++G  W  L   +K  Y+++
Sbjct: 1   GSSGSSGPKAPVTGYVRFLNERREQIRTRHPDLPFPEITKMLGAEWSKLQPAEKQRYLDE 60

Query: 141 YEQEK 145
            E+EK
Sbjct: 61  AEKEK 65
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Length = 99 Back     alignment and structure
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Length = 102 Back     alignment and structure
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Length = 93 Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Length = 77 Back     alignment and structure
>2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Length = 214 Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Length = 214 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Length = 238 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Length = 238 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 173 Back     alignment and structure
>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Length = 83 Back     alignment and structure
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Length = 90 Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} PDB: 1e7j_A* 1hma_A 1qrv_A* Length = 73 Back     alignment and structure
>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Length = 97 Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Length = 71 Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Length = 73 Back     alignment and structure
>3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Length = 67 Back     alignment and structure
>1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 Length = 101 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Length = 159 Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Length = 87 Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Length = 82 Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Length = 86 Back     alignment and structure
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Length = 106 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Length = 76 Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} Length = 71 Back     alignment and structure
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} Length = 79 Back     alignment and structure
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Length = 85 Back     alignment and structure
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Length = 81 Back     alignment and structure
>1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Length = 108 Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} PDB: 2yul_A Length = 83 Back     alignment and structure
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Length = 80 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query307
2eqz_A86 High mobility group protein B3; HMG-box domain, mo 99.83
2co9_A102 Thymus high mobility group box protein TOX; TOX pr 99.82
2e6o_A87 HMG box-containing protein 1; HMG-box domain, HMG- 99.82
1wgf_A90 Upstream binding factor 1; transcription factor, D 99.81
1k99_A99 Upstream binding factor 1; alpha-helix, L-shape, D 99.81
1hme_A77 High mobility group protein fragment-B; DNA-bindin 99.81
2crj_A92 SWI/SNF-related matrix-associated actin- dependent 99.81
1hry_A76 Human SRY; DNA, DNA-binding protein, DNA binding p 99.8
1aab_A83 High mobility group protein; HMG-BOX, DNA-binding; 99.79
2lhj_A97 High mobility group protein homolog NHP1; structur 99.79
1cg7_A93 Protein (NON histone protein 6 A); HMG BOX, DNA be 99.78
1j46_A85 SRY, sex-determining region Y protein; MALE sex de 99.78
2cs1_A92 PMS1 protein homolog 1; DNA mismatch repair protei 99.78
1wz6_A82 HMG-box transcription factor BBX; bobby SOX homolo 99.77
1wxl_A73 Single-strand recognition protein; FACT, SSRP1, HM 99.76
4euw_A106 Transcription factor SOX-9; protein-DNA complex, H 99.76
1i11_A81 Transcription factor SOX-5; HMG BOX, DNA bending, 99.75
3f27_D83 Transcription factor SOX-17; protein-DNA complex, 99.75
4a3n_A71 Transcription factor SOX-17; 2.40A {Homo sapiens} 99.75
2d7l_A81 WD repeat and HMG-box DNA binding protein 1; high 99.75
1gt0_D80 Transcription factor SOX-2; POU factors, SOX prote 99.75
2lef_A86 LEF-1 HMG, protein (lymphoid enhancer-binding fact 99.75
1ckt_A71 High mobility group 1 protein; high-mobility group 99.75
3nm9_A73 HMG-D, high mobility group protein D; DNA bending, 99.75
3u2b_C79 Transcription factor SOX-4; HMG domain, transcript 99.74
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 99.71
2yrq_A173 High mobility group protein B1; HMG box domain, DN 99.7
1v64_A108 Nucleolar transcription factor 1; DNA binding, str 99.69
2yrq_A173 High mobility group protein B1; HMG box domain, DN 99.68
3fgh_A67 Transcription factor A, mitochondrial; HMG domain, 99.68
2yuk_A90 Myeloid/lymphoid or mixed-lineage leukemia protein 99.67
1l8y_A91 Upstream binding factor 1; HUBF, HMG box 5, DNA bi 99.66
2cto_A93 Novel protein; high mobility group box domain, hel 99.64
1v63_A101 Nucleolar transcription factor 1; DNA binding, str 99.63
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 99.61
2gzk_A159 Sex-determining region on Y / HMGB1; protein-DNA c 99.58
3tq6_A214 Transcription factor A, mitochondrial; transcripti 99.58
3tq6_A214 Transcription factor A, mitochondrial; transcripti 99.45
3tmm_A238 Transcription factor A, mitochondrial; HMG, high m 99.42
>2eqz_A High mobility group protein B3; HMG-box domain, mobility group protein 2A, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
Probab=99.83  E-value=1.6e-20  Score=145.40  Aligned_cols=80  Identities=16%  Similarity=0.290  Sum_probs=69.8

Q ss_pred             ccCCCCCCCCCCCCCCccchhchhHHHHHHHHHHcCCCC--HHHHHHHHHhhccCCChHHhHHHHHHHHHHHHHHHhhhh
Q psy1937          76 KTDGRGPKAPKPPEKPLMPYMRYSRKVWDQVKAQNLDLK--LWEIGKIIGQMWRDLPEDQKTEYVEDYEQEKNLKASTKL  153 (307)
Q Consensus        76 k~~~k~~kdp~~PKRPlsAy~lf~~e~r~~v~~e~P~~~--~~eisk~lg~~Wk~Ls~eeK~~Y~~~ae~~K~~k~y~y~  153 (307)
                      +++++..+||++||||+||||+||+++|..|+.+||+++  +.||+++||++|++|++++|.+|+++|+.+++...-++.
T Consensus         4 g~~~~~~kdp~~PKrP~say~lF~~~~r~~~k~~~p~~~~~~~eisk~lg~~Wk~ls~~eK~~y~~~A~~~k~~y~~e~~   83 (86)
T 2eqz_A            4 GSSGMAKGDPKKPKGKMSAYAFFVQTCREEHKKKNPEVPVNFAEFSKKCSERWKTMSGKEKSKFDEMAKADKVRYDREMK   83 (86)
T ss_dssp             CCSSCSSCCSSSCCCCCCHHHHHHHHHHHHHHHHCTTSCCCHHHHHHHHHHHHHSSCHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCCCCCCCcHHHHHHHHHHHHHHHHCCCCCCcHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHHHHHHHHH
Confidence            345566789999999999999999999999999999997  699999999999999999999999999999763222555


Q ss_pred             hc
Q psy1937         154 AS  155 (307)
Q Consensus       154 ~y  155 (307)
                      +|
T Consensus        84 ~Y   85 (86)
T 2eqz_A           84 DY   85 (86)
T ss_dssp             HH
T ss_pred             Hc
Confidence            55
>2co9_A Thymus high mobility group box protein TOX; TOX protein, HMG box domain, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2e6o_A HMG box-containing protein 1; HMG-box domain, HMG-box transcription factor 1, high mobility group box transcription factor 1, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1wgf_A Upstream binding factor 1; transcription factor, DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1k99_A Upstream binding factor 1; alpha-helix, L-shape, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 Back     alignment and structure
>1hme_A High mobility group protein fragment-B; DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1hmf_A 1nhm_A 1nhn_A 1hsm_A 1hsn_A 1j3c_A 1j3d_A 2yqi_A Back     alignment and structure
>2crj_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; structural DNA-binding protein BRAF35, DNA-bending; NMR {Mus musculus} Back     alignment and structure
>1hry_A Human SRY; DNA, DNA-binding protein, DNA binding protein/DNA complex; HET: DNA; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1hrz_A* Back     alignment and structure
>1aab_A High mobility group protein; HMG-BOX, DNA-binding; NMR {Rattus norvegicus} SCOP: a.21.1.1 Back     alignment and structure
>2lhj_A High mobility group protein homolog NHP1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; NMR {Babesia bovis} Back     alignment and structure
>1cg7_A Protein (NON histone protein 6 A); HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.21.1.1 PDB: 1j5n_A 1lwm_A Back     alignment and structure
>1j46_A SRY, sex-determining region Y protein; MALE sex determining factor, SRY, sex-reversal mutation; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1j47_A Back     alignment and structure
>2cs1_A PMS1 protein homolog 1; DNA mismatch repair protein PMS1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wz6_A HMG-box transcription factor BBX; bobby SOX homolog, HMG_BOX domain, structural genomics, NPPSFA, riken structural genomics/proteomics initiative; NMR {Mus musculus} Back     alignment and structure
>1wxl_A Single-strand recognition protein; FACT, SSRP1, HMG, DNA binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>4euw_A Transcription factor SOX-9; protein-DNA complex, HMG domain, activator, DNA-binding, NUC transcription; HET: DNA; 2.77A {Homo sapiens} Back     alignment and structure
>1i11_A Transcription factor SOX-5; HMG BOX, DNA bending, DNA recognition, chromatin, DNA binding protein, DNA sequence specific, testis determining.; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>3f27_D Transcription factor SOX-17; protein-DNA complex, HMG domain, endodermal, activator, DNA- nucleus, transcription regulation, transcrip complex; HET: DNA; 2.75A {Mus musculus} SCOP: a.21.1.1 PDB: 2yul_A Back     alignment and structure
>4a3n_A Transcription factor SOX-17; 2.40A {Homo sapiens} SCOP: a.21.1.0 Back     alignment and structure
>2d7l_A WD repeat and HMG-box DNA binding protein 1; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gt0_D Transcription factor SOX-2; POU factors, SOX proteins; 2.6A {Mus musculus} SCOP: a.21.1.1 PDB: 2le4_A 1o4x_B Back     alignment and structure
>2lef_A LEF-1 HMG, protein (lymphoid enhancer-binding factor); LEF1, HMG, TCR-A, transcription factor; HET: DNA; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>1ckt_A High mobility group 1 protein; high-mobility group domain, BENT DNA, protein-drug-DNA compl regulation-DNA complex; HET: DNA 5IU; 2.50A {Rattus norvegicus} SCOP: a.21.1.1 PDB: 1j3x_A Back     alignment and structure
>3nm9_A HMG-D, high mobility group protein D; DNA bending, non-sequence-specific, HMG chromosomal protein; HET: DNA; 2.85A {Drosophila melanogaster} SCOP: a.21.1.1 PDB: 1e7j_A* 1hma_A 1qrv_A* Back     alignment and structure
>3u2b_C Transcription factor SOX-4; HMG domain, transcriptional regulation, transcription-DNA CO; HET: DNA; 2.40A {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v64_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>2yrq_A High mobility group protein B1; HMG box domain, DNA binding, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fgh_A Transcription factor A, mitochondrial; HMG domain, mitochondrial transcription, activator, DNA- binding, mitochondrion, phosphoprotein; 1.35A {Homo sapiens} Back     alignment and structure
>2yuk_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>1l8y_A Upstream binding factor 1; HUBF, HMG box 5, DNA binding domain, DNA binding protein; NMR {Homo sapiens} SCOP: a.21.1.1 PDB: 1l8z_A 2hdz_A Back     alignment and structure
>2cto_A Novel protein; high mobility group box domain, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v63_A Nucleolar transcription factor 1; DNA binding, structural genomics, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: a.21.1.1 Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure
>2gzk_A Sex-determining region on Y / HMGB1; protein-DNA complex, HMG BOX, amphoterin, DNA/structural protein complex; NMR {Homo sapiens} SCOP: a.21.1.1 a.21.1.1 Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>3tq6_A Transcription factor A, mitochondrial; transcription, transcription regulation, mitochondrion; HET: DNA BRU 1PE; 2.45A {Homo sapiens} Back     alignment and structure
>3tmm_A Transcription factor A, mitochondrial; HMG, high mobility group, transcription, LSP1, mitochon transcription-DNA complex; HET: DNA; 2.50A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 307
d1hsma_79 a.21.1.1 (A:) High mobility group protein 1, HMG1 1e-09
d1i11a_70 a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 3e-09
d1wgfa_90 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 5e-09
d1v63a_101 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 8e-09
d1lwma_93 a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces 8e-09
d2lefa_86 a.21.1.1 (A:) Lymphoid enhancer-binding factor, LE 9e-09
d1j46a_85 a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 96 1e-08
d1k99a_91 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 2e-08
d1ckta_71 a.21.1.1 (A:) High mobility group protein 1, HMG1 1e-07
d1gt0d_80 a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 2e-07
d1v64a_108 a.21.1.1 (A:) Nucleolar transcription factor 1 (Up 6e-07
d1qrva_73 a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxI 6e-07
>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Length = 79 Back     information, alignment and structure

class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: High mobility group protein 1, HMG1
species: Hamster (Cricetulus griseus) [TaxId: 10029]

 Score = 52.2 bits (125), Expect = 1e-09
 Identities = 12/58 (20%), Positives = 29/58 (50%)

Query: 88  PEKPLMPYMRYSRKVWDQVKAQNLDLKLWEIGKIIGQMWRDLPEDQKTEYVEDYEQEK 145
           P++P   +  +  +   ++K ++  L + ++ K +G+MW +   D K  Y +   + K
Sbjct: 3   PKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLK 60
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 70 Back     information, alignment and structure
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 Back     information, alignment and structure
>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 93 Back     information, alignment and structure
>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 71 Back     information, alignment and structure
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 80 Back     information, alignment and structure
>d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Length = 73 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query307
d1lwma_93 NHP6a {Baker's yeast (Saccharomyces cerevisiae) [T 99.78
d1i11a_70 Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} 99.76
d1gt0d_80 Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.76
d1j46a_85 SRY {Human (Homo sapiens) [TaxId: 9606]} 99.75
d1hsma_79 High mobility group protein 1, HMG1 {Hamster (Cric 99.74
d1k99a_91 Nucleolar transcription factor 1 (Upstream binding 99.74
d1wgfa_90 Nucleolar transcription factor 1 (Upstream binding 99.73
d2lefa_86 Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus 99.71
d1ckta_71 High mobility group protein 1, HMG1 {Rat (Rattus n 99.7
d1qrva_73 HMG-D {Drosophila melanogaster [TaxId: 7227]} 99.68
d1v64a_108 Nucleolar transcription factor 1 (Upstream binding 99.59
d1v63a_101 Nucleolar transcription factor 1 (Upstream binding 99.57
>d1lwma_ a.21.1.1 (A:) NHP6a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: HMG-box
superfamily: HMG-box
family: HMG-box
domain: NHP6a
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=99.78  E-value=3.2e-19  Score=138.46  Aligned_cols=73  Identities=27%  Similarity=0.569  Sum_probs=67.8

Q ss_pred             ccccCCCCCCCCCCCCCCccchhchhHHHHHHHHHHcCCCCHHHHHHHHHhhccCCChHHhHHHHHHHHHHHH
Q psy1937          74 TAKTDGRGPKAPKPPEKPLMPYMRYSRKVWDQVKAQNLDLKLWEIGKIIGQMWRDLPEDQKTEYVEDYEQEKN  146 (307)
Q Consensus        74 ~~k~~~k~~kdp~~PKRPlsAy~lf~~e~r~~v~~e~P~~~~~eisk~lg~~Wk~Ls~eeK~~Y~~~ae~~K~  146 (307)
                      .+++..+..++|++||||+||||+|++++|..|+.++|++++.+|++.||++|++||+++|.+|.+.|+.+++
T Consensus         7 ~~k~~~k~~k~p~~PKrP~saf~lF~~e~r~~ik~~~p~~~~~ei~k~l~~~W~~ls~~eK~~y~~~a~~~k~   79 (93)
T d1lwma_           7 PKKRTTRKKKDPNAPKRALSAYMFFANENRDIVRSENPDITFGQVGKKLGEKWKALTPEEKQPYEAKAQADKK   79 (93)
T ss_dssp             TTSCCCSCCCCSSCCCCCCCHHHHHHHHHHHHHHHHCTTSCHHHHHHHHHHHHHTSCHHHHHHHHHHHHHHHH
T ss_pred             CCCccccCCCCcCCCCCCCCHHHHHHHHHHHHHHHhCCCCcHHHHHHHHHHHHHhCCHHHHHHHHHHHHHHHH
Confidence            3345566778999999999999999999999999999999999999999999999999999999999999976
>d1i11a_ a.21.1.1 (A:) Sox-5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gt0d_ a.21.1.1 (D:) Sox-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1j46a_ a.21.1.1 (A:) SRY {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hsma_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1k99a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgfa_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2lefa_ a.21.1.1 (A:) Lymphoid enhancer-binding factor, LEF1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ckta_ a.21.1.1 (A:) High mobility group protein 1, HMG1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qrva_ a.21.1.1 (A:) HMG-D {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1v64a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v63a_ a.21.1.1 (A:) Nucleolar transcription factor 1 (Upstream binding factor 1, UBF-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure