Psyllid ID: psy1959


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290------
VRIDIQCCALNSSDLLLYNGSGDAKPTLPLVPGFEFSGTIIEKKMMTRINSSDLLLYNGSGDAKPTLPLVPGFEFSGTVIEVADTKSSSTEEDDEEDVLQVGDKVLALNKELLHGFSDQCVVHTNDVFKIPEKMTFEHAASLADSYSTAQIVFSRHAKLKEKQTVLVTAAGGGLGLAAVDMATKIYKAKVIGVCNSEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVSGGKYANVVFEAVGGEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVSGGKYANVVFEAVGGEVFKAAMH
cEEEEEEEEccccccEEEccccccccccccccccccccEEEEEEEEEEccHHHHHHHHcccccccccccccccEEEEEEEEEcccccccccccccccccccccEEEEEccccccccccccccccccEEEccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHccccEEEEccccccHHHHHHHHHccccccEEEEccccccHHHHHcccccEEEEEEcccccccccEEEEEEcEEEEcccccHHHHHHHHHcc
ccEEEEEcHHHHEEEEEEcccccEEEEEEccccccccccEEEEEEEEEEccHHHHHHccccccccccccccccHHcEEEEEccccccccccccccHHHcccccEEEEEccccccccEEEEEccHHccccccccccHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHccccEEEEccccHHHHHHHHHHHcccccEEEEEccccccHHHHHcccccEEEEEEcccccccccHHcccccEEEEcccccccHHHHHHHHc
vridiqccalnssdlllyngsgdakptlplvpgfefsgTIIEKKMMTRINSSDlllyngsgdakptlplvpgfefsgtvievadtksssteeddeedvlQVGDKVLALNKELLHGfsdqcvvhtndvfkipekmtfEHAASLADSYSTAQIVFSRHAKLKEKQTVLVTAAGGGLGLAAVDMATKIYKAKVigvcnsedktDLIRQKGAWAALTFTNEKSLVNKVLEVSGGKYANVVFEavggedktdlIRQKGAWAALTFTNEKSLVNKVLEVSGGKYANVVFEAVGGEVFKAAMH
VRIDIQCCALNSSDLLLYNGSGDAKPTLPLVPGFEFSGTIIEKKMMTRINSSDLLLYNGSGDAKPTLPLVPGFEFSGTVIEVADtksssteeddeedvLQVGDKVLALNKELLHGFSDQCVVHTNDVFKIPEKMTFEHAASLADSYSTAQIVFSRHAKLKEKQTVLVTAAGGGLGLAAVDMATKIYKAKVIGVCNSEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVSGGKYANVVFEAVGGEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVSGGKYANVVFEAVGGEVFKAAMH
VRIDIQCCALNSSDLLLYNGSGDAKPTLPLVPGFEFSGTIIEKKMMTRINSSDLLLYNGSGDAKPTLPLVPGFEFSGTVIEVAdtksssteeddeedVLQVGDKVLALNKELLHGFSDQCVVHTNDVFKIPEKMTFEHAASLADSYSTAQIVFSRHAKLKEKQtvlvtaaggglglaavDMATKIYKAKVIGVCNSEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVSGGKYANVVFEAVGGEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVSGGKYANVVFEAVGGEVFKAAMH
**IDIQCCALNSSDLLLYNGSGDAKPTLPLVPGFEFSGTIIEKKMMTRINSSDLLLYNGSGDAKPTLPLVPGFEFSGTVIEV***************VLQVGDKVLALNKELLHGFSDQCVVHTNDVFKIPEKMTFEHAASLADSYSTAQIVFSRHAKLKEKQTVLVTAAGGGLGLAAVDMATKIYKAKVIGVCNSEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVSGGKYANVVFEAVGGEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVSGGKYANVVFEAVGGEVF*****
VRIDIQCCALNSSDLLLYNGSGDAKPTLPLVPGFEFSGTIIEKKMMTRINSSDLLLYNGSGDAKPTLPLVPGFEFSGTVIEVADTKSSSTEEDDEEDVLQVGDKVLALNKELLHGFSDQCVVHTNDVFKIPEKMTFEHAASLADSYSTAQIVFSRHAKLKEKQTVLVTAAGGGLGLAAVDMATKIYKAKVIGVCNSEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVSGGKYANVVFEAVGGEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVSGGKYANVVFEAVGGEVFKA*M*
VRIDIQCCALNSSDLLLYNGSGDAKPTLPLVPGFEFSGTIIEKKMMTRINSSDLLLYNGSGDAKPTLPLVPGFEFSGTVIEVA***************LQVGDKVLALNKELLHGFSDQCVVHTNDVFKIPEKMTFEHAASLADSYSTAQIVFSRHAKLKEKQTVLVTAAGGGLGLAAVDMATKIYKAKVIGVCNSEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVSGGKYANVVFEAVGGEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVSGGKYANVVFEAVGGEVFKAAMH
VRIDIQCCALNSSDLLLYNGSGDAKPTLPLVPGFEFSGTIIEKKMMTRINSSDLLLYNGSGDAKPTLPLVPGFEFSGTVIEVADTKSSSTEEDDEEDVLQVGDKVLALNKELLHGFSDQCVVHTNDVFKIPEKMTFEHAASLADSYSTAQIVFSRHAKLKEKQTVLVTAAGGGLGLAAVDMATKIYKAKVIGVCNSEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVSGGKYANVVFEAVGGEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVSGGKYANVVFEAVGGEVFKAAMH
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VRIDIQCCALNSSDLLLYNGSGDAKPTLPLVPGFEFSGTIIEKKMMTRINSSDLLLYNGSGDAKPTLPLVPGFEFSGTVIEVADTKSSSTEEDDEEDVLQVGDKVLALNKELLHGFSDQCVVHTNDVFKIPEKMTFEHAASLADSYSTAQIVFSRHAKLKEKQTVLVTAAGGGLGLAAVDMATKIYKAKVIGVCNSEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVSGGKYANVVFEAVGGEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVSGGKYANVVFEAVGGEVFKAAMH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query296 2.2.26 [Sep-21-2011]
A7RK30365 Quinone oxidoreductase-li N/A N/A 0.614 0.498 0.420 7e-25
Q3UNZ8350 Quinone oxidoreductase-li yes N/A 0.709 0.6 0.334 2e-22
B0BNC9350 Quinone oxidoreductase-li yes N/A 0.709 0.6 0.343 2e-22
A6QQF5349 Quinone oxidoreductase-li yes N/A 0.638 0.541 0.351 4e-20
Q8JFV8 484 Synaptic vesicle membrane yes N/A 0.652 0.398 0.307 5e-18
Q99536393 Synaptic vesicle membrane yes N/A 0.611 0.460 0.306 4e-17
Q0MVN8329 Quinone oxidoreductase OS no N/A 0.597 0.537 0.278 5e-15
O97764330 Zeta-crystallin OS=Bos ta no N/A 0.597 0.536 0.268 5e-15
Q08257329 Quinone oxidoreductase OS no N/A 0.597 0.537 0.268 2e-14
Q5R4S7329 Quinone oxidoreductase OS no N/A 0.597 0.537 0.284 4e-14
>sp|A7RK30|QORL2_NEMVE Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 Back     alignment and function desciption
 Score =  114 bits (286), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 82/195 (42%), Positives = 116/195 (59%), Gaps = 13/195 (6%)

Query: 49  INSSDLLLYNGSGDAKPTLPLVPGFEFSGTVIEVADTKSSSTEEDDEEDVLQVGDKVLAL 108
           IN +D+L   G    KP LP VPG E SG V+EV    +S          L  GD+VL +
Sbjct: 76  INFADILKCIGKYQEKPELPFVPGTEISGEVVEVGSKVTS----------LSKGDRVLGV 125

Query: 109 NKELLHGFSDQCVVHTNDVFKIPEKMTFEHAASLADSYSTAQIVFSRHAKLKEKQTVLVT 168
             +   G +++CV+    ++KIP  ++F  AA+LA SY TA I     A L+  QTVLVT
Sbjct: 126 CGQG-GGMAEECVLPQTALWKIPSSLSFTQAAALAISYGTAYIGLKHKANLQPGQTVLVT 184

Query: 169 AAGGGLGLAAVDMATKIYKAKVIGVCNSEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVS 228
           AA G LGLA+VD+A  ++ AKVIG    E K  ++++ GA A + +T E ++ +KV E++
Sbjct: 185 AAAGALGLASVDLAANVFGAKVIGASRKE-KLVIVQEIGATATIDYTRE-NIKDKVKELT 242

Query: 229 GGKYANVVFEAVGGE 243
            G  ANV+ EAVGG+
Sbjct: 243 DGHGANVIMEAVGGD 257





Nematostella vectensis (taxid: 45351)
EC: 1EC: .EC: -EC: .EC: -EC: .EC: -
>sp|Q3UNZ8|QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=2 SV=1 Back     alignment and function description
>sp|B0BNC9|QORL2_RAT Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1 Back     alignment and function description
>sp|A6QQF5|QORL2_BOVIN Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2 Back     alignment and function description
>sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 Back     alignment and function description
>sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 Back     alignment and function description
>sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 Back     alignment and function description
>sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 Back     alignment and function description
>sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 Back     alignment and function description
>sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query296
328713227359 PREDICTED: quinone oxidoreductase-like p 0.641 0.529 0.497 7e-41
242009154355 Zeta-crystallin, putative [Pediculus hum 0.618 0.515 0.445 3e-31
156555925 407 PREDICTED: quinone oxidoreductase-like p 0.628 0.457 0.4 3e-30
332376194351 unknown [Dendroctonus ponderosae] 0.557 0.470 0.417 4e-29
383854438 410 PREDICTED: quinone oxidoreductase-like p 0.628 0.453 0.374 7e-29
332025419 414 Quinone oxidoreductase-like protein 2 [A 0.611 0.437 0.364 2e-28
340726582 411 PREDICTED: quinone oxidoreductase-like p 0.628 0.452 0.358 5e-28
350418419 411 PREDICTED: quinone oxidoreductase-like p 0.628 0.452 0.358 2e-27
195996411336 hypothetical protein TRIADDRAFT_52177 [T 0.648 0.571 0.404 2e-27
424863844332 NADPH:quinone reductase [SAR86 cluster b 0.770 0.686 0.352 2e-27
>gi|328713227|ref|XP_001943069.2| PREDICTED: quinone oxidoreductase-like protein 2 homolog isoform 1 [Acyrthosiphon pisum] gi|328713229|ref|XP_003245020.1| PREDICTED: quinone oxidoreductase-like protein 2 homolog isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  173 bits (439), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 97/195 (49%), Positives = 134/195 (68%), Gaps = 5/195 (2%)

Query: 49  INSSDLLLYNGSGDAKPTLPLVPGFEFSGTVIEVADTKSSSTEEDDEEDVLQVGDKVLAL 108
           +N SD L+ +G  + KP LP VPGFE  G VIE     S +T  DDEE+ + VGD+VL L
Sbjct: 62  VNMSDALICSGLSEIKPVLPYVPGFEIVGEVIE-----SKATNADDEEEDISVGDRVLVL 116

Query: 109 NKELLHGFSDQCVVHTNDVFKIPEKMTFEHAASLADSYSTAQIVFSRHAKLKEKQTVLVT 168
           NKE++ GF+++C+V   D+F IP ++++E A S+ DSY+TA I  +R A LK+  T+LVT
Sbjct: 117 NKEIMGGFAEECIVDEKDIFGIPSELSYETAVSIGDSYATALIGLARRANLKKDNTILVT 176

Query: 169 AAGGGLGLAAVDMATKIYKAKVIGVCNSEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVS 228
           AA GGLGLAAVD+A  + KAKVIG C  E  T ++R KGA+ +    + +SL  +VL+ +
Sbjct: 177 AAAGGLGLAAVDIAANMCKAKVIGACRLEKNTSIVRDKGAFISFEIKSPESLCKRVLKET 236

Query: 229 GGKYANVVFEAVGGE 243
            GK  +VVF+AVGGE
Sbjct: 237 DGKGVDVVFDAVGGE 251




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242009154|ref|XP_002425357.1| Zeta-crystallin, putative [Pediculus humanus corporis] gi|212509142|gb|EEB12619.1| Zeta-crystallin, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|156555925|ref|XP_001603606.1| PREDICTED: quinone oxidoreductase-like protein 2-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332376194|gb|AEE63237.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|383854438|ref|XP_003702728.1| PREDICTED: quinone oxidoreductase-like protein 2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|332025419|gb|EGI65586.1| Quinone oxidoreductase-like protein 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340726582|ref|XP_003401635.1| PREDICTED: quinone oxidoreductase-like protein 2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350418419|ref|XP_003491851.1| PREDICTED: quinone oxidoreductase-like protein 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|195996411|ref|XP_002108074.1| hypothetical protein TRIADDRAFT_52177 [Trichoplax adhaerens] gi|190588850|gb|EDV28872.1| hypothetical protein TRIADDRAFT_52177 [Trichoplax adhaerens] Back     alignment and taxonomy information
>gi|424863844|ref|ZP_18287756.1| NADPH:quinone reductase [SAR86 cluster bacterium SAR86A] gi|400757165|gb|EJP71377.1| NADPH:quinone reductase [SAR86 cluster bacterium SAR86A] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query296
RGD|1304982350 RGD1304982 "similar to RIKEN c 0.709 0.6 0.291 3e-21
MGI|MGI:2448516350 BC026585 "cDNA sequence BC0265 0.709 0.6 0.283 4.9e-21
UNIPROTKB|F1PV34350 LOC610994 "Uncharacterized pro 0.652 0.551 0.285 1.3e-20
UNIPROTKB|J9P068375 LOC610994 "Uncharacterized pro 0.652 0.514 0.285 1.8e-20
UNIPROTKB|F1NVJ2347 LOC424430 "Uncharacterized pro 0.652 0.556 0.280 5.2e-18
UNIPROTKB|A6QQF5349 A6QQF5 "Quinone oxidoreductase 0.631 0.535 0.294 7.1e-18
TIGR_CMR|SPO_1969330 SPO_1969 "oxidoreductase, zinc 0.689 0.618 0.258 2.3e-11
TIGR_CMR|SPO_2548330 SPO_2548 "oxidoreductase, zinc 0.652 0.584 0.279 3e-11
ZFIN|ZDB-GENE-030616-178 484 vat1 "vesicle amine transport 0.652 0.398 0.274 6e-11
UNIPROTKB|Q99536393 VAT1 "Synaptic vesicle membran 0.685 0.516 0.244 1.6e-10
RGD|1304982 RGD1304982 "similar to RIKEN cDNA 2810025M15" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 249 (92.7 bits), Expect = 3.0e-21, P = 3.0e-21
 Identities = 68/233 (29%), Positives = 111/233 (47%)

Query:    49 INSSDLLLYNGSGDAKPTLPLVPGFEFSGTVIEVAXXXXXXXXXXXXXXVLQVGDKVLAL 108
             IN +D L+  G    KP LP  PG EFSG V+E                 ++ GD+V+ +
Sbjct:    63 INFADNLVCRGQYQEKPPLPFTPGMEFSGVVLEAGADVST----------VKKGDRVIGV 112

Query:   109 NKELLHGFSDQCVVHTNDVFKIPEKMTFEHAASLADSYSTAQIVFSRHAKLKEKQXXXXX 168
             +    H  ++QC+     +++IPE ++ + AA L  SY TA +     A+++  +     
Sbjct:   113 SN--FHSMAEQCITDQKTLWRIPENVSLQDAAVLPVSYGTAILAVDHRARIQPGETVLVT 170

Query:   169 XXXXXXXXXXXDMATKIYKAKVIGVCNSEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVS 228
                        D+AT ++ AKVI    S++K  L  Q+GA + + ++ + SL + V ++ 
Sbjct:   171 AAAGATGLAVIDVATNVFCAKVIAAAGSDEKCKLAMQRGAQSGVNYS-QGSLKDAVKKLV 229

Query:   229 GGKYANVVFEAVGGEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVSGGKYANV 281
             G    NV  + VGG+   D +R   AW       E  +V  VL  +GG  A+V
Sbjct:   230 GSSGVNVAIDMVGGDVFLDSLRSL-AW-------EGRIV--VLGFAGGNIASV 272


GO:0000166 "nucleotide binding" evidence=IEA
GO:0005739 "mitochondrion" evidence=IEA;ISO
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA
MGI|MGI:2448516 BC026585 "cDNA sequence BC026585" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1PV34 LOC610994 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P068 LOC610994 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NVJ2 LOC424430 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|A6QQF5 A6QQF5 "Quinone oxidoreductase-like protein 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_1969 SPO_1969 "oxidoreductase, zinc-binding dehydrogenase family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_2548 SPO_2548 "oxidoreductase, zinc-binding dehydrogenase family" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030616-178 vat1 "vesicle amine transport protein 1 homolog (T californica)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q99536 VAT1 "Synaptic vesicle membrane protein VAT-1 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query296
cd08241323 cd08241, QOR1, Quinone oxidoreductase (QOR) 5e-44
COG0604326 COG0604, Qor, NADPH:quinone reductase and related 2e-35
cd05188271 cd05188, MDR, Medium chain reductase/dehydrogenase 5e-34
cd08268328 cd08268, MDR2, Medium chain dehydrogenases/reducta 1e-32
cd05276323 cd05276, p53_inducible_oxidoreductase, PIG3 p53-in 7e-32
cd08275337 cd08275, MDR3, Medium chain dehydrogenases/reducta 2e-30
cd05286320 cd05286, QOR2, Quinone oxidoreductase (QOR) 2e-28
cd05289309 cd05289, MDR_like_2, alcohol dehydrogenase and qui 5e-28
cd05195293 cd05195, enoyl_red, enoyl reductase of polyketide 7e-28
PTZ00354334 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisi 8e-26
cd05282323 cd05282, ETR_like, 2-enoyl thioester reductase-lik 1e-25
cd08253325 cd08253, zeta_crystallin, Zeta-crystallin with NAD 5e-25
cd08267319 cd08267, MDR1, Medium chain dehydrogenases/reducta 3e-24
smart00829287 smart00829, PKS_ER, Enoylreductase 4e-24
TIGR02824325 TIGR02824, quinone_pig3, putative NAD(P)H quinone 3e-23
cd08251303 cd08251, polyketide_synthase, polyketide synthase 3e-22
cd08266342 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of t 2e-20
cd08259332 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MD 3e-20
cd08250329 cd08250, Mgc45594_like, Mgc45594 gene product and 1e-19
cd08273331 cd08273, MDR8, Medium chain dehydrogenases/reducta 2e-19
cd08244324 cd08244, MDR_enoyl_red, Possible enoyl reductase 2e-18
COG1064339 COG1064, AdhP, Zn-dependent alcohol dehydrogenases 6e-18
PRK13771334 PRK13771, PRK13771, putative alcohol dehydrogenase 6e-18
COG1063350 COG1063, Tdh, Threonine dehydrogenase and related 8e-18
PRK10754327 PRK10754, PRK10754, quinone oxidoreductase, NADPH- 6e-17
cd08236343 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrog 3e-16
cd08254338 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-e 5e-16
cd08271325 cd08271, MDR5, Medium chain dehydrogenases/reducta 1e-15
cd08272326 cd08272, MDR6, Medium chain dehydrogenases/reducta 3e-15
cd08260345 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MD 4e-15
cd08274350 cd08274, MDR9, Medium chain dehydrogenases/reducta 5e-15
cd08261337 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MD 6e-15
cd08248350 cd08248, RTN4I1, Human Reticulon 4 Interacting Pro 5e-14
cd08233351 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanedio 2e-13
cd08249339 cd08249, enoyl_reductase_like, enoyl_reductase_lik 3e-13
cd05278347 cd05278, FDH_like, Formaldehyde dehydrogenases 4e-13
cd08258306 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MD 9e-13
cd08297341 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CA 1e-12
cd05284340 cd05284, arabinose_DH_like, D-arabinose dehydrogen 4e-12
cd08291324 cd08291, ETR_like_1, 2-enoyl thioester reductase ( 1e-11
cd08243320 cd08243, quinone_oxidoreductase_like_1, Quinone ox 1e-11
cd08234334 cd08234, threonine_DH_like, L-threonine dehydrogen 2e-11
cd05280325 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putativ 4e-11
cd08231361 cd08231, MDR_TM0436_like, Hypothetical enzyme TM04 5e-11
cd08263367 cd08263, Zn_ADH10, Alcohol dehydrogenases of the M 2e-10
cd08290341 cd08290, ETR, 2-enoyl thioester reductase (ETR) 2e-10
cd08247352 cd08247, AST1_like, AST1 is a cytoplasmic protein 3e-10
cd08269312 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MD 4e-10
TIGR01751398 TIGR01751, crot-CoA-red, crotonyl-CoA reductase 4e-10
TIGR02823323 TIGR02823, oxido_YhdH, putative quinone oxidoreduc 5e-10
cd08279363 cd08279, Zn_ADH_class_III, Class III alcohol dehyd 6e-10
cd05288329 cd05288, PGDH, Prostaglandin dehydrogenases 1e-09
cd08239339 cd08239, THR_DH_like, L-threonine dehydrogenase (T 3e-09
cd05285343 cd05285, sorbitol_DH, Sorbitol dehydrogenase 4e-09
cd08256350 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MD 6e-09
cd08255277 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochloro 6e-09
cd08284344 cd08284, FDH_like_2, Glutathione-dependent formald 7e-09
cd08270305 cd08270, MDR4, Medium chain dehydrogenases/reducta 9e-09
COG1062366 COG1062, AdhC, Zn-dependent alcohol dehydrogenases 1e-08
cd08292324 cd08292, ETR_like_2, 2-enoyl thioester reductase ( 1e-08
cd08235343 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenas 2e-08
pfam00107131 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase 2e-08
cd08264325 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of t 3e-08
cd08283386 cd08283, FDH_like_1, Glutathione-dependent formald 3e-08
cd08276336 cd08276, MDR7, Medium chain dehydrogenases/reducta 4e-08
COG2130340 COG2130, COG2130, Putative NADP-dependent oxidored 2e-07
cd08288324 cd08288, MDR_yhdh, Yhdh putative quinone oxidoredu 2e-07
cd08289326 cd08289, MDR_yhfp_like, Yhfp putative quinone oxid 2e-07
cd08246393 cd08246, crotonyl_coA_red, crotonyl-CoA reductase 4e-07
cd08281371 cd08281, liver_ADH_like1, Zinc-dependent alcohol d 4e-07
cd05283337 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CA 8e-07
cd08240350 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexa 3e-06
pfam08240108 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like 3e-06
cd08285351 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehyd 4e-06
pfam08240108 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like 6e-06
cd08286345 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase 6e-06
TIGR02825325 TIGR02825, B4_12hDH, leukotriene B4 12-hydroxydehy 1e-05
TIGR00692340 TIGR00692, tdh, L-threonine 3-dehydrogenase 2e-05
cd08262341 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MD 4e-05
cd08265384 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MD 6e-05
cd05279365 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and 8e-05
PRK09422338 PRK09422, PRK09422, ethanol-active dehydrogenase/a 9e-05
PLN02514357 PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase 2e-04
cd08252336 cd08252, AL_MDR, Arginate lyase and other MDR fami 2e-04
cd08277365 cd08277, liver_alcohol_DH_like, Liver alcohol dehy 4e-04
cd08245330 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD 6e-04
cd08232339 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase 0.001
cd08258306 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MD 0.003
>gnl|CDD|176203 cd08241, QOR1, Quinone oxidoreductase (QOR) Back     alignment and domain information
 Score =  151 bits (385), Expect = 5e-44
 Identities = 73/195 (37%), Positives = 109/195 (55%), Gaps = 14/195 (7%)

Query: 49  INSSDLLLYNGSGDAKPTLPLVPGFEFSGTVIEVADTKSSSTEEDDEEDVLQVGDKVLAL 108
           +N  DLL+  G    KP LP VPG E +G V  V +  +            +VGD+V+AL
Sbjct: 39  VNFPDLLMIQGKYQVKPPLPFVPGSEVAGVVEAVGEGVTG----------FKVGDRVVAL 88

Query: 109 NKELLHGFSDQCVVHTNDVFKIPEKMTFEHAASLADSYSTAQIVFSRHAKLKEKQTVLVT 168
                 GF+++ VV    VF +P+ ++FE AA+L  +Y TA     R A+L+  +TVLV 
Sbjct: 89  T--GQGGFAEEVVVPAAAVFPLPDGLSFEEAAALPVTYGTAYHALVRRARLQPGETVLVL 146

Query: 169 AAGGGLGLAAVDMATKIYKAKVIGVCNSEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVS 228
            A GG+GLAAV +A K   A+VI   +SE+K  L R  GA   + +  +  L  +V  ++
Sbjct: 147 GAAGGVGLAAVQLA-KALGARVIAAASSEEKLALARALGADHVIDYR-DPDLRERVKALT 204

Query: 229 GGKYANVVFEAVGGE 243
           GG+  +VV++ VGG+
Sbjct: 205 GGRGVDVVYDPVGGD 219


QOR catalyzes the conversion of a quinone + NAD(P)H to a hydroquinone + NAD(P)+. Quinones are cyclic diones derived from aromatic compounds. Membrane bound QOR acts in the respiratory chains of bacteria and mitochondria, while soluble QOR acts to protect from toxic quinones (e.g. DT-diaphorase) or as a soluble eye-lens protein in some vertebrates (e.g. zeta-crystalin). QOR reduces quinones through a semi-quinone intermediate via a NAD(P)H-dependent single electron transfer. QOR is a member of the medium chain dehydrogenase/reductase family, but lacks the zinc-binding sites of the prototypical alcohol dehydrogenases of this group. NAD(P)(H)-dependent oxidoreductases are the major enzymes in the interconversion of alcohols and aldehydes, or ketones. Alcohol dehydrogenase in the liver converts ethanol and NAD+ to acetaldehyde and NADH, while in yeast and some other microorganisms ADH catalyzes the conversion acetaldehyde to ethanol in alcoholic fermentation. ADH is a member of the medium chain alcohol dehydrogenase family (MDR), which has a NAD(P)(H)-binding domain in a Rossmann fold of a beta-alpha form. The NAD(H)-binding region is comprised of 2 structurally similar halves, each of which contacts a mononucleotide. A GxGxxG motif after the first mononucleotide contact half allows the close contact of the coenzyme with the ADH backbone. The N-terminal catalytic domain has a distant homology to GroES. These proteins typically form dimers (typically higher plants, mammals) or tetramers (yeast, bacteria), and have 2 tightly bound zinc atoms per subunit, a catalytic zinc at the active site, and a structural zinc in a lobe of the catalytic domain. NAD(H)-binding occurs in the cleft between the catalytic and coenzyme-binding domains at the active site, and coenzyme binding induces a conformational closing of this cleft. Coenzyme binding typically precedes and contributes to substrate binding. In human ADH catalysis, the zinc ion helps coordinate the alcohol, followed by deprotonation of a histidine, the ribose of NAD, a serine, then the alcohol, which allows the transfer of a hydride to NAD+, creating NADH and a zinc-bound aldehyde or ketone. In yeast and some bacteria, the active site zinc binds an aldehyde, polarizing it, and leading to the reverse reaction. Length = 323

>gnl|CDD|223677 COG0604, Qor, NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>gnl|CDD|176178 cd05188, MDR, Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176229 cd08268, MDR2, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176180 cd05276, p53_inducible_oxidoreductase, PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>gnl|CDD|176236 cd08275, MDR3, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176189 cd05286, QOR2, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176191 cd05289, MDR_like_2, alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>gnl|CDD|176179 cd05195, enoyl_red, enoyl reductase of polyketide synthase Back     alignment and domain information
>gnl|CDD|173547 PTZ00354, PTZ00354, alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|176645 cd05282, ETR_like, 2-enoyl thioester reductase-like Back     alignment and domain information
>gnl|CDD|176215 cd08253, zeta_crystallin, Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|214840 smart00829, PKS_ER, Enoylreductase Back     alignment and domain information
>gnl|CDD|234027 TIGR02824, quinone_pig3, putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>gnl|CDD|176213 cd08251, polyketide_synthase, polyketide synthase Back     alignment and domain information
>gnl|CDD|176227 cd08266, Zn_ADH_like1, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176220 cd08259, Zn_ADH5, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176212 cd08250, Mgc45594_like, Mgc45594 gene product and other MDR family members Back     alignment and domain information
>gnl|CDD|176234 cd08273, MDR8, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176206 cd08244, MDR_enoyl_red, Possible enoyl reductase Back     alignment and domain information
>gnl|CDD|223992 COG1064, AdhP, Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>gnl|CDD|184316 PRK13771, PRK13771, putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223991 COG1063, Tdh, Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|182701 PRK10754, PRK10754, quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>gnl|CDD|176198 cd08236, sugar_DH, NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>gnl|CDD|176216 cd08254, hydroxyacyl_CoA_DH, 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>gnl|CDD|176232 cd08271, MDR5, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176233 cd08272, MDR6, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176221 cd08260, Zn_ADH6, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176235 cd08274, MDR9, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|176222 cd08261, Zn_ADH7, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176210 cd08248, RTN4I1, Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>gnl|CDD|176195 cd08233, butanediol_DH_like, (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>gnl|CDD|176211 cd08249, enoyl_reductase_like, enoyl_reductase_like Back     alignment and domain information
>gnl|CDD|176181 cd05278, FDH_like, Formaldehyde dehydrogenases Back     alignment and domain information
>gnl|CDD|176219 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176257 cd08297, CAD3, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176187 cd05284, arabinose_DH_like, D-arabinose dehydrogenase Back     alignment and domain information
>gnl|CDD|176251 cd08291, ETR_like_1, 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>gnl|CDD|176205 cd08243, quinone_oxidoreductase_like_1, Quinone oxidoreductase (QOR) Back     alignment and domain information
>gnl|CDD|176196 cd08234, threonine_DH_like, L-threonine dehydrogenase Back     alignment and domain information
>gnl|CDD|176183 cd05280, MDR_yhdh_yhfp, Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>gnl|CDD|176193 cd08231, MDR_TM0436_like, Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>gnl|CDD|176224 cd08263, Zn_ADH10, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176250 cd08290, ETR, 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>gnl|CDD|176209 cd08247, AST1_like, AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>gnl|CDD|176230 cd08269, Zn_ADH9, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|188164 TIGR01751, crot-CoA-red, crotonyl-CoA reductase Back     alignment and domain information
>gnl|CDD|234026 TIGR02823, oxido_YhdH, putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>gnl|CDD|176240 cd08279, Zn_ADH_class_III, Class III alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176190 cd05288, PGDH, Prostaglandin dehydrogenases Back     alignment and domain information
>gnl|CDD|176201 cd08239, THR_DH_like, L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>gnl|CDD|176188 cd05285, sorbitol_DH, Sorbitol dehydrogenase Back     alignment and domain information
>gnl|CDD|176218 cd08256, Zn_ADH2, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176217 cd08255, 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like, 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>gnl|CDD|176244 cd08284, FDH_like_2, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>gnl|CDD|176231 cd08270, MDR4, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|223990 COG1062, AdhC, Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|176252 cd08292, ETR_like_2, 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>gnl|CDD|176197 cd08235, iditol_2_DH_like, L-iditol 2-dehydrogenase Back     alignment and domain information
>gnl|CDD|215721 pfam00107, ADH_zinc_N, Zinc-binding dehydrogenase Back     alignment and domain information
>gnl|CDD|176225 cd08264, Zn_ADH_like2, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176243 cd08283, FDH_like_1, Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>gnl|CDD|176237 cd08276, MDR7, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|225041 COG2130, COG2130, Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>gnl|CDD|176248 cd08288, MDR_yhdh, Yhdh putative quinone oxidoreductases Back     alignment and domain information
>gnl|CDD|176249 cd08289, MDR_yhfp_like, Yhfp putative quinone oxidoreductases Back     alignment and domain information
>gnl|CDD|176208 cd08246, crotonyl_coA_red, crotonyl-CoA reductase Back     alignment and domain information
>gnl|CDD|176241 cd08281, liver_ADH_like1, Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>gnl|CDD|176186 cd05283, CAD1, Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>gnl|CDD|176202 cd08240, 6_hydroxyhexanoate_dh_like, 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>gnl|CDD|219758 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like domain Back     alignment and domain information
>gnl|CDD|176245 cd08285, NADP_ADH, NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|219758 pfam08240, ADH_N, Alcohol dehydrogenase GroES-like domain Back     alignment and domain information
>gnl|CDD|176246 cd08286, FDH_like_ADH2, formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>gnl|CDD|131872 TIGR02825, B4_12hDH, leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>gnl|CDD|129775 TIGR00692, tdh, L-threonine 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|176223 cd08262, Zn_ADH8, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176226 cd08265, Zn_ADH3, Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>gnl|CDD|176182 cd05279, Zn_ADH1, Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>gnl|CDD|181842 PRK09422, PRK09422, ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>gnl|CDD|166155 PLN02514, PLN02514, cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176214 cd08252, AL_MDR, Arginate lyase and other MDR family members Back     alignment and domain information
>gnl|CDD|176238 cd08277, liver_alcohol_DH_like, Liver alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|176207 cd08245, CAD, Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>gnl|CDD|176194 cd08232, idonate-5-DH, L-idonate 5-dehydrogenase Back     alignment and domain information
>gnl|CDD|176219 cd08258, Zn_ADH4, Alcohol dehydrogenases of the MDR family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 296
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 100.0
COG0604326 Qor NADPH:quinone reductase and related Zn-depende 100.0
KOG0024|consensus354 100.0
KOG1197|consensus336 100.0
KOG0023|consensus360 100.0
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 100.0
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 100.0
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 100.0
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 100.0
PLN02740381 Alcohol dehydrogenase-like 100.0
TIGR02818368 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydr 100.0
KOG0025|consensus354 100.0
KOG0022|consensus375 100.0
cd08300368 alcohol_DH_class_III class III alcohol dehydrogena 100.0
cd08291324 ETR_like_1 2-enoyl thioester reductase (ETR) like 100.0
PLN02827378 Alcohol dehydrogenase-like 100.0
PRK09880343 L-idonate 5-dehydrogenase; Provisional 100.0
cd08301369 alcohol_DH_plants Plant alcohol dehydrogenase. NAD 100.0
TIGR02819393 fdhA_non_GSH formaldehyde dehydrogenase, glutathio 100.0
cd08292324 ETR_like_2 2-enoyl thioester reductase (ETR) like 100.0
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 100.0
PLN02586360 probable cinnamyl alcohol dehydrogenase 100.0
cd08277365 liver_alcohol_DH_like Liver alcohol dehydrogenase. 100.0
cd08233351 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrog 100.0
cd08237341 ribitol-5-phosphate_DH ribitol-5-phosphate dehydro 100.0
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 100.0
PLN02178375 cinnamyl-alcohol dehydrogenase 100.0
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 100.0
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 100.0
cd08293345 PTGR2 Prostaglandin reductase. Prostaglandins and 100.0
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 100.0
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 100.0
cd08231361 MDR_TM0436_like Hypothetical enzyme TM0436 resembl 100.0
PLN02514357 cinnamyl-alcohol dehydrogenase 100.0
cd08238410 sorbose_phosphate_red L-sorbose-1-phosphate reduct 100.0
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 100.0
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 99.98
PTZ00354334 alcohol dehydrogenase; Provisional 99.98
cd08278365 benzyl_alcohol_DH Benzyl alcohol dehydrogenase. Be 99.98
cd05284340 arabinose_DH_like D-arabinose dehydrogenase. This 99.98
PLN03154348 putative allyl alcohol dehydrogenase; Provisional 99.98
TIGR02817336 adh_fam_1 zinc-binding alcohol dehydrogenase famil 99.98
cd08296333 CAD_like Cinnamyl alcohol dehydrogenases (CAD). Ci 99.98
cd08274350 MDR9 Medium chain dehydrogenases/reductase (MDR)/z 99.98
cd08285351 NADP_ADH NADP(H)-dependent alcohol dehydrogenases. 99.98
cd05278347 FDH_like Formaldehyde dehydrogenases. Formaldehyde 99.97
cd08290341 ETR 2-enoyl thioester reductase (ETR). 2-enoyl thi 99.97
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 99.97
cd08299373 alcohol_DH_class_I_II_IV class I, II, IV alcohol d 99.97
PRK10083339 putative oxidoreductase; Provisional 99.97
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 99.97
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provision 99.97
cd08297341 CAD3 Cinnamyl alcohol dehydrogenases (CAD). These 99.97
cd08244324 MDR_enoyl_red Possible enoyl reductase. Member ide 99.97
cd08286345 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-lik 99.97
cd05280325 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone 99.97
cd08250329 Mgc45594_like Mgc45594 gene product and other MDR 99.97
cd08246393 crotonyl_coA_red crotonyl-CoA reductase. Crotonyl- 99.97
cd08256350 Zn_ADH2 Alcohol dehydrogenases of the MDR family. 99.97
cd08240350 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehy 99.97
KOG1198|consensus347 99.97
cd08263367 Zn_ADH10 Alcohol dehydrogenases of the MDR family. 99.97
cd05282323 ETR_like 2-enoyl thioester reductase-like. 2-enoyl 99.97
cd08261337 Zn_ADH7 Alcohol dehydrogenases of the MDR family. 99.97
cd08279363 Zn_ADH_class_III Class III alcohol dehydrogenase. 99.97
cd08289326 MDR_yhfp_like Yhfp putative quinone oxidoreductase 99.97
cd05279365 Zn_ADH1 Liver alcohol dehydrogenase and related zi 99.97
cd08258306 Zn_ADH4 Alcohol dehydrogenases of the MDR family. 99.97
cd08235343 iditol_2_DH_like L-iditol 2-dehydrogenase. Putativ 99.97
cd08243320 quinone_oxidoreductase_like_1 Quinone oxidoreducta 99.97
cd08260345 Zn_ADH6 Alcohol dehydrogenases of the MDR family. 99.97
cd08249339 enoyl_reductase_like enoyl_reductase_like. Member 99.97
cd08276336 MDR7 Medium chain dehydrogenases/reductase (MDR)/z 99.97
cd08284344 FDH_like_2 Glutathione-dependent formaldehyde dehy 99.97
PRK09422338 ethanol-active dehydrogenase/acetaldehyde-active r 99.97
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 99.97
cd08236343 sugar_DH NAD(P)-dependent sugar dehydrogenases. Th 99.97
cd05276323 p53_inducible_oxidoreductase PIG3 p53-inducible qu 99.97
cd08282375 PFDH_like Pseudomonas putida aldehyde-dismutating 99.97
cd08251303 polyketide_synthase polyketide synthase. Polyketid 99.97
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 99.96
cd08252336 AL_MDR Arginate lyase and other MDR family members 99.96
cd08272326 MDR6 Medium chain dehydrogenases/reductase (MDR)/z 99.96
cd08287345 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-lik 99.96
cd08259332 Zn_ADH5 Alcohol dehydrogenases of the MDR family. 99.96
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 99.96
cd08262341 Zn_ADH8 Alcohol dehydrogenases of the MDR family. 99.96
cd08248350 RTN4I1 Human Reticulon 4 Interacting Protein 1. Hu 99.96
cd05283337 CAD1 Cinnamyl alcohol dehydrogenases (CAD). Cinnam 99.96
cd05188271 MDR Medium chain reductase/dehydrogenase (MDR)/zin 99.96
TIGR02823323 oxido_YhdH putative quinone oxidoreductase, YhdH/Y 99.96
PRK13771334 putative alcohol dehydrogenase; Provisional 99.96
TIGR01751398 crot-CoA-red crotonyl-CoA reductase. The enzyme mo 99.96
cd05285343 sorbitol_DH Sorbitol dehydrogenase. Sorbitol and a 99.96
TIGR02824325 quinone_pig3 putative NAD(P)H quinone oxidoreducta 99.96
cd08266342 Zn_ADH_like1 Alcohol dehydrogenases of the MDR fam 99.96
cd08265384 Zn_ADH3 Alcohol dehydrogenases of the MDR family. 99.96
cd08234334 threonine_DH_like L-threonine dehydrogenase. L-thr 99.96
cd08271325 MDR5 Medium chain dehydrogenases/reductase (MDR)/z 99.96
cd05286320 QOR2 Quinone oxidoreductase (QOR). Quinone oxidore 99.96
cd08247352 AST1_like AST1 is a cytoplasmic protein associated 99.96
cd08268328 MDR2 Medium chain dehydrogenases/reductase (MDR)/z 99.96
cd08270305 MDR4 Medium chain dehydrogenases/reductase (MDR)/z 99.96
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 99.96
cd08269312 Zn_ADH9 Alcohol dehydrogenases of the MDR family. 99.96
PLN02702364 L-idonate 5-dehydrogenase 99.96
cd08273331 MDR8 Medium chain dehydrogenases/reductase (MDR)/z 99.96
COG2130340 Putative NADP-dependent oxidoreductases [General f 99.96
cd08264325 Zn_ADH_like2 Alcohol dehydrogenases of the MDR fam 99.96
cd08298329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 99.96
cd08288324 MDR_yhdh Yhdh putative quinone oxidoreductases. Yh 99.96
cd05281341 TDH Threonine dehydrogenase. L-threonine dehydroge 99.96
cd05195293 enoyl_red enoyl reductase of polyketide synthase. 99.95
TIGR00692340 tdh L-threonine 3-dehydrogenase. E. coli His-90 mo 99.95
cd08241323 QOR1 Quinone oxidoreductase (QOR). QOR catalyzes t 99.95
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 99.95
cd05289309 MDR_like_2 alcohol dehydrogenase and quinone reduc 99.95
cd08245330 CAD Cinnamyl alcohol dehydrogenases (CAD) and rela 99.95
cd05288329 PGDH Prostaglandin dehydrogenases. Prostaglandins 99.95
cd08232339 idonate-5-DH L-idonate 5-dehydrogenase. L-idonate 99.95
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketid 99.94
cd08267319 MDR1 Medium chain dehydrogenases/reductase (MDR)/z 99.94
cd08275337 MDR3 Medium chain dehydrogenases/reductase (MDR)/z 99.94
KOG1196|consensus343 99.9
cd08255277 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_ 99.87
KOG1202|consensus 2376 99.85
PF08240109 ADH_N: Alcohol dehydrogenase GroES-like domain; In 99.72
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 99.49
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 98.73
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 98.43
COG4221 246 Short-chain alcohol dehydrogenase of unknown speci 97.9
TIGR00561 511 pntA NAD(P) transhydrogenase, alpha subunit. In so 97.7
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 97.57
COG0300 265 DltE Short-chain dehydrogenases of various substra 97.51
PRK05993 277 short chain dehydrogenase; Provisional 97.39
TIGR00936406 ahcY adenosylhomocysteinase. This enzyme hydrolyze 97.34
PRK05693 274 short chain dehydrogenase; Provisional 97.31
PRK06182 273 short chain dehydrogenase; Validated 97.31
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 97.3
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 97.29
PRK08324 681 short chain dehydrogenase; Validated 97.17
COG3967 245 DltE Short-chain dehydrogenase involved in D-alani 97.15
PRK06139 330 short chain dehydrogenase; Provisional 97.15
PRK08306296 dipicolinate synthase subunit A; Reviewed 97.13
PRK07904 253 short chain dehydrogenase; Provisional 97.11
PRK08339 263 short chain dehydrogenase; Provisional 97.08
PLN02494 477 adenosylhomocysteinase 97.08
PRK05872 296 short chain dehydrogenase; Provisional 97.05
TIGR03325 262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 97.04
PRK07060 245 short chain dehydrogenase; Provisional 97.04
PRK08017 256 oxidoreductase; Provisional 96.99
PRK08177225 short chain dehydrogenase; Provisional 96.98
PRK07825 273 short chain dehydrogenase; Provisional 96.97
PRK06200 263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 96.97
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.97
PRK07831 262 short chain dehydrogenase; Provisional 96.91
PRK06057 255 short chain dehydrogenase; Provisional 96.88
PRK12742237 oxidoreductase; Provisional 96.85
PRK09072 263 short chain dehydrogenase; Provisional 96.84
PRK12771 564 putative glutamate synthase (NADPH) small subunit; 96.84
PRK07231 251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.83
PRK07024 257 short chain dehydrogenase; Provisional 96.82
PRK06180 277 short chain dehydrogenase; Provisional 96.82
PRK06953222 short chain dehydrogenase; Provisional 96.82
PRK06196 315 oxidoreductase; Provisional 96.81
PLN02780 320 ketoreductase/ oxidoreductase 96.8
PRK08267 260 short chain dehydrogenase; Provisional 96.77
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 96.77
PRK06949 258 short chain dehydrogenase; Provisional 96.74
PRK12828239 short chain dehydrogenase; Provisional 96.73
PRK08217 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.73
PRK06841 255 short chain dehydrogenase; Provisional 96.73
PLN03209 576 translocon at the inner envelope of chloroplast su 96.72
PRK08265 261 short chain dehydrogenase; Provisional 96.68
PRK07062 265 short chain dehydrogenase; Provisional 96.68
PRK00045 423 hemA glutamyl-tRNA reductase; Reviewed 96.67
PRK12829 264 short chain dehydrogenase; Provisional 96.65
PRK05866 293 short chain dehydrogenase; Provisional 96.64
PRK05867 253 short chain dehydrogenase; Provisional 96.63
TIGR01832 248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 96.63
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 96.63
PRK06483236 dihydromonapterin reductase; Provisional 96.62
PRK07523 255 gluconate 5-dehydrogenase; Provisional 96.61
PRK09291 257 short chain dehydrogenase; Provisional 96.6
PRK07577 234 short chain dehydrogenase; Provisional 96.6
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 96.59
PRK07814 263 short chain dehydrogenase; Provisional 96.59
PRK07326237 short chain dehydrogenase; Provisional 96.58
PRK08862227 short chain dehydrogenase; Provisional 96.57
PRK07478 254 short chain dehydrogenase; Provisional 96.57
PRK05854 313 short chain dehydrogenase; Provisional 96.55
KOG1205|consensus 282 96.54
KOG1014|consensus 312 96.53
PRK07774 250 short chain dehydrogenase; Provisional 96.5
PRK06500 249 short chain dehydrogenase; Provisional 96.5
PRK05717 255 oxidoreductase; Validated 96.49
PRK06079 252 enoyl-(acyl carrier protein) reductase; Provisiona 96.49
PRK06194 287 hypothetical protein; Provisional 96.49
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.47
PRK07109 334 short chain dehydrogenase; Provisional 96.47
PRK04148134 hypothetical protein; Provisional 96.46
PRK08589 272 short chain dehydrogenase; Validated 96.46
PRK07890 258 short chain dehydrogenase; Provisional 96.45
PRK12481 251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 96.45
PTZ00075 476 Adenosylhomocysteinase; Provisional 96.45
PRK06179 270 short chain dehydrogenase; Provisional 96.44
PRK12939 250 short chain dehydrogenase; Provisional 96.43
KOG0725|consensus 270 96.43
PRK07454241 short chain dehydrogenase; Provisional 96.42
PRK06463 255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.41
PRK08628 258 short chain dehydrogenase; Provisional 96.4
PRK06505 271 enoyl-(acyl carrier protein) reductase; Provisiona 96.4
PRK06138 252 short chain dehydrogenase; Provisional 96.39
PLN02253 280 xanthoxin dehydrogenase 96.39
PRK07677 252 short chain dehydrogenase; Provisional 96.37
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 96.37
PRK07035 252 short chain dehydrogenase; Provisional 96.37
PRK08213 259 gluconate 5-dehydrogenase; Provisional 96.36
PRK07576 264 short chain dehydrogenase; Provisional 96.36
PRK05876 275 short chain dehydrogenase; Provisional 96.35
PRK06125 259 short chain dehydrogenase; Provisional 96.33
PRK13394 262 3-hydroxybutyrate dehydrogenase; Provisional 96.33
PRK05884223 short chain dehydrogenase; Provisional 96.33
PRK07453 322 protochlorophyllide oxidoreductase; Validated 96.32
PRK10538 248 malonic semialdehyde reductase; Provisional 96.31
PRK07063 260 short chain dehydrogenase; Provisional 96.3
KOG1201|consensus 300 96.3
PRK08264 238 short chain dehydrogenase; Validated 96.3
PRK09186 256 flagellin modification protein A; Provisional 96.29
PRK08340 259 glucose-1-dehydrogenase; Provisional 96.28
PRK12823 260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 96.27
PRK06482 276 short chain dehydrogenase; Provisional 96.27
PRK07533 258 enoyl-(acyl carrier protein) reductase; Provisiona 96.26
PRK06398 258 aldose dehydrogenase; Validated 96.25
PRK06181 263 short chain dehydrogenase; Provisional 96.25
PRK12367 245 short chain dehydrogenase; Provisional 96.24
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 96.24
PRK06172 253 short chain dehydrogenase; Provisional 96.24
PRK06114 254 short chain dehydrogenase; Provisional 96.22
PRK07832 272 short chain dehydrogenase; Provisional 96.22
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 96.17
PRK08415 274 enoyl-(acyl carrier protein) reductase; Provisiona 96.16
PRK06603 260 enoyl-(acyl carrier protein) reductase; Provisiona 96.15
PRK08643 256 acetoin reductase; Validated 96.15
PRK09242 257 tropinone reductase; Provisional 96.15
PRK07856 252 short chain dehydrogenase; Provisional 96.15
PRK08263 275 short chain dehydrogenase; Provisional 96.15
PRK06198 260 short chain dehydrogenase; Provisional 96.14
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 96.13
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 96.13
PRK06197 306 short chain dehydrogenase; Provisional 96.13
PRK07791 286 short chain dehydrogenase; Provisional 96.12
PRK07074 257 short chain dehydrogenase; Provisional 96.12
PRK06101 240 short chain dehydrogenase; Provisional 96.11
PRK08251 248 short chain dehydrogenase; Provisional 96.07
PRK07067 257 sorbitol dehydrogenase; Provisional 96.06
PRK12384 259 sorbitol-6-phosphate dehydrogenase; Provisional 96.06
PRK12826 251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 96.05
PRK07806248 short chain dehydrogenase; Provisional 96.05
PRK06523 260 short chain dehydrogenase; Provisional 96.04
PRK06720169 hypothetical protein; Provisional 96.04
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 96.03
PRK08993 253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 96.03
CHL00194 317 ycf39 Ycf39; Provisional 96.03
PRK08226 263 short chain dehydrogenase; Provisional 96.03
PRK08303 305 short chain dehydrogenase; Provisional 96.02
PRK08085 254 gluconate 5-dehydrogenase; Provisional 96.02
PRK08690 261 enoyl-(acyl carrier protein) reductase; Provisiona 96.01
PRK08703239 short chain dehydrogenase; Provisional 96.01
PRK06124 256 gluconate 5-dehydrogenase; Provisional 96.0
PRK06484 520 short chain dehydrogenase; Validated 96.0
PRK07984 262 enoyl-(acyl carrier protein) reductase; Provisiona 95.99
PRK08278 273 short chain dehydrogenase; Provisional 95.97
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 95.96
PRK08277 278 D-mannonate oxidoreductase; Provisional 95.96
KOG1209|consensus 289 95.96
PRK07097 265 gluconate 5-dehydrogenase; Provisional 95.96
PRK07424406 bifunctional sterol desaturase/short chain dehydro 95.96
PRK06914 280 short chain dehydrogenase; Provisional 95.95
PRK06484 520 short chain dehydrogenase; Validated 95.93
PRK06935 258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 95.91
PRK12429 258 3-hydroxybutyrate dehydrogenase; Provisional 95.88
PRK12743 256 oxidoreductase; Provisional 95.86
PRK07889 256 enoyl-(acyl carrier protein) reductase; Provisiona 95.83
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 95.83
PRK05875 276 short chain dehydrogenase; Provisional 95.82
PLN00141 251 Tic62-NAD(P)-related group II protein; Provisional 95.82
TIGR02632 676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 95.82
PRK08159 272 enoyl-(acyl carrier protein) reductase; Provisiona 95.81
PRK05557 248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.81
TIGR03206 250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 95.79
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.79
PRK06128 300 oxidoreductase; Provisional 95.77
PRK08594 257 enoyl-(acyl carrier protein) reductase; Provisiona 95.77
PRK12936 245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 95.74
PF11017314 DUF2855: Protein of unknown function (DUF2855); In 95.71
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.71
PF02670129 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re 95.69
PRK05650 270 short chain dehydrogenase; Provisional 95.67
TIGR01963 255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 95.67
PRK12938 246 acetyacetyl-CoA reductase; Provisional 95.67
PRK08219227 short chain dehydrogenase; Provisional 95.66
PRK07102 243 short chain dehydrogenase; Provisional 95.6
PRK07792 306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.6
PRK06113 255 7-alpha-hydroxysteroid dehydrogenase; Validated 95.6
PRK07370 258 enoyl-(acyl carrier protein) reductase; Validated 95.6
TIGR01035 417 hemA glutamyl-tRNA reductase. This enzyme, togethe 95.58
PRK06171 266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 95.52
PF05368 233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 95.5
PRK08063 250 enoyl-(acyl carrier protein) reductase; Provisiona 95.48
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 95.46
PRK08416 260 7-alpha-hydroxysteroid dehydrogenase; Provisional 95.46
TIGR01289 314 LPOR light-dependent protochlorophyllide reductase 95.43
PRK12746254 short chain dehydrogenase; Provisional 95.42
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 95.42
PRK09135249 pteridine reductase; Provisional 95.41
PRK06701 290 short chain dehydrogenase; Provisional 95.32
PRK12937245 short chain dehydrogenase; Provisional 95.29
KOG1208|consensus 314 95.28
PRK07775 274 short chain dehydrogenase; Provisional 95.28
PRK12745 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.27
PRK06940 275 short chain dehydrogenase; Provisional 95.26
PRK05599 246 hypothetical protein; Provisional 95.26
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 95.25
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 95.23
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.22
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 95.22
PRK08642 253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.19
PRK07201 657 short chain dehydrogenase; Provisional 95.19
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 95.13
PRK12747252 short chain dehydrogenase; Provisional 95.13
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 95.11
PRK06997 260 enoyl-(acyl carrier protein) reductase; Provisiona 95.11
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 95.09
PRK12935247 acetoacetyl-CoA reductase; Provisional 95.09
COG2910211 Putative NADH-flavin reductase [General function p 95.08
PRK07985 294 oxidoreductase; Provisional 95.08
PRK08936 261 glucose-1-dehydrogenase; Provisional 95.05
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 95.03
PRK05855 582 short chain dehydrogenase; Validated 95.03
PRK08220 252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 95.03
PRK06077 252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 95.03
PRK09134 258 short chain dehydrogenase; Provisional 95.01
TIGR00438188 rrmJ cell division protein FtsJ. 94.97
TIGR02415 254 23BDH acetoin reductases. One member of this famil 94.91
PRK12825 249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.85
PRK07023 243 short chain dehydrogenase; Provisional 94.84
KOG1210|consensus 331 94.83
PRK12744 257 short chain dehydrogenase; Provisional 94.81
PRK07069 251 short chain dehydrogenase; Validated 94.8
PRK05447 385 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 94.78
PLN02653 340 GDP-mannose 4,6-dehydratase 94.74
PRK13943 322 protein-L-isoaspartate O-methyltransferase; Provis 94.7
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 94.68
PLN02986 322 cinnamyl-alcohol dehydrogenase family protein 94.65
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 94.62
COG4122219 Predicted O-methyltransferase [General function pr 94.57
TIGR00507270 aroE shikimate 5-dehydrogenase. This model finds p 94.55
TIGR02685 267 pter_reduc_Leis pteridine reductase. Pteridine red 94.55
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 94.53
PRK06947 248 glucose-1-dehydrogenase; Provisional 94.53
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 94.52
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 94.52
PRK07041230 short chain dehydrogenase; Provisional 94.51
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 94.5
PLN02989 325 cinnamyl-alcohol dehydrogenase family protein 94.5
PRK09730 247 putative NAD(P)-binding oxidoreductase; Provisiona 94.43
PLN02896 353 cinnamyl-alcohol dehydrogenase 94.41
PRK13940 414 glutamyl-tRNA reductase; Provisional 94.35
PRK12827249 short chain dehydrogenase; Provisional 94.32
KOG4022|consensus236 94.31
TIGR03649 285 ergot_EASG ergot alkaloid biosynthesis protein, AF 94.27
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 94.22
PRK06550 235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 94.19
COG1028 251 FabG Dehydrogenases with different specificities ( 94.19
TIGR01500 256 sepiapter_red sepiapterin reductase. This model de 94.04
PLN02427 386 UDP-apiose/xylose synthase 94.03
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 94.02
PLN02214 342 cinnamoyl-CoA reductase 94.01
KOG1200|consensus 256 93.99
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 93.98
KOG1610|consensus 322 93.93
PRK12824 245 acetoacetyl-CoA reductase; Provisional 93.91
PF01370 236 Epimerase: NAD dependent epimerase/dehydratase fam 93.89
PRK12748 256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 93.87
PRK12548289 shikimate 5-dehydrogenase; Provisional 93.82
PRK06123 248 short chain dehydrogenase; Provisional 93.81
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 93.81
PLN02240 352 UDP-glucose 4-epimerase 93.73
KOG4169|consensus 261 93.67
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 93.66
PF04321 286 RmlD_sub_bind: RmlD substrate binding domain; Inte 93.62
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 93.62
TIGR00715 256 precor6x_red precorrin-6x reductase. This enzyme w 93.46
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 93.45
TIGR01214 287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 93.44
KOG1199|consensus 260 93.43
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 93.35
PLN00015 308 protochlorophyllide reductase 93.33
PRK11908 347 NAD-dependent epimerase/dehydratase family protein 93.32
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 93.3
PRK07578199 short chain dehydrogenase; Provisional 93.27
PLN02686 367 cinnamoyl-CoA reductase 93.25
PRK06924 251 short chain dehydrogenase; Provisional 93.25
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 93.23
PLN02662 322 cinnamyl-alcohol dehydrogenase family protein 93.2
PLN02589247 caffeoyl-CoA O-methyltransferase 93.18
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 93.16
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 93.15
TIGR01181 317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 93.07
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 93.01
PLN00016 378 RNA-binding protein; Provisional 92.98
PLN02696 454 1-deoxy-D-xylulose-5-phosphate reductoisomerase 92.93
PRK13656 398 trans-2-enoyl-CoA reductase; Provisional 92.81
PLN02650 351 dihydroflavonol-4-reductase 92.77
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 92.75
TIGR01318 467 gltD_gamma_fam glutamate synthase small subunit fa 92.72
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 92.71
KOG1502|consensus 327 92.67
PLN00198 338 anthocyanidin reductase; Provisional 92.64
PRK02472 447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.61
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 92.57
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 92.51
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 92.5
PRK10675 338 UDP-galactose-4-epimerase; Provisional 92.48
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 92.46
PLN02476278 O-methyltransferase 92.44
PRK06719157 precorrin-2 dehydrogenase; Validated 92.44
TIGR01179 328 galE UDP-glucose-4-epimerase. This enzyme intercon 92.43
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 92.42
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 92.42
PLN02583 297 cinnamoyl-CoA reductase 92.4
PF13602127 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQ 92.35
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 92.33
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 92.33
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 92.26
KOG1207|consensus 245 92.17
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 92.14
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 92.06
PRK06718202 precorrin-2 dehydrogenase; Reviewed 92.04
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 92.01
PRK06849 389 hypothetical protein; Provisional 92.01
PLN02695 370 GDP-D-mannose-3',5'-epimerase 92.0
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 91.99
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 91.91
PRK08309177 short chain dehydrogenase; Provisional 91.89
smart00822180 PKS_KR This enzymatic domain is part of bacterial 91.87
TIGR00243 389 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomeras 91.72
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 91.7
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 91.7
PF02719 293 Polysacc_synt_2: Polysaccharide biosynthesis prote 91.6
TIGR02197 314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 91.58
TIGR01777 292 yfcH conserved hypothetical protein TIGR01777. Thi 91.52
PRK00258278 aroE shikimate 5-dehydrogenase; Reviewed 91.48
PRK12549284 shikimate 5-dehydrogenase; Reviewed 91.44
COG0702 275 Predicted nucleoside-diphosphate-sugar epimerases 91.39
COG0031 300 CysK Cysteine synthase [Amino acid transport and m 91.32
COG0569225 TrkA K+ transport systems, NAD-binding component [ 91.3
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 91.29
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 91.28
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 91.24
COG1179263 Dinucleotide-utilizing enzymes involved in molybdo 91.23
PRK09987 299 dTDP-4-dehydrorhamnose reductase; Provisional 91.2
PRK12475 338 thiamine/molybdopterin biosynthesis MoeB-like prot 91.19
PRK12550272 shikimate 5-dehydrogenase; Reviewed 91.14
PLN02730 303 enoyl-[acyl-carrier-protein] reductase 91.14
COG0169283 AroE Shikimate 5-dehydrogenase [Amino acid transpo 90.94
PRK09620229 hypothetical protein; Provisional 90.91
KOG1252|consensus 362 90.89
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 90.87
PLN02572 442 UDP-sulfoquinovose synthase 90.86
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 90.71
PRK14967223 putative methyltransferase; Provisional 90.57
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 90.54
KOG1611|consensus 249 90.53
PRK07688 339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 90.49
PRK04457262 spermidine synthase; Provisional 90.34
COG1090 297 Predicted nucleoside-diphosphate sugar epimerase [ 90.32
PRK03562621 glutathione-regulated potassium-efflux system prot 90.31
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.28
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 90.25
PF07991165 IlvN: Acetohydroxy acid isomeroreductase, catalyti 90.22
PRK14027283 quinate/shikimate dehydrogenase; Provisional 90.16
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 90.01
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 90.0
PRK14874 334 aspartate-semialdehyde dehydrogenase; Provisional 89.86
PLN00203 519 glutamyl-tRNA reductase 89.82
TIGR01809282 Shik-DH-AROM shikimate-5-dehydrogenase, fungal ARO 89.75
PRK11150 308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 89.73
PRK08618325 ornithine cyclodeaminase; Validated 89.69
PRK09310477 aroDE bifunctional 3-dehydroquinate dehydratase/sh 89.59
COG0373 414 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] 89.58
PLN03013 429 cysteine synthase 89.53
PRK10669558 putative cation:proton antiport protein; Provision 89.45
PF13561 241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 89.34
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 89.32
PRK09009 235 C factor cell-cell signaling protein; Provisional 89.32
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 89.09
COG1087 329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 89.01
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 88.97
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
Probab=100.00  E-value=8.3e-44  Score=318.47  Aligned_cols=241  Identities=27%  Similarity=0.357  Sum_probs=216.0

Q ss_pred             CCcceEEecCCCCC-----CCCCCCCCCCCCCCcEEEEeeeeecChhhHHHHcCCCCCCCCCCCcCCCceeEEEEEEccC
Q psy1959          11 NSSDLLLYNGSGDA-----KPTLPLVPGFEFSGTIIEKKMMTRINSSDLLLYNGSGDAKPTLPLVPGFEFSGTVIEVADT   85 (296)
Q Consensus        11 ~~~~~~~~~~~~~~-----~~~p~~~~~~~~~~evlvkv~~~~i~~~D~~~~~g~~~~~~~~p~~~G~e~~G~V~~v~~~   85 (296)
                      -+||++++.+.+++     ++.|.|+|+     ||+|||.|+|+|++|++.++|.++.. .+|++||||.+|+|+++   
T Consensus         2 ~~mkA~~~~~~~~pl~i~e~~~p~p~~~-----eVlI~v~~~GVChsDlH~~~G~~~~~-~~P~ipGHEivG~V~~v---   72 (339)
T COG1064           2 MTMKAAVLKKFGQPLEIEEVPVPEPGPG-----EVLIKVEACGVCHTDLHVAKGDWPVP-KLPLIPGHEIVGTVVEV---   72 (339)
T ss_pred             cceEEEEEccCCCCceEEeccCCCCCCC-----eEEEEEEEEeecchhhhhhcCCCCCC-CCCccCCcceEEEEEEe---
Confidence            36899999998885     678889999     99999999999999999999999884 49999999999999999   


Q ss_pred             CCCCCCCCCCCCCCCCCCEEEE-ecC-------------------------CCCCcccceEeeeCCceEECCCCCCHHHH
Q psy1959          86 KSSSTEEDDEEDVLQVGDKVLA-LNK-------------------------ELLHGFSDQCVVHTNDVFKIPEKMTFEHA  139 (296)
Q Consensus        86 ~~~~~~~g~~v~~~~~Gd~V~~-~~~-------------------------~~~g~~~~~~~v~~~~~~~iP~~~~~~~a  139 (296)
                             |++|++|++||||.. +..                         ..+|+|+||+++|+.+++++|++++++.|
T Consensus        73 -------G~~V~~~k~GDrVgV~~~~~~Cg~C~~C~~G~E~~C~~~~~~gy~~~GGyaeyv~v~~~~~~~iP~~~d~~~a  145 (339)
T COG1064          73 -------GEGVTGLKVGDRVGVGWLVISCGECEYCRSGNENLCPNQKITGYTTDGGYAEYVVVPARYVVKIPEGLDLAEA  145 (339)
T ss_pred             -------cCCCccCCCCCEEEecCccCCCCCCccccCcccccCCCccccceeecCcceeEEEEchHHeEECCCCCChhhh
Confidence                   999999999999996 211                         23799999999999999999999999999


Q ss_pred             hhhccHHHHHHHHHHHHcCCCCCcEEEEEcCCCcHHHHHHHHHHHhCCCEEEEEeCCcchHHHHHhcCCcEEEEcCCchh
Q psy1959         140 ASLADSYSTAQIVFSRHAKLKEKQTVLVTAAGGGLGLAAVDMATKIYKAKVIGVCNSEDKTDLIRQKGAWAALTFTNEKS  219 (296)
Q Consensus       140 a~l~~~~~ta~~~l~~~~~~~~g~~vlI~Ga~g~vG~aa~~la~~~~g~~Vi~~~~~~~~~~~~~~~g~~~~~~~~~~~~  219 (296)
                      |.|.+++.|.|++| +.++++||++|+|.|+ |++|++++|+| +.+|++|++++++++|++.++++|++.+++.++ .+
T Consensus       146 ApllCaGiT~y~al-k~~~~~pG~~V~I~G~-GGlGh~avQ~A-ka~ga~Via~~~~~~K~e~a~~lGAd~~i~~~~-~~  221 (339)
T COG1064         146 APLLCAGITTYRAL-KKANVKPGKWVAVVGA-GGLGHMAVQYA-KAMGAEVIAITRSEEKLELAKKLGADHVINSSD-SD  221 (339)
T ss_pred             hhhhcCeeeEeeeh-hhcCCCCCCEEEEECC-cHHHHHHHHHH-HHcCCeEEEEeCChHHHHHHHHhCCcEEEEcCC-ch
Confidence            99999999999999 6699999999999998 89999999999 778999999999999999999999999999875 66


Q ss_pred             HHHHHHHHhCCCcccEEEECCCCccHHHHHHHhhccCceEE------------eecccceeeeeEEeccc
Q psy1959         220 LVNKVLEVSGGKYANVVFEAVGGEDKTDLIRQKGAWAALTF------------TNEKSLVNKVLEVSGGK  277 (296)
Q Consensus       220 ~~~~i~~~~~~~g~d~vld~~g~~~~~~~~~~lg~~~g~~~------------~~~~~~~~k~~~i~g~~  277 (296)
                      ..+.+.+.     +|+++|+++..+++.++++| +++|++.            ++...++.++++|.||.
T Consensus       222 ~~~~~~~~-----~d~ii~tv~~~~~~~~l~~l-~~~G~~v~vG~~~~~~~~~~~~~~li~~~~~i~GS~  285 (339)
T COG1064         222 ALEAVKEI-----ADAIIDTVGPATLEPSLKAL-RRGGTLVLVGLPGGGPIPLLPAFLLILKEISIVGSL  285 (339)
T ss_pred             hhHHhHhh-----CcEEEECCChhhHHHHHHHH-hcCCEEEEECCCCCcccCCCCHHHhhhcCeEEEEEe
Confidence            66666553     99999999977999999999 8887762            22345788999999987



>COG0604 Qor NADPH:quinone reductase and related Zn-dependent oxidoreductases [Energy production and conversion / General function prediction only] Back     alignment and domain information
>KOG0024|consensus Back     alignment and domain information
>KOG1197|consensus Back     alignment and domain information
>KOG0023|consensus Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>TIGR02818 adh_III_F_hyde S-(hydroxymethyl)glutathione dehydrogenase/class III alcohol dehydrogenase Back     alignment and domain information
>KOG0025|consensus Back     alignment and domain information
>KOG0022|consensus Back     alignment and domain information
>cd08300 alcohol_DH_class_III class III alcohol dehydrogenases Back     alignment and domain information
>cd08291 ETR_like_1 2-enoyl thioester reductase (ETR) like proteins, child 1 Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>cd08301 alcohol_DH_plants Plant alcohol dehydrogenase Back     alignment and domain information
>TIGR02819 fdhA_non_GSH formaldehyde dehydrogenase, glutathione-independent Back     alignment and domain information
>cd08292 ETR_like_2 2-enoyl thioester reductase (ETR) like proteins, child 2 Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>cd08277 liver_alcohol_DH_like Liver alcohol dehydrogenase Back     alignment and domain information
>cd08233 butanediol_DH_like (2R,3R)-2,3-butanediol dehydrogenase Back     alignment and domain information
>cd08237 ribitol-5-phosphate_DH ribitol-5-phosphate dehydrogenase Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PLN02178 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>cd08293 PTGR2 Prostaglandin reductase Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08231 MDR_TM0436_like Hypothetical enzyme TM0436 resembles the zinc-dependent alcohol dehydrogenases (ADH) Back     alignment and domain information
>PLN02514 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>cd08238 sorbose_phosphate_red L-sorbose-1-phosphate reductase Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PTZ00354 alcohol dehydrogenase; Provisional Back     alignment and domain information
>cd08278 benzyl_alcohol_DH Benzyl alcohol dehydrogenase Back     alignment and domain information
>cd05284 arabinose_DH_like D-arabinose dehydrogenase Back     alignment and domain information
>PLN03154 putative allyl alcohol dehydrogenase; Provisional Back     alignment and domain information
>TIGR02817 adh_fam_1 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>cd08296 CAD_like Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08274 MDR9 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08285 NADP_ADH NADP(H)-dependent alcohol dehydrogenases Back     alignment and domain information
>cd05278 FDH_like Formaldehyde dehydrogenases Back     alignment and domain information
>cd08290 ETR 2-enoyl thioester reductase (ETR) Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>cd08299 alcohol_DH_class_I_II_IV class I, II, IV alcohol dehydrogenases Back     alignment and domain information
>PRK10083 putative oxidoreductase; Provisional Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>PRK10754 quinone oxidoreductase, NADPH-dependent; Provisional Back     alignment and domain information
>cd08297 CAD3 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08244 MDR_enoyl_red Possible enoyl reductase Back     alignment and domain information
>cd08286 FDH_like_ADH2 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd05280 MDR_yhdh_yhfp Yhdh and yhfp-like putative quinone oxidoreductases Back     alignment and domain information
>cd08250 Mgc45594_like Mgc45594 gene product and other MDR family members Back     alignment and domain information
>cd08246 crotonyl_coA_red crotonyl-CoA reductase Back     alignment and domain information
>cd08256 Zn_ADH2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08240 6_hydroxyhexanoate_dh_like 6-hydroxyhexanoate dehydrogenase Back     alignment and domain information
>KOG1198|consensus Back     alignment and domain information
>cd08263 Zn_ADH10 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd05282 ETR_like 2-enoyl thioester reductase-like Back     alignment and domain information
>cd08261 Zn_ADH7 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08279 Zn_ADH_class_III Class III alcohol dehydrogenase Back     alignment and domain information
>cd08289 MDR_yhfp_like Yhfp putative quinone oxidoreductases Back     alignment and domain information
>cd05279 Zn_ADH1 Liver alcohol dehydrogenase and related zinc-dependent alcohol dehydrogenases Back     alignment and domain information
>cd08258 Zn_ADH4 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08235 iditol_2_DH_like L-iditol 2-dehydrogenase Back     alignment and domain information
>cd08243 quinone_oxidoreductase_like_1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08260 Zn_ADH6 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08249 enoyl_reductase_like enoyl_reductase_like Back     alignment and domain information
>cd08276 MDR7 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08284 FDH_like_2 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 2 Back     alignment and domain information
>PRK09422 ethanol-active dehydrogenase/acetaldehyde-active reductase; Provisional Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>cd08236 sugar_DH NAD(P)-dependent sugar dehydrogenases Back     alignment and domain information
>cd05276 p53_inducible_oxidoreductase PIG3 p53-inducible quinone oxidoreductase Back     alignment and domain information
>cd08282 PFDH_like Pseudomonas putida aldehyde-dismutating formaldehyde dehydrogenase (PFDH) Back     alignment and domain information
>cd08251 polyketide_synthase polyketide synthase Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>cd08252 AL_MDR Arginate lyase and other MDR family members Back     alignment and domain information
>cd08272 MDR6 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08287 FDH_like_ADH3 formaldehyde dehydrogenase (FDH)-like Back     alignment and domain information
>cd08259 Zn_ADH5 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PRK05396 tdh L-threonine 3-dehydrogenase; Validated Back     alignment and domain information
>cd08262 Zn_ADH8 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08248 RTN4I1 Human Reticulon 4 Interacting Protein 1 Back     alignment and domain information
>cd05283 CAD1 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd05188 MDR Medium chain reductase/dehydrogenase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>TIGR02823 oxido_YhdH putative quinone oxidoreductase, YhdH/YhfP family Back     alignment and domain information
>PRK13771 putative alcohol dehydrogenase; Provisional Back     alignment and domain information
>TIGR01751 crot-CoA-red crotonyl-CoA reductase Back     alignment and domain information
>cd05285 sorbitol_DH Sorbitol dehydrogenase Back     alignment and domain information
>TIGR02824 quinone_pig3 putative NAD(P)H quinone oxidoreductase, PIG3 family Back     alignment and domain information
>cd08266 Zn_ADH_like1 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08265 Zn_ADH3 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08234 threonine_DH_like L-threonine dehydrogenase Back     alignment and domain information
>cd08271 MDR5 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd05286 QOR2 Quinone oxidoreductase (QOR) Back     alignment and domain information
>cd08247 AST1_like AST1 is a cytoplasmic protein associated with the periplasmic membrane in yeast Back     alignment and domain information
>cd08268 MDR2 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08270 MDR4 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08269 Zn_ADH9 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>PLN02702 L-idonate 5-dehydrogenase Back     alignment and domain information
>cd08273 MDR8 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>COG2130 Putative NADP-dependent oxidoreductases [General function prediction only] Back     alignment and domain information
>cd08264 Zn_ADH_like2 Alcohol dehydrogenases of the MDR family Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>cd08288 MDR_yhdh Yhdh putative quinone oxidoreductases Back     alignment and domain information
>cd05281 TDH Threonine dehydrogenase Back     alignment and domain information
>cd05195 enoyl_red enoyl reductase of polyketide synthase Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase Back     alignment and domain information
>cd08241 QOR1 Quinone oxidoreductase (QOR) Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>cd05289 MDR_like_2 alcohol dehydrogenase and quinone reductase-like medium chain degydrogenases/reductases Back     alignment and domain information
>cd08245 CAD Cinnamyl alcohol dehydrogenases (CAD) and related proteins Back     alignment and domain information
>cd05288 PGDH Prostaglandin dehydrogenases Back     alignment and domain information
>cd08232 idonate-5-DH L-idonate 5-dehydrogenase Back     alignment and domain information
>smart00829 PKS_ER Enoylreductase Back     alignment and domain information
>cd08267 MDR1 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>cd08275 MDR3 Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>KOG1196|consensus Back     alignment and domain information
>cd08255 2-desacetyl-2-hydroxyethyl_bacteriochlorophyllide_like 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide and other MDR family members Back     alignment and domain information
>KOG1202|consensus Back     alignment and domain information
>PF08240 ADH_N: Alcohol dehydrogenase GroES-like domain; InterPro: IPR013154 This is the catalytic domain of alcohol dehydrogenases (1 Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00936 ahcY adenosylhomocysteinase Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02494 adenosylhomocysteinase Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1205|consensus Back     alignment and domain information
>KOG1014|consensus Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PTZ00075 Adenosylhomocysteinase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0725|consensus Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1201|consensus Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>KOG1209|consensus Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PF11017 DUF2855: Protein of unknown function (DUF2855); InterPro: IPR021276 This family of proteins has no known function Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1208|consensus Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1210|consensus Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00507 aroE shikimate 5-dehydrogenase Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>PRK13940 glutamyl-tRNA reductase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4022|consensus Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>KOG1200|consensus Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>KOG1610|consensus Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>KOG4169|consensus Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR00715 precor6x_red precorrin-6x reductase Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>KOG1199|consensus Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PLN02696 1-deoxy-D-xylulose-5-phosphate reductoisomerase Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PF13602 ADH_zinc_N_2: Zinc-binding dehydrogenase; PDB: 3TQH_A 2VN8_A 3GOH_A 4A27_A Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>KOG1207|consensus Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>PRK06849 hypothetical protein; Provisional Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>TIGR00243 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase Back     alignment and domain information
>PRK07502 cyclohexadienyl dehydrogenase; Validated Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PRK00258 aroE shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0031 CysK Cysteine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>COG1179 Dinucleotide-utilizing enzymes involved in molybdopterin and thiamine biosynthesis family 1 [Coenzyme metabolism] Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK12550 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>COG0169 AroE Shikimate 5-dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>KOG1252|consensus Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>KOG1611|consensus Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>PF07991 IlvN: Acetohydroxy acid isomeroreductase, catalytic domain; InterPro: IPR013116 Acetohydroxy acid isomeroreductase catalyses the conversion of acetohydroxy acids into dihydroxy valerates Back     alignment and domain information
>PRK14027 quinate/shikimate dehydrogenase; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PLN00203 glutamyl-tRNA reductase Back     alignment and domain information
>TIGR01809 Shik-DH-AROM shikimate-5-dehydrogenase, fungal AROM-type Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK09310 aroDE bifunctional 3-dehydroquinate dehydratase/shikimate dehydrogenase protein; Reviewed Back     alignment and domain information
>COG0373 HemA Glutamyl-tRNA reductase [Coenzyme metabolism] Back     alignment and domain information
>PLN03013 cysteine synthase Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query296
4eye_A342 Crystal Structure Of A Probable Oxidoreductase From 2e-09
4a27_A349 Crystal Structure Of Human Synaptic Vesicle Membran 1e-07
1yb5_A351 Crystal Structure Of Human Zeta-crystallin With Bou 8e-07
3jyl_A325 Crystal Structures Of Pseudomonas Syringae Pv. Toma 2e-06
1wly_A333 Crystal Structure Of 2-haloacrylate Reductase Lengt 3e-05
1qor_A327 Crystal Structure Of Escherichia Coli Quinone Oxido 1e-04
3gms_A340 Crystal Structure Of Putative Nadph:quinone Reducta 8e-04
>pdb|4EYE|A Chain A, Crystal Structure Of A Probable Oxidoreductase From Mycobacterium Abscessus Solved By Iodide Ion Sad Length = 342 Back     alignment and structure

Iteration: 1

Score = 59.7 bits (143), Expect = 2e-09, Method: Compositional matrix adjust. Identities = 47/199 (23%), Positives = 81/199 (40%), Gaps = 16/199 (8%) Query: 52 SDLLLYNGSGDAKPTLPLVPGFEFSGTVIEVAXXXXXXXXXXXXXXVLQVGDKVLALNKE 111 D L+ G K P VPG E +G V ++ GD+V+A N Sbjct: 63 PDYLMTKGEYQLKMEPPFVPGIETAGVVRSAPEGSG-----------IKPGDRVMAFN-- 109 Query: 112 LLHGFSDQCVVHTNDVFKIPEKMTFEHAASLADSYSTAQIVFSRHAKLKEKQXXXXXXXX 171 + G++++ V +++ P ++ A +L +Y T ++R +L+ + Sbjct: 110 FIGGYAERVAVAPSNILPTPPQLDDAEAVALIANYHTMYFAYARRGQLRAGETVLVLGAA 169 Query: 172 XXXXXXXXDMATKIYKAKVIGVCNSEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVSGGK 231 +A K AKVI V N T+ ++ GA L E+ V E +GG Sbjct: 170 GGIGTAAIQIA-KGMGAKVIAVVNRTAATEFVKSVGADIVLPL--EEGWAKAVREATGGA 226 Query: 232 YANVVFEAVGGEDKTDLIR 250 ++V + +GG D +R Sbjct: 227 GVDMVVDPIGGPAFDDAVR 245
>pdb|4A27|A Chain A, Crystal Structure Of Human Synaptic Vesicle Membrane Protein Vat-1 Homolog-Like Protein Length = 349 Back     alignment and structure
>pdb|1YB5|A Chain A, Crystal Structure Of Human Zeta-crystallin With Bound Nadp Length = 351 Back     alignment and structure
>pdb|3JYL|A Chain A, Crystal Structures Of Pseudomonas Syringae Pv. Tomato Dc3000 Quinone Oxidoreductase Length = 325 Back     alignment and structure
>pdb|1WLY|A Chain A, Crystal Structure Of 2-haloacrylate Reductase Length = 333 Back     alignment and structure
>pdb|1QOR|A Chain A, Crystal Structure Of Escherichia Coli Quinone Oxidoreductase Complexed With Nadph Length = 327 Back     alignment and structure
>pdb|3GMS|A Chain A, Crystal Structure Of Putative Nadph:quinone Reductase From Bacillus Thuringiensis Length = 340 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query296
4eye_A342 Probable oxidoreductase; structural genomics, niai 1e-41
3gms_A340 Putative NADPH:quinone reductase; structural genom 6e-41
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 8e-41
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 2e-40
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 2e-36
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 7e-35
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 9e-05
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 2e-34
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 1e-33
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 3e-32
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 6e-32
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 7e-32
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 3e-30
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 2e-29
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 2e-29
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 3e-29
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 6e-29
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 1e-28
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 2e-28
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 6e-27
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 2e-26
3krt_A456 Crotonyl COA reductase; structural genomics, prote 3e-26
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 1e-25
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 3e-25
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 5e-23
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 5e-21
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 1e-20
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 1e-19
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 1e-19
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 2e-17
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 3e-17
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 2e-16
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 3e-16
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 3e-16
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 3e-15
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 3e-15
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 4e-15
3fbg_A346 Putative arginate lyase; structural genomics, unkn 6e-15
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 7e-15
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 1e-14
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 2e-14
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 3e-14
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 3e-14
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 1e-12
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 1e-12
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 2e-12
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 5e-12
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 2e-11
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 2e-11
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 2e-11
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 3e-11
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 2e-10
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 2e-10
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 3e-10
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 4e-10
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 1e-09
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 1e-08
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 1e-07
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 2e-07
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 4e-07
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 1e-06
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 2e-06
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 2e-06
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 2e-06
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 2e-06
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 4e-06
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 5e-06
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 6e-06
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 1e-05
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 2e-04
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Length = 342 Back     alignment and structure
 Score =  146 bits (370), Expect = 1e-41
 Identities = 54/195 (27%), Positives = 91/195 (46%), Gaps = 16/195 (8%)

Query: 49  INSSDLLLYNGSGDAKPTLPLVPGFEFSGTVIEVADTKSSSTEEDDEEDVLQVGDKVLAL 108
           +   D L+  G    K   P VPG E +G V    +              ++ GD+V+A 
Sbjct: 60  VCFPDYLMTKGEYQLKMEPPFVPGIETAGVVRSAPEGSG-----------IKPGDRVMAF 108

Query: 109 NKELLHGFSDQCVVHTNDVFKIPEKMTFEHAASLADSYSTAQIVFSRHAKLKEKQTVLVT 168
           N   + G++++  V  +++   P ++    A +L  +Y T    ++R  +L+  +TVLV 
Sbjct: 109 NF--IGGYAERVAVAPSNILPTPPQLDDAEAVALIANYHTMYFAYARRGQLRAGETVLVL 166

Query: 169 AAGGGLGLAAVDMATKIYKAKVIGVCNSEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVS 228
            A GG+G AA+ +A K   AKVI V N    T+ ++  GA   L     +     V E +
Sbjct: 167 GAAGGIGTAAIQIA-KGMGAKVIAVVNRTAATEFVKSVGADIVLPLE--EGWAKAVREAT 223

Query: 229 GGKYANVVFEAVGGE 243
           GG   ++V + +GG 
Sbjct: 224 GGAGVDMVVDPIGGP 238


>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Length = 340 Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Length = 357 Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Length = 349 Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Length = 351 Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Length = 302 Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Length = 302 Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Length = 362 Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Length = 349 Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Length = 325 Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 327 Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Length = 354 Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Length = 364 Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Length = 353 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Length = 333 Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Length = 334 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Length = 343 Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Length = 321 Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Length = 379 Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Length = 343 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Length = 447 Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Length = 456 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Length = 347 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Length = 363 Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Length = 375 Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Length = 795 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Length = 344 Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Length = 345 Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Length = 359 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Length = 371 Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Length = 380 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Length = 404 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Length = 370 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Length = 346 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Length = 198 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Length = 363 Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Length = 315 Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Length = 346 Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Length = 348 Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Length = 347 Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Length = 352 Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Length = 2512 Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Length = 366 Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Length = 352 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Length = 356 Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Length = 357 Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Length = 343 Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Length = 330 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Length = 339 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Length = 363 Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Length = 340 Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Length = 398 Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Length = 328 Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Length = 324 Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Length = 398 Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Length = 333 Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Length = 373 Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Length = 374 Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Length = 374 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Length = 376 Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Length = 371 Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Length = 357 Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Length = 348 Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Length = 366 Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Length = 345 Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Length = 360 Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Length = 373 Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Length = 357 Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Length = 369 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query296
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 100.0
4eye_A342 Probable oxidoreductase; structural genomics, niai 100.0
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 100.0
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 100.0
3gms_A340 Putative NADPH:quinone reductase; structural genom 100.0
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 100.0
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 100.0
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 100.0
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 100.0
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 100.0
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 100.0
4a27_A349 Synaptic vesicle membrane protein VAT-1 homolog-L; 100.0
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 100.0
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 100.0
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 100.0
3fbg_A346 Putative arginate lyase; structural genomics, unkn 100.0
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 100.0
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 100.0
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 100.0
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 100.0
1rjw_A339 ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD 100.0
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 100.0
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 100.0
1h2b_A359 Alcohol dehydrogenase; oxidoreductase, archaea, hy 100.0
3gqv_A371 Enoyl reductase; medium-chain reductase (MDR super 100.0
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 100.0
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 100.0
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 100.0
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 100.0
3goh_A315 Alcohol dehydrogenase, zinc-containing; NP_718042. 100.0
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 100.0
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 100.0
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 100.0
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 100.0
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 100.0
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 100.0
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 100.0
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 100.0
3nx4_A324 Putative oxidoreductase; csgid, structural genomic 100.0
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 100.0
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 100.0
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 100.0
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 100.0
2dq4_A343 L-threonine 3-dehydrogenase; NAD-dependent, oxidor 100.0
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 100.0
3krt_A456 Crotonyl COA reductase; structural genomics, prote 100.0
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 100.0
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 100.0
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 100.0
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 100.0
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 100.0
2h6e_A344 ADH-4, D-arabinose 1-dehydrogenase; rossman fold, 100.0
2vn8_A375 Reticulon-4-interacting protein 1; mitochondrion, 100.0
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 100.0
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 100.0
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 100.0
1xa0_A328 Putative NADPH dependent oxidoreductases; structur 100.0
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 100.0
3iup_A379 Putative NADPH:quinone oxidoreductase; YP_296108.1 100.0
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 100.0
1tt7_A330 YHFP; alcohol dehydrogenase, Zn-dependent, NAD, st 100.0
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 100.0
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 100.0
1iz0_A302 Quinone oxidoreductase; APO-enzyme, riken structur 100.0
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 100.0
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 100.0
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 100.0
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 100.0
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 100.0
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.94
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 99.79
1gpj_A 404 Glutamyl-tRNA reductase; tRNA-dependent tetrapyrro 98.45
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 98.05
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 97.92
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 97.91
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 97.88
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 97.75
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 97.74
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.61
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 97.53
3ged_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 97.5
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 97.38
4fgs_A 273 Probable dehydrogenase protein; PSI-biology, nysgr 97.38
3h7a_A 252 Short chain dehydrogenase; oxidoreductase, PSI-2, 97.37
4fn4_A 254 Short chain dehydrogenase; NADH-binding, rossmann 97.37
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 97.36
2z1n_A 260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 97.36
4g81_D 255 Putative hexonate dehydrogenase; enzyme function i 97.31
3f9i_A 249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 97.31
3d3w_A 244 L-xylulose reductase; uronate cycle, short-chain d 97.28
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 97.26
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 97.26
4hp8_A 247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 97.25
3rd5_A 291 Mypaa.01249.C; ssgcid, structural genomics, seattl 97.18
2wsb_A 254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 97.18
3dii_A 247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 97.17
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 97.17
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 97.17
3rwb_A 247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 97.16
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 97.15
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 97.15
1uls_A 245 Putative 3-oxoacyl-acyl carrier protein reductase; 97.15
3c85_A183 Putative glutathione-regulated potassium-efflux S 97.13
1cyd_A 244 Carbonyl reductase; short-chain dehydrogenase, oxi 97.12
2ae2_A 260 Protein (tropinone reductase-II); oxidoreductase, 97.12
4gkb_A 258 3-oxoacyl-[acyl-carrier protein] reductase; putati 97.11
4imr_A 275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 97.1
1hdc_A 254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 97.1
3ai3_A 263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 97.1
4eso_A 255 Putative oxidoreductase; NADP, structural genomics 97.09
3ioy_A 319 Short-chain dehydrogenase/reductase SDR; structura 97.09
1ae1_A 273 Tropinone reductase-I; oxidoreductase, tropane alk 97.08
1iy8_A 267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 97.08
3ppi_A 281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 97.08
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 97.07
3ak4_A 263 NADH-dependent quinuclidinone reductase; SDR, (R)- 97.07
3n74_A 261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 97.06
3r1i_A 276 Short-chain type dehydrogenase/reductase; structur 97.06
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 97.05
3gem_A260 Short chain dehydrogenase; structural genomics, AP 97.05
2ew8_A 249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 97.05
4dry_A 281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 97.04
3tjr_A 301 Short chain dehydrogenase; structural genomics, se 97.04
4e6p_A 259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 97.04
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 97.03
3op4_A 248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 97.03
1yo6_A 250 Putative carbonyl reductase sniffer; tyrosine-depe 97.03
4dqx_A 277 Probable oxidoreductase protein; structural genomi 97.02
4fs3_A 256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 97.02
3qiv_A 253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 97.01
3p19_A 266 BFPVVD8, putative blue fluorescent protein; rossma 96.99
3imf_A 257 Short chain dehydrogenase; structural genomics, in 96.99
1vl8_A 267 Gluconate 5-dehydrogenase; TM0441, structural geno 96.99
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 96.99
3grp_A 266 3-oxoacyl-(acyl carrierprotein) reductase; structu 96.98
3tfo_A 264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 96.98
1yde_A 270 Retinal dehydrogenase/reductase 3; oxidoreductase, 96.98
3cxt_A 291 Dehydrogenase with different specificities; rossma 96.98
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 96.98
3tzq_B 271 Short-chain type dehydrogenase/reductase; ssgcid, 96.98
3lyl_A 247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 96.98
4egf_A 266 L-xylulose reductase; structural genomics, ssgcid, 96.97
1xq1_A 266 Putative tropinone reducatse; structural genomics, 96.97
2ag5_A 246 DHRS6, dehydrogenase/reductase (SDR family) member 96.97
3kvo_A 346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 96.96
1xkq_A 280 Short-chain reductase family member (5D234); parra 96.95
1nff_A 260 Putative oxidoreductase RV2002; directed evolution 96.95
3zv4_A 281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 96.95
3sc4_A 285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 96.95
3ftp_A 270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 96.94
2d1y_A 256 Hypothetical protein TT0321; strucrtural genomics, 96.94
1zem_A 262 Xylitol dehydrogenase; rossmann fold, dinucleotide 96.93
1sny_A 267 Sniffer CG10964-PA; alpha and beta protein, rossma 96.93
2rhc_B 277 Actinorhodin polyketide ketoreductase; oxidoreduct 96.93
1o5i_A 249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 96.93
2o23_A 265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 96.93
3m1a_A 281 Putative dehydrogenase; short, PSI, MCSG, structur 96.92
3uf0_A 273 Short-chain dehydrogenase/reductase SDR; gluconate 96.92
1x1t_A 260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 96.92
3sju_A 279 Keto reductase; short-chain dehydrogenase, oxidore 96.91
3ucx_A 264 Short chain dehydrogenase; ssgcid, seattle structu 96.91
1zmo_A 244 Halohydrin dehalogenase; haloalcohol dehalogenase, 96.91
1g0o_A 283 Trihydroxynaphthalene reductase; protein-NADPH-act 96.91
3awd_A 260 GOX2181, putative polyol dehydrogenase; oxidoreduc 96.91
2qq5_A 260 DHRS1, dehydrogenase/reductase SDR family member 1 96.91
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 96.9
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 96.9
1w6u_A 302 2,4-dienoyl-COA reductase, mitochondrial precursor 96.9
3tox_A 280 Short chain dehydrogenase; structural genomics, PS 96.9
3v8b_A 283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 96.89
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 96.88
3t4x_A 267 Oxidoreductase, short chain dehydrogenase/reducta; 96.88
3e03_A 274 Short chain dehydrogenase; structural genomics, PS 96.88
3gvc_A 277 Oxidoreductase, probable short-chain type dehydrog 96.88
3svt_A 281 Short-chain type dehydrogenase/reductase; ssgcid, 96.87
1geg_A 256 Acetoin reductase; SDR family, oxidoreductase; HET 96.87
3tpc_A 257 Short chain alcohol dehydrogenase-related dehydro; 96.87
4dyv_A 272 Short-chain dehydrogenase/reductase SDR; structura 96.87
2ekp_A 239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 96.86
2zat_A 260 Dehydrogenase/reductase SDR family member 4; alpha 96.86
1xg5_A 279 ARPG836; short chain dehydrogenase, human, SGC, st 96.85
2b4q_A 276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 96.85
3rih_A 293 Short chain dehydrogenase or reductase; structural 96.85
1yxm_A 303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 96.85
3t7c_A 299 Carveol dehydrogenase; structural genomics, seattl 96.85
1hxh_A 253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 96.83
3gaf_A 256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 96.83
3pk0_A 262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 96.83
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 96.83
3lf2_A 265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 96.82
3s55_A 281 Putative short-chain dehydrogenase/reductase; stru 96.82
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 96.82
1zk4_A 251 R-specific alcohol dehydrogenase; short chain redu 96.82
2a4k_A 263 3-oxoacyl-[acyl carrier protein] reductase; reduct 96.82
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 96.82
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 96.81
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 96.81
3ek2_A 271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 96.81
3tl3_A 257 Short-chain type dehydrogenase/reductase; ssgcid, 96.81
3gvp_A435 Adenosylhomocysteinase 3; protein CO-factor comple 96.81
1zmt_A 254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 96.81
3o26_A 311 Salutaridine reductase; short chain dehydrogenase/ 96.8
3afn_B 258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 96.79
4fc7_A 277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 96.79
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 96.79
1xhl_A 297 Short-chain dehydrogenase/reductase family member 96.79
2bgk_A 278 Rhizome secoisolariciresinol dehydrogenase; oxidor 96.78
3pxx_A 287 Carveol dehydrogenase; structural genomics, seattl 96.78
1fmc_A 255 7 alpha-hydroxysteroid dehydrogenase; short-chain 96.77
3oid_A 258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 96.77
3ijr_A 291 Oxidoreductase, short chain dehydrogenase/reducta; 96.76
1spx_A 278 Short-chain reductase family member (5L265); paral 96.76
1mxh_A 276 Pteridine reductase 2; SDR topology, protein-subst 96.75
4ibo_A 271 Gluconate dehydrogenase; enzyme function initiativ 96.75
3sx2_A 278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 96.75
2gdz_A 267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 96.75
1gee_A 261 Glucose 1-dehydrogenase; short-chain dehydrogenase 96.73
3uve_A 286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 96.73
3k31_A 296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 96.73
1wma_A 276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 96.72
2pd6_A 264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 96.72
3ksu_A 262 3-oxoacyl-acyl carrier protein reductase; structur 96.71
2q2v_A 255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 96.71
3tsc_A 277 Putative oxidoreductase; structural genomics, seat 96.7
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 96.69
1xq6_A 253 Unknown protein; structural genomics, protein stru 96.68
2cfc_A 250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 96.68
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 96.68
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 96.67
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 96.66
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 96.66
1gz6_A 319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 96.66
3pgx_A 280 Carveol dehydrogenase; structural genomics, seattl 96.66
3vtz_A 269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 96.65
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 96.64
3asu_A 248 Short-chain dehydrogenase/reductase SDR; SDR famil 96.64
4da9_A 280 Short-chain dehydrogenase/reductase; structural ge 96.64
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 96.63
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 96.63
3a28_C 258 L-2.3-butanediol dehydrogenase; chiral substrate r 96.63
3oec_A 317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 96.63
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 96.63
4h15_A 261 Short chain alcohol dehydrogenase-related dehydro; 96.62
3v2h_A 281 D-beta-hydroxybutyrate dehydrogenase; structural g 96.62
3qlj_A 322 Short chain dehydrogenase; structural genomics, se 96.61
3oig_A 266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 96.61
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.6
1dhr_A 241 Dihydropteridine reductase; oxidoreductase(acting 96.6
1xu9_A 286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 96.59
1qsg_A 265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 96.59
3is3_A 270 17BETA-hydroxysteroid dehydrogenase; short chain d 96.58
3ond_A 488 Adenosylhomocysteinase; plant protein, enzyme-subs 96.57
1ooe_A236 Dihydropteridine reductase; structural genomics, P 96.57
3ctm_A 279 Carbonyl reductase; alcohol dehydrogenase, short-c 96.57
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 96.56
2x9g_A 288 PTR1, pteridine reductase; short chain dehydrogena 96.56
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 96.56
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 96.55
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 96.55
1oaa_A 259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 96.54
3rku_A 287 Oxidoreductase YMR226C; substrate fingerprint, sho 96.53
3u9l_A 324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.53
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 96.53
2nwq_A 272 Probable short-chain dehydrogenase; oxidoreductase 96.53
2pd4_A 275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 96.52
2ph3_A 245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 96.52
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 96.51
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 96.51
1ja9_A 274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 96.49
2h7i_A 269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 96.49
2fwm_X 250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 96.48
3s8m_A 422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 96.48
3o38_A 266 Short chain dehydrogenase; tuberculosis, ortholog 96.48
2nm0_A 253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 96.48
2dtx_A 264 Glucose 1-dehydrogenase related protein; rossmann 96.47
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 96.46
3edm_A 259 Short chain dehydrogenase; structural genomics, ox 96.45
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 96.41
1uzm_A 247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 96.41
1edo_A 244 Beta-keto acyl carrier protein reductase; nucleoti 96.4
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.4
1h5q_A 265 NADP-dependent mannitol dehydrogenase; oxidoreduct 96.39
1sby_A 254 Alcohol dehydrogenase; ternary complex, NAD, trifl 96.39
3grk_A 293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 96.39
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 96.38
2wyu_A 261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 96.38
3e9n_A 245 Putative short-chain dehydrogenase/reductase; stru 96.37
2p91_A 285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 96.37
3nrc_A 280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 96.37
3r3s_A 294 Oxidoreductase; structural genomics, csgid, center 96.37
3rft_A 267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 96.35
3uxy_A 266 Short-chain dehydrogenase/reductase SDR; structura 96.34
3zu3_A 405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 96.33
4e3z_A 272 Putative oxidoreductase protein; PSI-biology, stru 96.33
1e7w_A 291 Pteridine reductase; dihydrofolate reductase, shor 96.31
2qhx_A 328 Pteridine reductase 1; oxidoreductase, short-chain 96.29
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 96.29
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 96.27
3kzv_A 254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 96.26
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 96.25
2rir_A300 Dipicolinate synthase, A chain; structural genomic 96.24
3ezl_A 256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 96.24
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 96.23
1y1p_A 342 ARII, aldehyde reductase II; rossmann fold, short 96.22
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 96.22
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 96.21
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 96.19
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 96.18
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 96.18
1uay_A 242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 96.18
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 96.14
3n58_A464 Adenosylhomocysteinase; ssgcid, hydrolase, structu 96.13
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 96.12
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 96.1
4e4y_A 244 Short chain dehydrogenase family protein; structur 96.1
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 96.08
2z5l_A 511 Tylkr1, tylactone synthase starter module and modu 96.06
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 96.06
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 96.03
4eue_A 418 Putative reductase CA_C0462; TER, biofuel, synthet 96.02
3mje_A 496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 95.98
3h9u_A 436 Adenosylhomocysteinase; NAD CO-factor complex, str 95.96
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 95.92
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 95.91
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 95.9
3gk3_A 269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 95.9
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 95.9
1fjh_A 257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 95.89
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 95.84
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 95.82
3i4f_A 264 3-oxoacyl-[acyl-carrier protein] reductase; struct 95.81
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 95.77
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 95.76
2fr1_A 486 Erythromycin synthase, eryai; short chain dehydrog 95.76
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 95.73
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 95.73
3qp9_A 525 Type I polyketide synthase pikaii; rossmann fold, 95.73
2dkn_A 255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 95.73
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 95.7
3gdg_A 267 Probable NADP-dependent mannitol dehydrogenase; ro 95.69
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 95.68
1lss_A140 TRK system potassium uptake protein TRKA homolog; 95.68
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 95.67
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 95.66
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 95.65
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 95.62
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 95.6
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 95.59
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 95.59
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 95.54
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 95.54
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 95.52
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 95.51
3u0b_A 454 Oxidoreductase, short chain dehydrogenase/reducta 95.51
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 95.48
3slk_A 795 Polyketide synthase extender module 2; rossmann fo 95.42
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 95.39
1vl0_A 292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 95.36
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 95.32
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 95.31
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 95.29
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 95.27
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 95.25
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 95.25
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 95.21
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 95.17
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 95.12
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 95.08
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 95.05
3ius_A 286 Uncharacterized conserved protein; APC63810, silic 95.02
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 94.97
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 94.96
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 94.92
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 94.9
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 94.9
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 94.89
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 94.87
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 94.84
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 94.83
2o2s_A 315 Enoyl-acyl carrier reductase; enoyl reductase, tri 94.82
2ph5_A 480 Homospermidine synthase; alpha-beta protein, struc 94.8
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 94.79
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 94.79
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 94.79
3l9w_A 413 Glutathione-regulated potassium-efflux system Pro 94.76
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 94.75
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 94.75
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 94.69
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 94.66
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 94.65
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 94.63
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 94.63
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 94.61
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 94.6
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 94.57
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 94.57
2p4h_X 322 Vestitone reductase; NADPH-dependent reductase, is 94.56
1p9l_A 245 Dihydrodipicolinate reductase; oxidoreductase, lys 94.51
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 94.46
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 94.45
4ggo_A 401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 94.43
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 94.43
2avd_A229 Catechol-O-methyltransferase; structural genomics, 94.41
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 94.39
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 94.39
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 94.37
1id1_A153 Putative potassium channel protein; RCK domain, E. 94.35
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 94.31
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 94.31
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 94.29
2ggs_A 273 273AA long hypothetical DTDP-4-dehydrorhamnose red 94.17
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 94.16
3o8q_A281 Shikimate 5-dehydrogenase I alpha; structural geno 94.13
3sc6_A 287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 94.13
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 94.09
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 94.09
2p5y_A 311 UDP-glucose 4-epimerase; TTHA0591, structural geno 94.08
3pwz_A272 Shikimate dehydrogenase 3; alpha-beta, oxidoreduct 94.08
1d7o_A 297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 94.05
1eq2_A 310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 94.04
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 94.02
2ptg_A 319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 93.98
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 93.97
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 93.95
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 93.91
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 93.85
1r0k_A 388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 93.79
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 93.75
4f6c_A 427 AUSA reductase domain protein; thioester reductase 93.72
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 93.71
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 93.65
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 93.59
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 93.55
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 93.54
3ggo_A 314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 93.44
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 93.43
3ay3_A 267 NAD-dependent epimerase/dehydratase; glucuronic ac 93.43
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 93.32
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 93.27
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 93.27
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 93.25
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 93.17
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 93.17
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 93.13
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 93.12
1nvm_B 312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 93.1
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 92.89
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 92.81
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 92.79
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 92.79
3lt0_A 329 Enoyl-ACP reductase; triclosan, triclosan variant, 92.71
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 92.65
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 92.61
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 92.5
3a06_A 376 1-deoxy-D-xylulose 5-phosphate reductoisomerase; M 92.46
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 92.46
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 92.32
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 92.28
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 92.26
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 92.24
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 92.21
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 92.13
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 92.09
3cea_A 346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 92.06
2f1k_A 279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 92.04
3don_A277 Shikimate dehydrogenase; alpha-beta structure, ros 91.97
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 91.96
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 91.8
2g5c_A 281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 91.76
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 91.74
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 91.71
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 91.69
3lk7_A 451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 91.6
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 91.58
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 91.5
3pef_A 287 6-phosphogluconate dehydrogenase, NAD-binding; gam 91.43
3h8v_A 292 Ubiquitin-like modifier-activating enzyme 5; rossm 91.42
3c24_A 286 Putative oxidoreductase; YP_511008.1, structural g 91.35
1v8b_A 479 Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2 91.35
3duw_A223 OMT, O-methyltransferase, putative; alternating of 91.16
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 90.96
1yb2_A275 Hypothetical protein TA0852; structural genomics, 90.93
3ehe_A 313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 90.89
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 90.74
3tum_A269 Shikimate dehydrogenase family protein; rossmann-f 90.6
3g0o_A 303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 90.57
3u62_A253 Shikimate dehydrogenase; shikimate pathway, oxidor 90.4
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 90.37
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 90.34
4f6l_B 508 AUSA reductase domain protein; thioester reductase 90.32
1zej_A 293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 90.3
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 90.22
3fbt_A282 Chorismate mutase and shikimate 5-dehydrogenase fu 90.21
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 90.14
3rui_A 340 Ubiquitin-like modifier-activating enzyme ATG7; au 90.11
3ktd_A 341 Prephenate dehydrogenase; structural genomics, joi 90.04
4a26_A300 Putative C-1-tetrahydrofolate synthase, cytoplasm; 90.0
2ew2_A 316 2-dehydropantoate 2-reductase, putative; alpha-str 89.97
1edz_A320 5,10-methylenetetrahydrofolate dehydrogenase; nucl 89.96
1bg6_A 359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 89.93
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
Probab=100.00  E-value=1.6e-42  Score=318.23  Aligned_cols=247  Identities=19%  Similarity=0.314  Sum_probs=223.3

Q ss_pred             CCcceEEecCCCCC-------CCCCCCCCCCCCCCcEEEEeeeeecChhhHHHHcCCCCCCCCCCCcCCCceeEEEEEEc
Q psy1959          11 NSSDLLLYNGSGDA-------KPTLPLVPGFEFSGTIIEKKMMTRINSSDLLLYNGSGDAKPTLPLVPGFEFSGTVIEVA   83 (296)
Q Consensus        11 ~~~~~~~~~~~~~~-------~~~p~~~~~~~~~~evlvkv~~~~i~~~D~~~~~g~~~~~~~~p~~~G~e~~G~V~~v~   83 (296)
                      .+||++++++++.+       .|.|+|.++     ||+|||.+++||++|++.+.|.++....+|.++|||++|+|+++ 
T Consensus        27 ~~MkA~~~~~~g~~~~l~~~~~~~P~~~~~-----eVlVkv~a~gi~~~D~~~~~g~~~~~~~~p~i~G~E~~G~V~~v-  100 (353)
T 4dup_A           27 QEMRFVDLKSFGGPDVMVIGKRPLPVAGEG-----EVLVRAEAIGVNRPDIAQRQGSYPPPKDASPILGLELSGEIVGV-  100 (353)
T ss_dssp             SSEEEEEESSSSSGGGEEEEEECCCCCCTT-----EEEEEEEEEEECHHHHHHHTTSSCCCTTSCSSSCCEEEEEEEEE-
T ss_pred             hheeEEEEccCCCccceEEEeccCCCCCCC-----EEEEEEEEEecCHHHHHHhCCCCCCCCCCCCccccccEEEEEEE-
Confidence            36999999986643       678888899     99999999999999999999988776678999999999999999 


Q ss_pred             cCCCCCCCCCCCCCCCCCCCEEEEecCCCCCcccceEeeeCCceEECCCCCCHHHHhhhccHHHHHHHHHHHHcCCCCCc
Q psy1959          84 DTKSSSTEEDDEEDVLQVGDKVLALNKELLHGFSDQCVVHTNDVFKIPEKMTFEHAASLADSYSTAQIVFSRHAKLKEKQ  163 (296)
Q Consensus        84 ~~~~~~~~~g~~v~~~~~Gd~V~~~~~~~~g~~~~~~~v~~~~~~~iP~~~~~~~aa~l~~~~~ta~~~l~~~~~~~~g~  163 (296)
                               |++|++|++||||+++..  .|+|+||+++|++.++++|++++++++|+|+++++|||+++.+.+++++|+
T Consensus       101 ---------G~~v~~~~vGdrV~~~~~--~G~~aey~~v~~~~~~~~P~~~~~~~aa~l~~~~~ta~~~l~~~~~~~~g~  169 (353)
T 4dup_A          101 ---------GPGVSGYAVGDKVCGLAN--GGAYAEYCLLPAGQILPFPKGYDAVKAAALPETFFTVWANLFQMAGLTEGE  169 (353)
T ss_dssp             ---------CTTCCSCCTTCEEEEECS--SCCSBSEEEEEGGGEEECCTTCCHHHHHTSHHHHHHHHHHHTTTTCCCTTC
T ss_pred             ---------CCCCCCCCCCCEEEEecC--CCceeeEEEEcHHHcEeCCCCCCHHHHhhhhhHHHHHHHHHHHhcCCCCCC
Confidence                     999999999999999865  699999999999999999999999999999999999999998889999999


Q ss_pred             EEEEEcCCCcHHHHHHHHHHHhCCCEEEEEeCCcchHHHHHhcCCcEEEEcCCchhHHHHHHHHhCCCcccEEEECCCCc
Q psy1959         164 TVLVTAAGGGLGLAAVDMATKIYKAKVIGVCNSEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVSGGKYANVVFEAVGGE  243 (296)
Q Consensus       164 ~vlI~Ga~g~vG~aa~~la~~~~g~~Vi~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~i~~~~~~~g~d~vld~~g~~  243 (296)
                      +|+|+|++|++|++++|+| +..|++|++++++++++++++++|++.++++++ .++.+.+.+.+ +.++|++|||+|++
T Consensus       170 ~VlV~Gg~g~iG~~~~~~a-~~~Ga~Vi~~~~~~~~~~~~~~lGa~~~~~~~~-~~~~~~~~~~~-~~g~Dvvid~~g~~  246 (353)
T 4dup_A          170 SVLIHGGTSGIGTTAIQLA-RAFGAEVYATAGSTGKCEACERLGAKRGINYRS-EDFAAVIKAET-GQGVDIILDMIGAA  246 (353)
T ss_dssp             EEEESSTTSHHHHHHHHHH-HHTTCEEEEEESSHHHHHHHHHHTCSEEEETTT-SCHHHHHHHHH-SSCEEEEEESCCGG
T ss_pred             EEEEEcCCCHHHHHHHHHH-HHcCCEEEEEeCCHHHHHHHHhcCCCEEEeCCc-hHHHHHHHHHh-CCCceEEEECCCHH
Confidence            9999988999999999999 678999999999999999999999999999987 78888899888 77999999999999


Q ss_pred             cHHHHHHHhhccCceEE------------eecccceeeeeEEecccc
Q psy1959         244 DKTDLIRQKGAWAALTF------------TNEKSLVNKVLEVSGGKY  278 (296)
Q Consensus       244 ~~~~~~~~lg~~~g~~~------------~~~~~~~~k~~~i~g~~~  278 (296)
                      .+..+++++ +++|++.            ++...++.|++++.|++.
T Consensus       247 ~~~~~~~~l-~~~G~iv~~g~~~~~~~~~~~~~~~~~~~~~i~g~~~  292 (353)
T 4dup_A          247 YFERNIASL-AKDGCLSIIAFLGGAVAEKVNLSPIMVKRLTVTGSTM  292 (353)
T ss_dssp             GHHHHHHTE-EEEEEEEECCCTTCSEEEEEECHHHHHTTCEEEECCS
T ss_pred             HHHHHHHHh-ccCCEEEEEEecCCCcccCCCHHHHHhcCceEEEEec
Confidence            999999999 7777652            333455678888888764



>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>4a27_A Synaptic vesicle membrane protein VAT-1 homolog-L; oxidoreductase; 2.10A {Homo sapiens} Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1rjw_A ADH-HT, alcohol dehydrogenase; oxidoreductase, NAD, zinc, tetramer; 2.35A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 3pii_A Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>1h2b_A Alcohol dehydrogenase; oxidoreductase, archaea, hyperthermophIle, zinc; HET: OCA NAJ; 1.62A {Aeropyrum pernix} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3gqv_A Enoyl reductase; medium-chain reductase (MDR superfamily), rossmann fold, NAD binding, oxidoreductase; HET: NAP; 1.74A {Aspergillus terreus} PDB: 3b6z_A* 3b70_A* Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>3goh_A Alcohol dehydrogenase, zinc-containing; NP_718042.1, alcohol dehydrogenase superfamily protein, ALCO dehydrogenase groes-like domain; 1.55A {Shewanella oneidensis} Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>3nx4_A Putative oxidoreductase; csgid, structural genomics, center for struc genomics of infectious diseases, PSI, protein structure INI; HET: MSE NAP; 1.90A {Salmonella enterica subsp} PDB: 1o89_A 1o8c_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2dq4_A L-threonine 3-dehydrogenase; NAD-dependent, oxidoreductase, structural genomics, NPPSFA; HET: MES; 2.50A {Thermus thermophilus} PDB: 2ejv_A* Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2h6e_A ADH-4, D-arabinose 1-dehydrogenase; rossman fold, medium chain alcohol dehydrogenase, oxidoreduc; 1.80A {Sulfolobus solfataricus} Back     alignment and structure
>2vn8_A Reticulon-4-interacting protein 1; mitochondrion, transit peptide, receptor inhibitor; HET: NDP CIT; 2.1A {Homo sapiens} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>1xa0_A Putative NADPH dependent oxidoreductases; structural genomics, protein structure initiative, MCSG; HET: DTY; 2.80A {Geobacillus stearothermophilus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3iup_A Putative NADPH:quinone oxidoreductase; YP_296108.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE NDP; 1.70A {Ralstonia eutropha} Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1tt7_A YHFP; alcohol dehydrogenase, Zn-dependent, NAD, structural genomics, protein structure initiative, PSI; 2.70A {Bacillus subtilis} SCOP: b.35.1.2 c.2.1.1 PDB: 1y9e_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>1iz0_A Quinone oxidoreductase; APO-enzyme, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.30A {Thermus thermophilus} SCOP: b.35.1.2 c.2.1.1 PDB: 1iyz_A 2cf2_D Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>1gpj_A Glutamyl-tRNA reductase; tRNA-dependent tetrapyrrole biosynthesis; HET: GMC CIT; 1.95A {Methanopyrus kandleri} SCOP: a.151.1.1 c.2.1.7 d.58.39.1 Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3gvp_A Adenosylhomocysteinase 3; protein CO-factor complex, hydrolase, NAD, one-carbon metabolism, phosphoprotein; HET: NAD; 2.25A {Homo sapiens} PDB: 3mtg_A* Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3n58_A Adenosylhomocysteinase; ssgcid, hydrolase, structural genomics, seattle structural G center for infectious disease; HET: ADN NAD; 2.39A {Brucella melitensis biovar abortus} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>3h9u_A Adenosylhomocysteinase; NAD CO-factor complex, structural genomics, SGC stockholm, S genomics consortium, SGC, hydrolase, NAD; HET: NAD ADN PG4; 1.90A {Trypanosoma brucei} PDB: 3g1u_A* 1b3r_A* 1k0u_A* 1ky4_A* 2h5l_A* 1xwf_A* 1d4f_A* 1ky5_A* 3nj4_A* 1li4_A* 1a7a_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>2ph5_A Homospermidine synthase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: NAD; 2.50A {Legionella pneumophila subsp} Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>3o8q_A Shikimate 5-dehydrogenase I alpha; structural genomics, center for structural genomics of infec diseases, csgid; HET: EPE; 1.45A {Vibrio cholerae biovar el tor} PDB: 3sef_A* 3pgj_A* 3o8q_B* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>3pwz_A Shikimate dehydrogenase 3; alpha-beta, oxidoreductase; 1.71A {Pseudomonas putida} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3a06_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pathway, isoprene biosynthesis, metal- NADP, oxidoreductase; HET: NDP; 2.00A {Thermotoga maritima} PDB: 3a14_A* Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3don_A Shikimate dehydrogenase; alpha-beta structure, rossman fold, amino-acid biosynthesis, amino acid biosynthesis, NADP, oxidoreductase; 2.10A {Staphylococcus epidermidis} PDB: 3doo_A* Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>1v8b_A Adenosylhomocysteinase; hydrolase; HET: NAD ADN; 2.40A {Plasmodium falciparum} SCOP: c.2.1.4 c.23.12.3 Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>3u62_A Shikimate dehydrogenase; shikimate pathway, oxidoreductase; 1.45A {Thermotoga maritima} Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3fbt_A Chorismate mutase and shikimate 5-dehydrogenase fusion protein; structural genomics, oxidoreductase, amino-acid biosynthesis; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>4a26_A Putative C-1-tetrahydrofolate synthase, cytoplasm; oxidoreductase, hydrolase, leishmaniasis; 2.70A {Leishmania major} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>1edz_A 5,10-methylenetetrahydrofolate dehydrogenase; nucleotide-binding domain, monofunctional, oxidoreductase; 2.80A {Saccharomyces cerevisiae} SCOP: c.2.1.7 c.58.1.2 PDB: 1ee9_A* Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 296
d2fzwa2176 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( 8e-11
d2jhfa2176 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse ( 5e-10
d1gu7a2189 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yea 6e-10
d1qora2179 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escher 2e-09
d1kola2195 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Ps 3e-09
d1f8fa2174 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase { 4e-09
d1piwa1192 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehy 5e-09
d2fzwa1197 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase 1e-08
d1cdoa2175 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Ga 4e-08
d1pqwa_183 c.2.1.1 (A:) Putative enoyl reductase domain of po 5e-08
d1llua1175 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase 9e-08
d1tt7a1162 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein 1e-07
d1cdoa1199 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase 1e-07
d1d1ta2176 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human ( 6e-07
d1kola1201 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrog 1e-06
d1p0fa2174 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog 3e-06
d1e3ia2174 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse ( 1e-05
d1tt7a2167 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bac 2e-05
d1e3ia1202 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase 6e-05
d1jqba2174 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol 8e-05
d1e3ja1178 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sor 2e-04
d1gu7a1175 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA redu 2e-04
d1v3va2182 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehyd 2e-04
d1yo6a1 250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 4e-04
d1iz0a1131 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase 4e-04
d1f8fa1194 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydr 4e-04
d1vj1a2187 c.2.1.1 (A:125-311) Putative zinc-binding alcohol 7e-04
d1yb5a2174 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human 8e-04
d1vj0a1184 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein 0.001
d1vj0a2182 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {T 0.001
d1rjwa2168 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillu 0.002
d1h2ba1171 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenas 0.003
d1iz0a2171 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus 0.003
d1o89a1146 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein 0.004
d1p0fa1198 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydro 0.004
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Alcohol dehydrogenase-like, C-terminal domain
domain: Alcohol dehydrogenase
species: Human (Homo sapiens), different isozymes [TaxId: 9606]
 Score = 57.7 bits (138), Expect = 8e-11
 Identities = 21/109 (19%), Positives = 37/109 (33%), Gaps = 1/109 (0%)

Query: 136 FEHAASLADSYSTAQIVFSRHAKLKEKQTVLVTAAGGGLGLAAVDMATKIYKAKVIGVCN 195
            +    L    ST        AKL+      V   GG      +        +++IGV  
Sbjct: 3   LDKVCLLGCGISTGYGAAVNTAKLEPGSVCAVFGLGGVGLAVIMGCK-VAGASRIIGVDI 61

Query: 196 SEDKTDLIRQKGAWAALTFTNEKSLVNKVLEVSGGKYANVVFEAVGGED 244
           ++DK    ++ GA   +   +    + +VL        +  FE +G   
Sbjct: 62  NKDKFARAKEFGATECINPQDFSKPIQEVLIEMTDGGVDYSFECIGNVK 110


>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Length = 176 Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 189 Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 195 Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 174 Back     information, alignment and structure
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 192 Back     information, alignment and structure
>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 197 Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 175 Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 183 Back     information, alignment and structure
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Length = 175 Back     information, alignment and structure
>d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Length = 162 Back     information, alignment and structure
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Length = 199 Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Length = 176 Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 201 Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 174 Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 174 Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Length = 167 Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Length = 202 Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Length = 174 Back     information, alignment and structure
>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Length = 178 Back     information, alignment and structure
>d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Length = 175 Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Length = 182 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Length = 131 Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Length = 194 Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Length = 187 Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Length = 174 Back     information, alignment and structure
>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 184 Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Length = 182 Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 168 Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 171 Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Length = 171 Back     information, alignment and structure
>d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Length = 146 Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Length = 198 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query296
d1yb5a1150 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.95
d1e3ja1178 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.94
d1llua1175 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 99.94
d1qora1147 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.93
d1cdoa1199 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 99.93
d1h2ba1171 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.93
d1rjwa1171 Alcohol dehydrogenase {Bacillus stearothermophilus 99.93
d2fzwa1197 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.92
d1xa0a1152 B. subtilis YhfP homologue {Bacillus stearothermop 99.92
d1piwa1192 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.92
d1iz0a1131 Quinone oxidoreductase {Thermus thermophilus [TaxI 99.92
d1pl8a1185 Ketose reductase (sorbitol dehydrogenase) {Human ( 99.92
d1e3ia1202 Alcohol dehydrogenase {Mouse (Mus musculus), class 99.92
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 99.91
d1vj0a1184 Hypothetical protein TM0436 {Thermotoga maritima [ 99.9
d1jvba1177 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.9
d1f8fa1194 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 99.9
d1kola1201 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 99.9
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 99.89
d1o89a1146 Hypothetical protein YhdH {Escherichia coli [TaxId 99.89
d2jhfa1198 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 99.88
d1tt7a1162 Hypothetical protein YhfP {Bacillus subtilis [TaxI 99.88
d1uufa1179 Hypothetical protein YahK {Escherichia coli [TaxId 99.87
d1gu7a1175 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 99.87
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 99.87
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 99.87
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 99.87
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 99.87
d1jqba1177 Bacterial secondary alcohol dehydrogenase {Clostri 99.87
d1p0fa1198 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 99.86
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 99.86
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 99.85
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 99.84
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 99.84
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 99.84
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 99.83
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.83
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 99.83
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 99.82
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 99.82
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 99.82
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 99.81
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 99.81
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 99.81
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 99.81
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 99.81
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 99.81
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 99.81
d1o89a2177 Hypothetical protein YhdH {Escherichia coli [TaxId 99.76
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 99.76
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 99.75
d1tt7a2167 Hypothetical protein YhfP {Bacillus subtilis [TaxI 99.73
d1o8ca277 Hypothetical protein YhdH {Escherichia coli [TaxId 99.49
d1vj1a1166 Putative zinc-binding alcohol dehydrogenase {Mouse 99.47
d1v3va1147 Leukotriene b4 12-hydroxydehydrogenase/prostagland 99.37
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 97.75
d2d1ya1 248 Hypothetical protein TTHA0369 {Thermus thermophilu 97.73
d1ydea1 250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 97.63
d1cyda_ 242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 97.57
d1pr9a_ 244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 97.56
d1ulsa_ 242 beta-keto acyl carrier protein reductase {Thermus 97.55
d1q7ba_ 243 beta-keto acyl carrier protein reductase {Escheric 97.5
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 97.45
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 97.44
d1k2wa_ 256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 97.44
d2ae2a_ 259 Tropinone reductase {Jimsonweed (Datura stramonium 97.44
d1hdca_ 254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 97.42
d1hxha_ 253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 97.42
d1ae1a_ 258 Tropinone reductase {Jimsonweed (Datura stramonium 97.41
d1bdba_ 276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 97.39
d1zema1 260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 97.39
d1fmca_ 255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 97.38
d2ag5a1 245 Dehydrogenase/reductase SDR family member 6, DHRS6 97.38
d1yo6a1 250 Putative carbonyl reductase sniffer {Caenorhabditi 97.37
d1vl8a_ 251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 97.34
d1dhra_ 236 Dihydropteridin reductase (pteridine reductase) {R 97.34
d2bgka1 268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 97.33
d1h5qa_ 260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 97.3
d2gdza1 254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 97.27
d1xq1a_ 259 Tropinone reductase {Thale cress (Arabidopsis thal 97.26
d1zk4a1 251 R-specific alcohol dehydrogenase {Lactobacillus br 97.25
d1xg5a_ 257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 97.25
d2rhca1 257 beta-keto acyl carrier protein reductase {Streptom 97.24
d1iy8a_ 258 Levodione reductase {Corynebacterium aquaticum [Ta 97.24
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 97.23
d2ew8a1 247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 97.22
d1geea_ 261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 97.22
d1spxa_ 264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 97.2
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 97.2
d1o5ia_ 234 beta-keto acyl carrier protein reductase {Thermoto 97.2
d1xhla_ 274 Hypothetical protein F25D1.5 {Caenorhabditis elega 97.19
d1xkqa_ 272 Hypothetical protein R05D8.7 {Caenorhabditis elega 97.18
d1w6ua_ 294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 97.17
d1yxma1 297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 97.17
d1sbya1 254 Drosophila alcohol dehydrogenase {Fly (Drosophila 97.16
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 97.14
d1gz6a_ 302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 97.1
d1ja9a_ 259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 97.08
d1wmaa1 275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 97.06
d1g0oa_ 272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 97.06
d1xu9a_ 269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 97.04
d1x1ta1 260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 97.01
d1snya_ 248 Carbonyl reductase sniffer {Fruit fly (Drosophila 97.01
d1ulua_ 256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 97.0
d1zmta1 252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 96.99
d1gega_ 255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 96.97
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 96.96
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 96.93
d2fr1a1 259 Erythromycin synthase, eryAI, 1st ketoreductase mo 96.9
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 96.87
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 96.85
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 96.82
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 96.8
d2pd4a1 274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 96.79
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 96.54
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 96.49
d2o23a1 248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 96.44
d1edoa_ 244 beta-keto acyl carrier protein reductase {Oil seed 96.42
d1qsga_ 258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 96.37
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 96.04
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 96.03
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 96.02
d1oaaa_ 259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 95.96
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 95.96
d2q46a1 252 Hypothetical protein At5g02240 (T7H20_290) {Thale 95.86
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 95.77
d2h7ma1 268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 95.75
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 95.74
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.74
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 95.58
d1mxha_ 266 Dihydropteridin reductase (pteridine reductase) {T 95.56
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 95.55
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 95.55
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 95.54
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.33
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 95.13
d1y1pa1 342 Aldehyde reductase II {Sporobolomyces salmonicolor 95.02
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 94.88
d1fjha_ 257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 94.86
d1d7oa_ 297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 94.84
d1vl0a_ 281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 94.81
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 94.77
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 94.73
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 94.68
d1jtva_ 285 Human estrogenic 17beta-hydroxysteroid dehydrogena 94.65
d1uaya_ 241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 94.57
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 94.53
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 94.49
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 94.48
d1e7wa_ 284 Dihydropteridin reductase (pteridine reductase) {L 94.45
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 94.42
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 94.25
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 94.13
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 94.12
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 94.09
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 94.09
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 94.02
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 93.93
d1li4a1163 S-adenosylhomocystein hydrolase {Human (Homo sapie 93.61
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 93.59
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 93.18
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 93.01
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 92.99
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 92.82
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 92.79
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 92.65
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 92.48
d1nvta1177 Shikimate 5-dehydrogenase AroE {Archaeon Methanoco 92.4
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 92.35
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 92.32
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 92.31
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 92.29
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 92.13
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 92.02
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 91.92
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 91.63
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 90.92
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 90.82
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 90.8
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 90.61
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 90.58
d1leha1230 Leucine dehydrogenase {Bacillus sphaericus [TaxId: 90.53
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 90.52
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 90.51
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 90.42
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 90.41
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 90.33
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 90.3
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 89.98
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 89.66
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 89.65
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 89.56
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 89.49
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 89.27
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 89.23
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 89.08
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 89.05
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 88.98
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 88.9
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 88.88
d1p3da196 UDP-N-acetylmuramate-alanine ligase MurC {Haemophi 88.81
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 88.72
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 88.57
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 88.51
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 87.89
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 87.87
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 87.64
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 87.53
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 87.51
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 87.41
d2voua1 265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 87.32
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 87.24
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 87.04
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 87.03
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 86.87
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 86.83
d1j6ua189 UDP-N-acetylmuramate-alanine ligase MurC {Thermoto 86.7
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 86.54
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 86.5
d1v8ba1163 S-adenosylhomocystein hydrolase {Plasmodium falcip 86.47
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 86.46
d1eq2a_ 307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 86.41
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 86.23
d1id1a_153 Rck domain from putative potassium channel Kch {Es 86.23
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 86.08
d1oi7a1121 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 85.63
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 85.45
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 84.88
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 84.64
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 84.62
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 84.43
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 84.42
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 84.4
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 84.31
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 84.2
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 84.14
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 84.12
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 83.78
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 83.75
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 83.59
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 83.53
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 83.29
d1c0pa1 268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 83.13
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 83.13
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 83.01
d2i76a2153 Hypothetical protein TM1727 {Thermotoga maritima [ 82.59
d2nu7a1119 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 82.36
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 82.26
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 82.14
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 82.08
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 81.97
d2bhsa1292 O-acetylserine sulfhydrylase (Cysteine synthase) { 81.78
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 81.59
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 81.48
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 81.18
d1euca1130 Succinyl-CoA synthetase, alpha-chain, N-terminal ( 81.17
d1hwxa1 293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 80.76
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 80.74
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 80.57
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 80.56
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 80.31
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 80.11
>d1yb5a1 b.35.1.2 (A:6-120,A:295-329) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: GroES-like
superfamily: GroES-like
family: Alcohol dehydrogenase-like, N-terminal domain
domain: Quinone oxidoreductase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.95  E-value=6.1e-28  Score=193.07  Aligned_cols=148  Identities=16%  Similarity=0.268  Sum_probs=129.3

Q ss_pred             eeeEeecccCCcceEEecCCCCCCCCCCCCCCCCCCCcEEEEeeeeecChhhHHHHcCCCCCCCCCCCcCCCceeEEEEE
Q psy1959           2 RIDIQCCALNSSDLLLYNGSGDAKPTLPLVPGFEFSGTIIEKKMMTRINSSDLLLYNGSGDAKPTLPLVPGFEFSGTVIE   81 (296)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~evlvkv~~~~i~~~D~~~~~g~~~~~~~~p~~~G~e~~G~V~~   81 (296)
                      |..+.+..+|..+.+.+..   ..|.|.|+++     ||||||.+++||++|.+.+.|.+.....+|.++|||++|+|++
T Consensus         3 MkAv~~~~~G~p~~l~~~~---~~~~P~~~~~-----eVlVkv~a~~i~~~D~~~~~g~~~~~~~~p~i~G~e~~G~V~~   74 (150)
T d1yb5a1           3 MRAVRVFEFGGPEVLKLRS---DIAVPIPKDH-----QVLIKVHACGVNPVETYIRSGTYSRKPLLPYTPGSDVAGVIEA   74 (150)
T ss_dssp             EEEEEESSCSSGGGEEEEE---EEECCCCCTT-----EEEEEEEEEECCHHHHHHHHTCSSCCCCSSBCCCSCEEEEEEE
T ss_pred             eeEEEEEccCCcceEEEEe---ecCCCCCCCC-----eEEEEEEEecCcccchhhhcCCcCccccccccCccceeeeeEe
Confidence            4455566666665555431   2577888899     9999999999999999999998888788899999999999999


Q ss_pred             EccCCCCCCCCCCCCCCCCCCCEEEEecCCCCCcccceEeeeCCceEECCCCCCHHHHhhhccHHHHHHHHHHHHcCCCC
Q psy1959          82 VADTKSSSTEEDDEEDVLQVGDKVLALNKELLHGFSDQCVVHTNDVFKIPEKMTFEHAASLADSYSTAQIVFSRHAKLKE  161 (296)
Q Consensus        82 v~~~~~~~~~~g~~v~~~~~Gd~V~~~~~~~~g~~~~~~~v~~~~~~~iP~~~~~~~aa~l~~~~~ta~~~l~~~~~~~~  161 (296)
                      +          |+++++|++||||++... .+|+|+||++++++.++++|+++++++||+++..+.++|+.+...+..+.
T Consensus        75 v----------G~~v~~~~vGdrV~~~~~-~~G~~ae~~~v~~~~~~~iP~~ls~~~Aa~~~~~~~ta~~~~~~~g~~~~  143 (150)
T d1yb5a1          75 V----------GDNASAFKKGDRVFTSST-ISGGYAEYALAADHTVYKLPEKLKPVIGSQYPLEKVAEAHENIIHGSGAT  143 (150)
T ss_dssp             E----------CTTCTTCCTTCEEEESCC-SSCSSBSEEEEEGGGEEECCTTCCCCEEEEEEGGGHHHHHHHHHHSSCCS
T ss_pred             e----------cceeeccccCcccccccc-ccccccccccccccccccccCCCCHHHHHHhhhhhhhehhhheEEcCccc
Confidence            9          999999999999988654 35999999999999999999999999999999999999999888899999


Q ss_pred             CcEEEEE
Q psy1959         162 KQTVLVT  168 (296)
Q Consensus       162 g~~vlI~  168 (296)
                      |+++||+
T Consensus       144 G~~vliL  150 (150)
T d1yb5a1         144 GKMILLL  150 (150)
T ss_dssp             SEEEEEC
T ss_pred             CCEEEEC
Confidence            9999874



>d1e3ja1 b.35.1.2 (A:4-142,A:313-351) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1llua1 b.35.1.2 (A:2-143,A:310-342) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qora1 b.35.1.2 (A:2-112,A:292-327) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cdoa1 b.35.1.2 (A:1-164,A:340-374) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1h2ba1 b.35.1.2 (A:17-154,A:327-359) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1rjwa1 b.35.1.2 (A:1-137,A:306-339) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2fzwa1 b.35.1.2 (A:1-162,A:339-373) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1xa0a1 b.35.1.2 (A:1-118,A:295-328) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1piwa1 b.35.1.2 (A:1-152,A:321-360) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iz0a1 b.35.1.2 (A:1-98,A:270-302) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pl8a1 b.35.1.2 (A:1-145,A:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia1 b.35.1.2 (A:1-167,A:342-376) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vj0a1 b.35.1.2 (A:2-155,A:338-367) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jvba1 b.35.1.2 (A:1-143,A:314-347) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1f8fa1 b.35.1.2 (A:4-162,A:337-371) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1kola1 b.35.1.2 (A:2-160,A:356-397) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o89a1 b.35.1.2 (A:1-115,A:293-323) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2jhfa1 b.35.1.2 (A:1-163,A:340-374) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1tt7a1 b.35.1.2 (A:2-127,A:295-330) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uufa1 b.35.1.2 (A:3-144,A:313-349) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gu7a1 b.35.1.2 (A:23-160,A:350-386) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1jqba1 b.35.1.2 (A:1001-1139,A:1314-1351) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1p0fa1 b.35.1.2 (A:1001-1163,A:1338-1372) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1o89a2 c.2.1.1 (A:116-292) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1tt7a2 c.2.1.1 (A:128-294) Hypothetical protein YhfP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o8ca2 c.2.1.1 (A:116-192) Hypothetical protein YhdH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v3va1 b.35.1.2 (A:1-112,A:295-329) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1li4a1 c.2.1.4 (A:190-352) S-adenosylhomocystein hydrolase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1nvta1 c.2.1.7 (A:111-287) Shikimate 5-dehydrogenase AroE {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1leha1 c.2.1.7 (A:135-364) Leucine dehydrogenase {Bacillus sphaericus [TaxId: 1421]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p3da1 c.5.1.1 (A:11-106) UDP-N-acetylmuramate-alanine ligase MurC {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1j6ua1 c.5.1.1 (A:0-88) UDP-N-acetylmuramate-alanine ligase MurC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1v8ba1 c.2.1.4 (A:235-397) S-adenosylhomocystein hydrolase {Plasmodium falciparum, isolate 3D7 [TaxId: 5833]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1oi7a1 c.2.1.8 (A:1-121) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2i76a2 c.2.1.6 (A:2-154) Hypothetical protein TM1727 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2nu7a1 c.2.1.8 (A:2-120) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bhsa1 c.79.1.1 (A:2-293) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1euca1 c.2.1.8 (A:1-130) Succinyl-CoA synthetase, alpha-chain, N-terminal (CoA-binding) domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure