Psyllid ID: psy2050

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-
MTYELKARNLKLAGYQLVGLNWLAVMHNQQLCGILADEMGLGKTIQVISFLAYLHEAGLSRPKSPHLIIVPSSTLCKYKVPSRWRTSNCDKTSPVKPQTITVAQLRVPECDQSPSQEVGYNDIIMYLNIPH
ccHHHHHcccccHHHHHHHHHHHHHHHHcccccEEcccccccHHHHHHHHHHHHHHHccccccccEEEEEEcccccccccccccccccccccccccHHHHHHHHHHccccccccccEEEEccEEEEEcccc
cccHHHHcccccHHHHHHHHHHHHHHHHcccccHEHHHcccHHHHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHcHHHHHHHccccEEEEEcccHHHHHHHHHcccccccEEEEEEEEccc
MTYELKARNLKLAGYQLVGLNWLAVMHNQQLCGILademglgkTIQVISFLAYLHEaglsrpksphliivpsstlckykvpsrwrtsncdktspvkpqtitvaqlrvpecdqspsqevgyndiIMYLNIPH
MTYELKARNLKLAGYQLVGLNWLAVMHNQQLCGILADEMGLGKTIQVISFLAYLHEAGLSRPKSPHLIIVpsstlckykvpsrwrtsncdktspvkpqtitvaqlrvpecdqspsqevgyndIIMYLNIPH
MTYELKARNLKLAGYQLVGLNWLAVMHNQQLCGILADEMGLGKTIQVISFLAYLHEAGLSRPKSPHLIIVPSSTLCKYKVPSRWRTSNCDKTSPVKPQTITVAQLRVPECDQSPSQEVGYNDIIMYLNIPH
******ARNLKLAGYQLVGLNWLAVMHNQQLCGILADEMGLGKTIQVISFLAYLHEAGLSRPKSPHLIIVPSSTLCKYKVPSRWRTSNC*********TITVAQLRV**********VGYNDIIMYLN***
***E***RNLKLAGYQLVGLNWLAVMHNQQLCGILADEMGLGKTIQVISFLAYLHEAGLSRPKSPHLIIVPSSTLCKYKVPSRWRTSNCDKTSPVKPQ**************SPSQEVGYNDIIMYLNIP*
MTYELKARNLKLAGYQLVGLNWLAVMHNQQLCGILADEMGLGKTIQVISFLAYLHEAGLSRPKSPHLIIVPSSTLCKYKVPSRWRTSNCDKTSPVKPQTITVAQLRVPECDQSPSQEVGYNDIIMYLNIPH
*TYELKARNLKLAGYQLVGLNWLAVMHNQQLCGILADEMGLGKTIQVISFLAYLHEAGLSRPKSPHLIIVPSSTLCKYKVPSRWRTSNCDKTSPVKPQTITVAQLRVPECDQSPSQEVGYNDIIMYLNIPH
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTYELKARNLKLAGYQLVGLNWLAVMHNQQLCGILADEMGLGKTIQVISFLAYLHEAGLSRPKSPHLIIVPSSTLCKYKVPSRWRTSNCDKTSPVKPQTITVAQLRVPECDQSPSQEVGYNDIIMYLNIPH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query131 2.2.26 [Sep-21-2011]
Q9VL72 844 SWI/SNF-related matrix-as no N/A 0.603 0.093 0.634 7e-23
B0R061 972 SWI/SNF-related matrix-as yes N/A 0.488 0.065 0.671 1e-19
E1B7X9 1028 SWI/SNF-related matrix-as yes N/A 0.496 0.063 0.632 8e-18
E7F1C4 954 SWI/SNF-related matrix-as no N/A 0.526 0.072 0.583 1e-17
D3Z9Z9 1024 SWI/SNF-related matrix-as yes N/A 0.496 0.063 0.632 1e-17
Q04692 1021 SWI/SNF-related matrix-as yes N/A 0.496 0.063 0.632 1e-17
Q9H4L7 1026 SWI/SNF-related matrix-as yes N/A 0.496 0.063 0.617 3e-17
P87114 944 ATP-dependent helicase ff yes N/A 0.503 0.069 0.608 6e-17
O74842 1284 ATP-dependent helicase ff no N/A 0.503 0.051 0.579 2e-16
Q5FWR0 1003 SWI/SNF-related matrix-as yes N/A 0.519 0.067 0.535 1e-15
>sp|Q9VL72|SMRCD_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Drosophila melanogaster GN=Etl1 PE=1 SV=1 Back     alignment and function desciption
 Score =  105 bits (263), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 65/82 (79%), Gaps = 3/82 (3%)

Query: 4   ELKARNLKLAGYQLVGLNWLAVMHNQQLCGILADEMGLGKTIQVISFLAYLHEAGLSRPK 63
           +L +  L+LA YQ++GLNWL VMH Q++ GILADEMGLGKTIQVI+FLAYL E GLS  +
Sbjct: 281 KLLSSGLQLADYQIIGLNWLTVMHKQEMNGILADEMGLGKTIQVIAFLAYLKENGLS--Q 338

Query: 64  SPHLIIVPSSTLCKYKVP-SRW 84
           + HLI+VPSSTL  ++   SRW
Sbjct: 339 AAHLIVVPSSTLDNWEAEISRW 360
DNA helicase that possesses intrinsic ATP-dependent nucleosome-remodeling activity and is both required for DNA repair and heterochromatin organization. Promotes DNA end resection of double-strand breaks (DSBs) following DNA damage: probably acts by weakening histone DNA interactions in nucleosomes flanking DSBs.
Drosophila melanogaster (taxid: 7227)
EC: 3EC: .EC: 6EC: .EC: 4EC: .EC: 1EC: 2
>sp|B0R061|SMRDA_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1A OS=Danio rerio GN=smarcad1a PE=2 SV=1 Back     alignment and function description
>sp|E1B7X9|SMRCD_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Bos taurus GN=SMARCAD1 PE=3 SV=2 Back     alignment and function description
>sp|E7F1C4|SMRDB_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1B OS=Danio rerio GN=smarcad1b PE=3 SV=1 Back     alignment and function description
>sp|D3Z9Z9|SMRCD_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Rattus norvegicus GN=Smarcad1 PE=3 SV=1 Back     alignment and function description
>sp|Q04692|SMRCD_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Mus musculus GN=Smarcad1 PE=1 SV=2 Back     alignment and function description
>sp|Q9H4L7|SMRCD_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens GN=SMARCAD1 PE=1 SV=2 Back     alignment and function description
>sp|P87114|FFT1_SCHPO ATP-dependent helicase fft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft1 PE=3 SV=1 Back     alignment and function description
>sp|O74842|FFT2_SCHPO ATP-dependent helicase fft2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft2 PE=1 SV=1 Back     alignment and function description
>sp|Q5FWR0|SMRCD_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Xenopus tropicalis GN=smarcad1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
383861314 831 PREDICTED: SWI/SNF-related matrix-associ 0.580 0.091 0.679 8e-22
350402509 831 PREDICTED: SWI/SNF-related matrix-associ 0.580 0.091 0.679 9e-22
340711976 831 PREDICTED: LOW QUALITY PROTEIN: SWI/SNF- 0.580 0.091 0.679 1e-21
195117078 843 GI24344 [Drosophila mojavensis] gi|19391 0.564 0.087 0.675 2e-21
380030207 851 PREDICTED: SWI/SNF-related matrix-associ 0.580 0.089 0.679 2e-21
195387524 842 GJ21604 [Drosophila virilis] gi|19414890 0.564 0.087 0.662 4e-21
194859366 847 GG23998 [Drosophila erecta] gi|190661227 0.603 0.093 0.634 4e-21
195473413 666 GE10204 [Drosophila yakuba] gi|194175089 0.557 0.109 0.671 5e-21
195577949 847 GD22327 [Drosophila simulans] gi|1941908 0.603 0.093 0.634 5e-21
16767854 664 GH01406p [Drosophila melanogaster] 0.557 0.109 0.671 5e-21
>gi|383861314|ref|XP_003706131.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  108 bits (270), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 53/78 (67%), Positives = 60/78 (76%), Gaps = 2/78 (2%)

Query: 9   NLKLAGYQLVGLNWLAVMHNQQLCGILADEMGLGKTIQVISFLAYLHEAGLSRPKS-PHL 67
           NLKLA YQ+VGLNWLAVMH Q + GILADEMGLGKT+QVI+FL YL EAGL   K  PHL
Sbjct: 260 NLKLASYQMVGLNWLAVMHAQHVNGILADEMGLGKTVQVIAFLTYLKEAGLKDEKDGPHL 319

Query: 68  IIVPSSTLCKYKVP-SRW 84
           I+VPSST+  +     RW
Sbjct: 320 IVVPSSTMENWNNELERW 337

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350402509|ref|XP_003486511.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340711976|ref|XP_003394541.1| PREDICTED: LOW QUALITY PROTEIN: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|195117078|ref|XP_002003076.1| GI24344 [Drosophila mojavensis] gi|193913651|gb|EDW12518.1| GI24344 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|380030207|ref|XP_003698745.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1-like isoform 2 [Apis florea] Back     alignment and taxonomy information
>gi|195387524|ref|XP_002052444.1| GJ21604 [Drosophila virilis] gi|194148901|gb|EDW64599.1| GJ21604 [Drosophila virilis] Back     alignment and taxonomy information
>gi|194859366|ref|XP_001969360.1| GG23998 [Drosophila erecta] gi|190661227|gb|EDV58419.1| GG23998 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195473413|ref|XP_002088988.1| GE10204 [Drosophila yakuba] gi|194175089|gb|EDW88700.1| GE10204 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195577949|ref|XP_002078829.1| GD22327 [Drosophila simulans] gi|194190838|gb|EDX04414.1| GD22327 [Drosophila simulans] Back     alignment and taxonomy information
>gi|16767854|gb|AAL28145.1| GH01406p [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query131
FB|FBgn0032157 844 Etl1 "Etl1 homologue" [Drosoph 0.603 0.093 0.634 2.2e-20
ZFIN|ZDB-GENE-050522-499 972 smarcad1 "SWI/SNF-related, mat 0.488 0.065 0.671 1.7e-17
UNIPROTKB|E2RG62 1026 SMARCAD1 "Uncharacterized prot 0.496 0.063 0.632 5.6e-16
UNIPROTKB|J9NX47 1026 SMARCAD1 "Uncharacterized prot 0.496 0.063 0.632 5.6e-16
UNIPROTKB|J9PA79 1026 SMARCAD1 "Uncharacterized prot 0.496 0.063 0.632 5.6e-16
UNIPROTKB|E1B7X9 1028 SMARCAD1 "SWI/SNF-related matr 0.496 0.063 0.632 5.6e-16
UNIPROTKB|F1RWW3 1029 SMARCAD1 "Uncharacterized prot 0.496 0.063 0.632 5.6e-16
ZFIN|ZDB-GENE-091113-61 954 si:dkey-76p7.6 "si:dkey-76p7.6 0.526 0.072 0.583 1.1e-15
MGI|MGI:95453 1021 Smarcad1 "SWI/SNF-related, mat 0.496 0.063 0.632 1.2e-15
RGD|1309640 1024 Smarcad1 "SWI/SNF-related, mat 0.496 0.063 0.632 1.2e-15
FB|FBgn0032157 Etl1 "Etl1 homologue" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 252 (93.8 bits), Expect = 2.2e-20, P = 2.2e-20
 Identities = 52/82 (63%), Positives = 65/82 (79%)

Query:     4 ELKARNLKLAGYQLVGLNWLAVMHNQQLCGILADEMGLGKTIQVISFLAYLHEAGLSRPK 63
             +L +  L+LA YQ++GLNWL VMH Q++ GILADEMGLGKTIQVI+FLAYL E GLS+  
Sbjct:   281 KLLSSGLQLADYQIIGLNWLTVMHKQEMNGILADEMGLGKTIQVIAFLAYLKENGLSQ-- 338

Query:    64 SPHLIIVPSSTLCKYKVP-SRW 84
             + HLI+VPSSTL  ++   SRW
Sbjct:   339 AAHLIVVPSSTLDNWEAEISRW 360
GO:0004003 "ATP-dependent DNA helicase activity" evidence=ISS
GO:0003677 "DNA binding" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
ZFIN|ZDB-GENE-050522-499 smarcad1 "SWI/SNF-related, matrix-associated actin-dependent regulator of chromatin, subfamily a, containing DEAD/H box 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RG62 SMARCAD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NX47 SMARCAD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9PA79 SMARCAD1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1B7X9 SMARCAD1 "SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RWW3 SMARCAD1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-091113-61 si:dkey-76p7.6 "si:dkey-76p7.6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:95453 Smarcad1 "SWI/SNF-related, matrix-associated actin-dependent regulator of chromatin, subfamily a, containing DEAD/H box 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1309640 Smarcad1 "SWI/SNF-related, matrix-associated actin-dependent regulator of chromatin, subfamily a, containing DEAD/H box 1`" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
D3Z9Z9SMRCD_RAT3, ., 6, ., 4, ., 1, 20.63230.49610.0634yesN/A
B0R061SMRDA_DANRE3, ., 6, ., 4, ., 1, 20.67160.48850.0658yesN/A
Q5FWR0SMRCD_XENTR3, ., 6, ., 4, ., 1, 20.53520.51900.0677yesN/A
Q08773ISW2_YEAST3, ., 6, ., 4, ., -0.56520.51140.0598yesN/A
Q04692SMRCD_MOUSE3, ., 6, ., 4, ., 1, 20.63230.49610.0636yesN/A
G5EDG2SMRCD_CAEEL3, ., 6, ., 4, ., 1, 20.56250.46560.0616yesN/A
E1B7X9SMRCD_BOVIN3, ., 6, ., 4, ., 1, 20.63230.49610.0632yesN/A
Q9H4L7SMRCD_HUMAN3, ., 6, ., 4, ., 1, 20.61760.49610.0633yesN/A
P87114FFT1_SCHPO3, ., 6, ., 4, ., -0.60860.50380.0699yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
pfam00176 301 pfam00176, SNF2_N, SNF2 family N-terminal domain 7e-22
PLN03142 1033 PLN03142, PLN03142, Probable chromatin-remodeling 5e-21
COG0553 866 COG0553, HepA, Superfamily II DNA/RNA helicases, S 7e-16
smart00487201 smart00487, DEXDc, DEAD-like helicases superfamily 3e-09
cd00046144 cd00046, DEXDc, DEAD-like helicases superfamily 4e-07
PRK04914 956 PRK04914, PRK04914, ATP-dependent helicase HepA; V 0.002
>gnl|CDD|215770 pfam00176, SNF2_N, SNF2 family N-terminal domain Back     alignment and domain information 
 Score = 87.4 bits (217), Expect = 7e-22
 Identities = 34/62 (54%), Positives = 41/62 (66%), Gaps = 3/62 (4%)

Query: 15 YQLVGLNWLAVMHNQQLCGILADEMGLGKTIQVISFLA-YLHEAGLSRPKSPHLIIVPSS 73
          YQL G+NWL  + +  L GILADEMGLGKT+Q I+ LA YL E    R   P L++ P S
Sbjct: 1  YQLEGVNWLISLESNGLGGILADEMGLGKTLQTIALLATYLKEGKDRR--GPTLVVCPLS 58

Query: 74 TL 75
          TL
Sbjct: 59 TL 60

This domain is found in proteins involved in a variety of processes including transcription regulation (e.g., SNF2, STH1, brahma, MOT1), DNA repair (e.g. ERCC6, RAD16, RAD5), DNA recombination (e.g. RAD54), and chromatin unwinding (e.g. ISWI) as well as a variety of other proteins with little functional information (e.g. lodestar, ETL1). Length = 301
>gnl|CDD|215601 PLN03142, PLN03142, Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>gnl|CDD|223627 COG0553, HepA, Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily Back     alignment and domain information
>gnl|CDD|235319 PRK04914, PRK04914, ATP-dependent helicase HepA; Validated Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 131
KOG0389|consensus 941 99.97
KOG0385|consensus 971 99.96
KOG0391|consensus 1958 99.94
KOG0387|consensus 923 99.94
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 99.94
KOG0388|consensus 1185 99.93
KOG0384|consensus 1373 99.92
KOG0392|consensus 1549 99.91
KOG0386|consensus 1157 99.91
KOG4439|consensus 901 99.9
PF00176 299 SNF2_N: SNF2 family N-terminal domain; InterPro: I 99.89
KOG1002|consensus 791 99.88
KOG1000|consensus 689 99.79
KOG0390|consensus 776 99.78
COG0553 866 HepA Superfamily II DNA/RNA helicases, SNF2 family 99.76
PRK04914 956 ATP-dependent helicase HepA; Validated 99.72
KOG1015|consensus 1567 99.71
TIGR00603 732 rad25 DNA repair helicase rad25. All proteins in t 99.58
KOG0383|consensus 696 99.57
KOG1001|consensus 674 99.54
KOG1016|consensus 1387 99.52
KOG1123|consensus 776 99.2
KOG0298|consensus 1394 99.19
PF04851184 ResIII: Type III restriction enzyme, res subunit; 99.15
COG1061 442 SSL2 DNA or RNA helicases of superfamily II [Trans 99.07
PRK13766 773 Hef nuclease; Provisional 99.02
PHA02558 501 uvsW UvsW helicase; Provisional 98.97
smart00487201 DEXDc DEAD-like helicases superfamily. 98.94
cd00268203 DEADc DEAD-box helicases. A diverse family of prot 98.67
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 98.61
PRK11448 1123 hsdR type I restriction enzyme EcoKI subunit R; Pr 98.59
COG1205 851 Distinct helicase family with a unique C-terminal 98.54
TIGR00348 667 hsdR type I site-specific deoxyribonuclease, HsdR 98.44
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 98.38
TIGR00643 630 recG ATP-dependent DNA helicase RecG. 98.37
PRK01172 674 ski2-like helicase; Provisional 98.36
PRK11776 460 ATP-dependent RNA helicase DbpA; Provisional 98.24
PTZ00424 401 helicase 45; Provisional 98.24
PRK02362 737 ski2-like helicase; Provisional 98.24
PRK10917 681 ATP-dependent DNA helicase RecG; Provisional 98.2
PRK01297 475 ATP-dependent RNA helicase RhlB; Provisional 98.2
PRK10590 456 ATP-dependent RNA helicase RhlE; Provisional 98.2
COG4096 875 HsdR Type I site-specific restriction-modification 98.17
COG1204 766 Superfamily II helicase [General function predicti 98.12
PRK00254 720 ski2-like helicase; Provisional 98.11
PRK11634 629 ATP-dependent RNA helicase DeaD; Provisional 98.1
PRK11192 434 ATP-dependent RNA helicase SrmB; Provisional 98.08
PRK05580 679 primosome assembly protein PriA; Validated 98.03
PRK04837 423 ATP-dependent RNA helicase RhlB; Provisional 98.03
PLN00206 518 DEAD-box ATP-dependent RNA helicase; Provisional 97.98
PTZ00110 545 helicase; Provisional 97.98
TIGR00580 926 mfd transcription-repair coupling factor (mfd). Al 97.96
TIGR03817 742 DECH_helic helicase/secretion neighborhood putativ 97.94
PRK10689 1147 transcription-repair coupling factor; Provisional 97.88
TIGR00614 470 recQ_fam ATP-dependent DNA helicase, RecQ family. 97.85
KOG0354|consensus 746 97.84
PRK09401 1176 reverse gyrase; Reviewed 97.81
PRK04537 572 ATP-dependent RNA helicase RhlB; Provisional 97.8
PRK13767 876 ATP-dependent helicase; Provisional 97.77
COG1111 542 MPH1 ERCC4-like helicases [DNA replication, recomb 97.75
TIGR03158 357 cas3_cyano CRISPR-associated helicase, Cyano-type. 97.7
TIGR01054 1171 rgy reverse gyrase. Generally, these gyrases are e 97.59
PRK11057 607 ATP-dependent DNA helicase RecQ; Provisional 97.51
TIGR01389 591 recQ ATP-dependent DNA helicase RecQ. The ATP-depe 97.45
TIGR03714 762 secA2 accessory Sec system translocase SecA2. Memb 97.45
COG1200 677 RecG RecG-like helicase [DNA replication, recombin 97.35
PF13086 236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 97.0
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 96.94
PRK14701 1638 reverse gyrase; Provisional 96.84
TIGR02621 844 cas3_GSU0051 CRISPR-associated helicase Cas3, Anae 96.82
KOG1802|consensus 935 96.78
COG1110 1187 Reverse gyrase [DNA replication, recombination, an 96.74
TIGR00595 505 priA primosomal protein N'. All proteins in this f 96.67
COG1201 814 Lhr Lhr-like helicases [General function predictio 96.65
PLN03137 1195 ATP-dependent DNA helicase; Q4-like; Provisional 96.6
COG4889 1518 Predicted helicase [General function prediction on 96.6
KOG0350|consensus 620 96.55
PF12340229 DUF3638: Protein of unknown function (DUF3638); In 96.49
PF13872 303 AAA_34: P-loop containing NTP hydrolase pore-1 96.37
TIGR01407 850 dinG_rel DnaQ family exonuclease/DinG family helic 96.32
KOG0331|consensus 519 96.32
PRK12899 970 secA preprotein translocase subunit SecA; Reviewed 96.29
PRK15483 986 type III restriction-modification system StyLTI en 96.21
COG4098 441 comFA Superfamily II DNA/RNA helicase required for 96.01
PHA02653 675 RNA helicase NPH-II; Provisional 95.79
COG1197 1139 Mfd Transcription-repair coupling factor (superfam 95.75
PRK09200 790 preprotein translocase subunit SecA; Reviewed 95.72
TIGR00631 655 uvrb excinuclease ABC, B subunit. This family is b 95.71
KOG0330|consensus 476 95.64
smart00488 289 DEXDc2 DEAD-like helicases superfamily. 95.54
smart00489 289 DEXDc3 DEAD-like helicases superfamily. 95.54
TIGR00963 745 secA preprotein translocase, SecA subunit. The pro 95.4
TIGR01587 358 cas3_core CRISPR-associated helicase Cas3. This mo 95.31
PRK05298 652 excinuclease ABC subunit B; Provisional 95.28
COG0513 513 SrmB Superfamily II DNA and RNA helicases [DNA rep 95.13
KOG0952|consensus 1230 94.84
PRK12898 656 secA preprotein translocase subunit SecA; Reviewed 94.5
TIGR03117 636 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase 94.48
COG1199 654 DinG Rad3-related DNA helicases [Transcription / D 94.47
PRK09694 878 helicase Cas3; Provisional 94.39
COG1198 730 PriA Primosomal protein N' (replication factor Y) 93.88
PF1324576 AAA_19: Part of AAA domain 93.68
TIGR00604 705 rad3 DNA repair helicase (rad3). All proteins in t 93.67
TIGR00376 637 DNA helicase, putative. The gene product may repre 93.56
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 92.19
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 92.06
KOG0334|consensus 997 91.73
PRK14873 665 primosome assembly protein PriA; Provisional 91.73
KOG0951|consensus 1674 91.67
PRK09751 1490 putative ATP-dependent helicase Lhr; Provisional 91.61
PRK05707 328 DNA polymerase III subunit delta'; Validated 91.6
PRK13104 896 secA preprotein translocase subunit SecA; Reviewed 91.55
TIGR01447 586 recD exodeoxyribonuclease V, alpha subunit. This f 91.44
PF00580 315 UvrD-helicase: UvrD/REP helicase N-terminal domain 91.13
COG0610 962 Type I site-specific restriction-modification syst 90.6
PRK10536262 hypothetical protein; Provisional 90.56
KOG0298|consensus 1394 90.24
KOG1803|consensus 649 90.17
PRK04296190 thymidine kinase; Provisional 89.96
KOG0335|consensus 482 89.92
PRK07993 334 DNA polymerase III subunit delta'; Validated 89.82
COG4581 1041 Superfamily II RNA helicase [DNA replication, reco 89.72
COG1203 733 CRISPR-associated helicase Cas3 [Defense mechanism 89.67
KOG0345|consensus 567 89.3
cd01124187 KaiC KaiC is a circadian clock protein primarily f 89.13
PRK10875 615 recD exonuclease V subunit alpha; Provisional 89.13
TIGR01448 720 recD_rel helicase, putative, RecD/TraA family. Thi 88.89
KOG0348|consensus 708 87.77
TIGR02640 262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 87.75
PRK07246 820 bifunctional ATP-dependent DNA helicase/DNA polyme 87.63
PRK08074 928 bifunctional ATP-dependent DNA helicase/DNA polyme 87.06
PRK12904 830 preprotein translocase subunit SecA; Reviewed 86.39
COG1202 830 Superfamily II helicase, archaea-specific [General 86.29
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 85.64
PRK13103 913 secA preprotein translocase subunit SecA; Reviewed 85.58
KOG0947|consensus 1248 85.48
PRK06090 319 DNA polymerase III subunit delta'; Validated 85.23
PF09848 352 DUF2075: Uncharacterized conserved protein (DUF207 85.12
PRK12326 764 preprotein translocase subunit SecA; Reviewed 84.29
PF13177162 DNA_pol3_delta2: DNA polymerase III, delta subunit 84.09
PRK11054 684 helD DNA helicase IV; Provisional 82.89
PRK07952244 DNA replication protein DnaC; Validated 82.85
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 82.65
KOG1131|consensus 755 81.14
PRK10919 672 ATP-dependent DNA helicase Rep; Provisional 80.98
PF06745 226 KaiC: KaiC; InterPro: IPR014774 This entry represe 80.95
PRK06835329 DNA replication protein DnaC; Validated 80.87
PRK12906 796 secA preprotein translocase subunit SecA; Reviewed 80.32
PRK05973237 replicative DNA helicase; Provisional 80.32
PRK10646153 ADP-binding protein; Provisional 80.23
>KOG0389|consensus Back     alignment and domain information 
Probab=99.97  E-value=7.7e-31  Score=218.08  Aligned_cols=116  Identities=41%  Similarity=0.639  Sum_probs=103.9

Q ss_pred             cCCCCCCcchHHHHHHHHHHHHhhcccCeeeeCCCCCCHHHHHHHHHHHHHHhCCCCCCCCEEEEecCCchhhhhh-hhc
Q psy2050           5 LKARNLKLAGYQLVGLNWLAVMHNQQLCGILADEMGLGKTIQVISFLAYLHEAGLSRPKSPHLIIVPSSTLCKYKV-PSR   83 (131)
Q Consensus         5 ~~~~~~~L~~~Q~~~v~~l~~~~~~~~g~ilad~mGlGKT~~~ia~l~~~~~~~~~~~~~~~LIv~P~sl~~~W~~-~~~   83 (131)
                      +.+.+.+|++||.-|++||.-..+.+-.||||||||||||+|+||+++.+...+.   .+|.|||||.|++.||.+ |++
T Consensus       393 ~l~s~i~LkdYQlvGvNWL~Llyk~~l~gILADEMGLGKTiQvIaFlayLkq~g~---~gpHLVVvPsSTleNWlrEf~k  469 (941)
T KOG0389|consen  393 LLSSGIQLKDYQLVGVNWLLLLYKKKLNGILADEMGLGKTIQVIAFLAYLKQIGN---PGPHLVVVPSSTLENWLREFAK  469 (941)
T ss_pred             ccCCCCcccchhhhhHHHHHHHHHccccceehhhccCcchhHHHHHHHHHHHcCC---CCCcEEEecchhHHHHHHHHHH
Confidence            3567899999999999999999988889999999999999999999999999887   599999999999999999 999


Q ss_pred             ccCCCceeeccCCCcchhhhhhcCccCCCCCCCCCCCcEEEEcccc
Q psy2050          84 WRTSNCDKTSPVKPQTITVAQLRVPECDQSPSQEVGYNDIIMYLNI  129 (131)
Q Consensus        84 ~~p~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VvIttY~~  129 (131)
                      |||.++|..|+|...++.....++.+.      ..+|||++|||++
T Consensus       470 wCPsl~Ve~YyGSq~ER~~lR~~i~~~------~~~ydVllTTY~l  509 (941)
T KOG0389|consen  470 WCPSLKVEPYYGSQDERRELRERIKKN------KDDYDVLLTTYNL  509 (941)
T ss_pred             hCCceEEEeccCcHHHHHHHHHHHhcc------CCCccEEEEEeec
Confidence            999999999999987776666554442      2379999999997

>KOG0385|consensus Back     alignment and domain information
>KOG0391|consensus Back     alignment and domain information
>KOG0387|consensus Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG0388|consensus Back     alignment and domain information
>KOG0384|consensus Back     alignment and domain information
>KOG0392|consensus Back     alignment and domain information
>KOG0386|consensus Back     alignment and domain information
>KOG4439|consensus Back     alignment and domain information
>PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG1000|consensus Back     alignment and domain information
>KOG0390|consensus Back     alignment and domain information
>COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04914 ATP-dependent helicase HepA; Validated Back     alignment and domain information
>KOG1015|consensus Back     alignment and domain information
>TIGR00603 rad25 DNA repair helicase rad25 Back     alignment and domain information
>KOG0383|consensus Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>KOG1016|consensus Back     alignment and domain information
>KOG1123|consensus Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13766 Hef nuclease; Provisional Back     alignment and domain information
>PHA02558 uvsW UvsW helicase; Provisional Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>cd00268 DEADc DEAD-box helicases Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional Back     alignment and domain information
>COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] Back     alignment and domain information
>TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>TIGR00643 recG ATP-dependent DNA helicase RecG Back     alignment and domain information
>PRK01172 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11776 ATP-dependent RNA helicase DbpA; Provisional Back     alignment and domain information
>PTZ00424 helicase 45; Provisional Back     alignment and domain information
>PRK02362 ski2-like helicase; Provisional Back     alignment and domain information
>PRK10917 ATP-dependent DNA helicase RecG; Provisional Back     alignment and domain information
>PRK01297 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK10590 ATP-dependent RNA helicase RhlE; Provisional Back     alignment and domain information
>COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>COG1204 Superfamily II helicase [General function prediction only] Back     alignment and domain information
>PRK00254 ski2-like helicase; Provisional Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>PRK11192 ATP-dependent RNA helicase SrmB; Provisional Back     alignment and domain information
>PRK05580 primosome assembly protein PriA; Validated Back     alignment and domain information
>PRK04837 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional Back     alignment and domain information
>PTZ00110 helicase; Provisional Back     alignment and domain information
>TIGR00580 mfd transcription-repair coupling factor (mfd) Back     alignment and domain information
>TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase Back     alignment and domain information
>PRK10689 transcription-repair coupling factor; Provisional Back     alignment and domain information
>TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family Back     alignment and domain information
>KOG0354|consensus Back     alignment and domain information
>PRK09401 reverse gyrase; Reviewed Back     alignment and domain information
>PRK04537 ATP-dependent RNA helicase RhlB; Provisional Back     alignment and domain information
>PRK13767 ATP-dependent helicase; Provisional Back     alignment and domain information
>COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type Back     alignment and domain information
>TIGR01054 rgy reverse gyrase Back     alignment and domain information
>PRK11057 ATP-dependent DNA helicase RecQ; Provisional Back     alignment and domain information
>TIGR01389 recQ ATP-dependent DNA helicase RecQ Back     alignment and domain information
>TIGR03714 secA2 accessory Sec system translocase SecA2 Back     alignment and domain information
>COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14701 reverse gyrase; Provisional Back     alignment and domain information
>TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype Back     alignment and domain information
>KOG1802|consensus Back     alignment and domain information
>COG1110 Reverse gyrase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00595 priA primosomal protein N' Back     alignment and domain information
>COG1201 Lhr Lhr-like helicases [General function prediction only] Back     alignment and domain information
>PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>KOG0350|consensus Back     alignment and domain information
>PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length Back     alignment and domain information
>PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 Back     alignment and domain information
>TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative Back     alignment and domain information
>KOG0331|consensus Back     alignment and domain information
>PRK12899 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional Back     alignment and domain information
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] Back     alignment and domain information
>PHA02653 RNA helicase NPH-II; Provisional Back     alignment and domain information
>COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] Back     alignment and domain information
>PRK09200 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR00631 uvrb excinuclease ABC, B subunit Back     alignment and domain information
>KOG0330|consensus Back     alignment and domain information
>smart00488 DEXDc2 DEAD-like helicases superfamily Back     alignment and domain information
>smart00489 DEXDc3 DEAD-like helicases superfamily Back     alignment and domain information
>TIGR00963 secA preprotein translocase, SecA subunit Back     alignment and domain information
>TIGR01587 cas3_core CRISPR-associated helicase Cas3 Back     alignment and domain information
>PRK05298 excinuclease ABC subunit B; Provisional Back     alignment and domain information
>COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0952|consensus Back     alignment and domain information
>PRK12898 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 Back     alignment and domain information
>COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PRK09694 helicase Cas3; Provisional Back     alignment and domain information
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>TIGR00604 rad3 DNA repair helicase (rad3) Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>KOG0334|consensus Back     alignment and domain information
>PRK14873 primosome assembly protein PriA; Provisional Back     alignment and domain information
>KOG0951|consensus Back     alignment and domain information
>PRK09751 putative ATP-dependent helicase Lhr; Provisional Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK13104 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>TIGR01447 recD exodeoxyribonuclease V, alpha subunit Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>KOG1803|consensus Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>KOG0335|consensus Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] Back     alignment and domain information
>KOG0345|consensus Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PRK10875 recD exonuclease V subunit alpha; Provisional Back     alignment and domain information
>TIGR01448 recD_rel helicase, putative, RecD/TraA family Back     alignment and domain information
>KOG0348|consensus Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated Back     alignment and domain information
>PRK12904 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>COG1202 Superfamily II helicase, archaea-specific [General function prediction only] Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>PRK13103 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>KOG0947|consensus Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>PRK12326 preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>KOG1131|consensus Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK12906 secA preprotein translocase subunit SecA; Reviewed Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK10646 ADP-binding protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
3mwy_W 800 Crystal Structure Of The Chromodomain-atpase Portio 2e-12
1z6a_A 500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN 6e-06
1z63_A 500 Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COM 5e-04
>pdb|3MWY|W Chain W, Crystal Structure Of The Chromodomain-atpase Portion Of The Yeast Chd1 Chromatin Remodeler Length = 800 Back     alignment and structure 
Iteration: 1

 Score = 67.8 bits (164), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 31/65 (47%), Positives = 47/65 (72%), Gaps = 2/65 (3%)
Query: 11  KLAGYQLVGLNWLAVMHNQQLCGILADEMGLGKTIQVISFLAYLHEAGLSRPKSPHLIIV 70
           +L  +QL G+NW+A + ++   GILADEMGLGKT+Q ++F+++L  A   R   PH+I+V
Sbjct: 236 ELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFA--RRQNGPHIIVV 293
Query: 71  PSSTL 75
           P ST+
Sbjct: 294 PLSTM 298
>pdb|1Z6A|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE DOMAIN Length = 500 Back     alignment and structure
>pdb|1Z63|A Chain A, Sulfolobus Solfataricus Swi2SNF2 ATPASE CORE IN COMPLEX With Dsdna Length = 500 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query131
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 1e-28
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 3e-23
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 3e-22
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 3e-17
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Length = 800 Back     alignment and structure
 Score =  108 bits (271), Expect = 1e-28
 Identities = 31/68 (45%), Positives = 48/68 (70%), Gaps = 2/68 (2%)

Query: 8   RNLKLAGYQLVGLNWLAVMHNQQLCGILADEMGLGKTIQVISFLAYLHEAGLSRPKSPHL 67
           +  +L  +QL G+NW+A + ++   GILADEMGLGKT+Q ++F+++L  A   R   PH+
Sbjct: 233 KGGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFAR--RQNGPHI 290

Query: 68  IIVPSSTL 75
           I+VP ST+
Sbjct: 291 IVVPLSTM 298
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Length = 500 Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Length = 644 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Length = 968 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
3mwy_W 800 Chromo domain-containing protein 1; SWI2/SNF2 ATPa 99.92
1z63_A 500 Helicase of the SNF2/RAD54 hamily; protein-DNA com 99.89
1z3i_X 644 Similar to RAD54-like; recombination ATPase helica 99.86
3dmq_A 968 RNA polymerase-associated protein RAPA; SWF2/SNF2, 99.74
1wp9_A 494 ATP-dependent RNA helicase, putative; ATPase, DNA 99.63
2fwr_A 472 DNA repair protein RAD25; DNA unwinding, XPB, DNA 99.49
1rif_A282 DAR protein, DNA helicase UVSW; bacteriophage, REC 99.45
3tbk_A 555 RIG-I helicase domain; DECH helicase, ATP binding, 99.42
2ykg_A 696 Probable ATP-dependent RNA helicase DDX58; hydrola 99.41
4a2p_A 556 RIG-I, retinoic acid inducible protein I; hydrolas 99.4
2oca_A 510 DAR protein, ATP-dependent DNA helicase UVSW; ATP- 99.39
3h1t_A 590 Type I site-specific restriction-modification syst 99.35
4gl2_A 699 Interferon-induced helicase C domain-containing P; 99.35
4a2q_A 797 RIG-I, retinoic acid inducible protein I; hydrolas 99.35
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 99.34
4a2w_A 936 RIG-I, retinoic acid inducible protein I; hydrolas 99.31
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 99.28
3b6e_A216 Interferon-induced helicase C domain-containing P; 99.27
1xti_A 391 Probable ATP-dependent RNA helicase P47; alpha-bet 99.27
1t6n_A220 Probable ATP-dependent RNA helicase; RECA-like fol 99.23
2z0m_A 337 337AA long hypothetical ATP-dependent RNA helicase 99.22
1s2m_A 400 Putative ATP-dependent RNA helicase DHH1; ATP-bind 99.17
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 99.15
1fuu_A 394 Yeast initiation factor 4A; IF4A, helicase, DEAD-b 99.15
1hv8_A 367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 99.14
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 99.14
2j0s_A 410 ATP-dependent RNA helicase DDX48; mRNA processing, 99.11
3ber_A249 Probable ATP-dependent RNA helicase DDX47; DEAD, A 99.1
3pey_A 395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 99.1
2oxc_A230 Probable ATP-dependent RNA helicase DDX20; DEAD, s 99.1
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 99.09
1q0u_A219 Bstdead; DEAD protein, RNA binding protein; 1.85A 99.07
1wrb_A253 DJVLGB; RNA helicase, DEAD BOX, VASA, structural g 99.05
3eiq_A 414 Eukaryotic initiation factor 4A-I; PDCD4, anti-onc 99.04
3bor_A237 Human initiation factor 4A-II; translation initiat 98.99
2w00_A 1038 HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri 98.92
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 98.9
3fht_A 412 ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box 98.87
3oiy_A 414 Reverse gyrase helicase domain; topoisomerase, DNA 98.83
3iuy_A228 Probable ATP-dependent RNA helicase DDX53; REC-A-l 98.82
2eyq_A 1151 TRCF, transcription-repair coupling factor; MFD, S 98.8
3fho_A 508 ATP-dependent RNA helicase DBP5; mRNA export, ATPa 98.79
2i4i_A 417 ATP-dependent RNA helicase DDX3X; DEAD, structural 98.76
2db3_A 434 ATP-dependent RNA helicase VASA; DEAD-BOX, protein 98.76
1gm5_A 780 RECG; helicase, replication restart; HET: DNA ADP; 98.71
3fe2_A242 Probable ATP-dependent RNA helicase DDX5; DEAD, AD 98.69
2xgj_A 1010 ATP-dependent RNA helicase DOB1; hydrolase-RNA com 98.67
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 98.64
3fmp_B 479 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.53
2zj8_A 720 DNA helicase, putative SKI2-type helicase; RECA fo 98.52
3sqw_A 579 ATP-dependent RNA helicase MSS116, mitochondrial; 98.49
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 98.47
4a4z_A 997 Antiviral helicase SKI2; hydrolase, ATPase, mRNA d 98.45
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 98.45
3l9o_A 1108 ATP-dependent RNA helicase DOB1; REC-A fold, winge 98.44
3i5x_A 563 ATP-dependent RNA helicase MSS116; protein-RNA com 98.42
3fmo_B300 ATP-dependent RNA helicase DDX19B; nuclear porin, 98.29
1oyw_A 523 RECQ helicase, ATP-dependent DNA helicase; winged 98.23
2v1x_A 591 ATP-dependent DNA helicase Q1; DNA strand annealin 98.19
4ddu_A 1104 Reverse gyrase; topoisomerase, DNA supercoiling, a 98.08
1gku_B 1054 Reverse gyrase, TOP-RG; topoisomerase, DNA superco 97.97
3crv_A 551 XPD/RAD3 related DNA helicase; XPD helicase DNA re 97.59
2vl7_A 540 XPD; helicase, unknown function; 2.25A {Sulfolobus 97.57
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 97.03
4a15_A 620 XPD helicase, ATP-dependent DNA helicase TA0057; h 97.03
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 96.97
1c4o_A 664 DNA nucleotide excision repair enzyme UVRB; uvrabc 96.89
4f92_B 1724 U5 small nuclear ribonucleoprotein 200 kDa helica; 96.61
2d7d_A 661 Uvrabc system protein B; helicase, protein-DNA-ADP 96.57
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 96.21
1tf5_A 844 Preprotein translocase SECA subunit; ATPase, helic 95.78
2fsf_A 853 Preprotein translocase SECA subunit; ATPase, DNA-R 95.21
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 94.83
1nkt_A 922 Preprotein translocase SECA 1 subunit; preprotein 94.73
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 94.63
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 94.61
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 94.16
1yks_A 440 Genome polyprotein [contains: flavivirin protease 94.07
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 93.94
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 93.84
2z83_A 459 Helicase/nucleoside triphosphatase; hydrolase, mem 93.79
2ipc_A 997 Preprotein translocase SECA subunit; nucleotide bi 93.29
3o8b_A 666 HCV NS3 protease/helicase; ntpase, RNA, translocat 93.08
2wv9_A 673 Flavivirin protease NS2B regulatory subunit, FLAV 92.96
2jlq_A 451 Serine protease subunit NS3; ribonucleoprotein, nu 90.75
2b8t_A 223 Thymidine kinase; deoxyribonucleoside kinase, zinc 90.65
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 90.48
2whx_A 618 Serine protease/ntpase/helicase NS3; transcription 90.04
3rc3_A 677 ATP-dependent RNA helicase SUPV3L1, mitochondrial; 90.04
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 89.99
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 88.57
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 87.64
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 87.4
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 86.9
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 84.69
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 83.91
1uaa_A 673 REP helicase, protein (ATP-dependent DNA helicase 83.72
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 83.62
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 82.86
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 82.65
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 81.87
>3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.92  E-value=4.8e-25  Score=187.11  Aligned_cols=120  Identities=27%  Similarity=0.403  Sum_probs=95.5

Q ss_pred             CCCcchHHHHHHHHHHHHhhcccCeeeeCCCCCCHHHHHHHHHHHHHHhCCCCCCCCEEEEecCCchhhhhh-hhcccCC
Q psy2050           9 NLKLAGYQLVGLNWLAVMHNQQLCGILADEMGLGKTIQVISFLAYLHEAGLSRPKSPHLIIVPSSTLCKYKV-PSRWRTS   87 (131)
Q Consensus         9 ~~~L~~~Q~~~v~~l~~~~~~~~g~ilad~mGlGKT~~~ia~l~~~~~~~~~~~~~~~LIv~P~sl~~~W~~-~~~~~p~   87 (131)
                      +.+|||||++|++||...+..+.+|||||+||+|||+++++++..+...+..  .+|+|||||.+++.||.+ |++|+|+
T Consensus       234 ~~~Lr~yQ~egv~~l~~~~~~~~~~ILademGlGKT~~ai~~i~~l~~~~~~--~~~~LIV~P~sll~qW~~E~~~~~p~  311 (800)
T 3mwy_W          234 GGELRDFQLTGINWMAFLWSKGDNGILADEMGLGKTVQTVAFISWLIFARRQ--NGPHIIVVPLSTMPAWLDTFEKWAPD  311 (800)
T ss_dssp             SSCCCTHHHHHHHHHHHHHTTTCCEEECCCTTSSTTHHHHHHHHHHHHHHSC--CSCEEEECCTTTHHHHHHHHHHHSTT
T ss_pred             CCCcCHHHHHHHHHHHHHhhcCCCEEEEeCCCcchHHHHHHHHHHHHHhcCC--CCCEEEEECchHHHHHHHHHHHHCCC
Confidence            5799999999999999999999999999999999999999999887655444  689999999999999999 9999999


Q ss_pred             CceeeccCCCcchhhhhhcCccC--CCCCCCCCCCcEEEEccccC
Q psy2050          88 NCDKTSPVKPQTITVAQLRVPEC--DQSPSQEVGYNDIIMYLNIP  130 (131)
Q Consensus        88 ~~v~~~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~VvIttY~~~  130 (131)
                      +++.++++....+..........  ........+++||||||++.
T Consensus       312 ~~v~~~~g~~~~r~~~~~~~~~~~~~~~~~~~~~~dvvitTy~~l  356 (800)
T 3mwy_W          312 LNCICYMGNQKSRDTIREYEFYTNPRAKGKKTMKFNVLLTTYEYI  356 (800)
T ss_dssp             CCEEECCCSSHHHHHHHHHHSCSCC-----CCCCCSEEEECTTHH
T ss_pred             ceEEEEeCCHHHHHHHHHHHhhccccccccccccCCEEEecHHHH
Confidence            99999988876543322211100  00112334689999999863
>1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A Back     alignment and structure
>1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} Back     alignment and structure
>1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Back     alignment and structure
>1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 Back     alignment and structure
>3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Back     alignment and structure
>2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Back     alignment and structure
>4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Back     alignment and structure
>2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} Back     alignment and structure
>3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} Back     alignment and structure
>4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} Back     alignment and structure
>4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Back     alignment and structure
>1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Back     alignment and structure
>3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Back     alignment and structure
>1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Back     alignment and structure
>3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Back     alignment and structure
>3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Back     alignment and structure
>2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Back     alignment and structure
>3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Back     alignment and structure
>3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Back     alignment and structure
>2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 Back     alignment and structure
>2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Back     alignment and structure
>2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Back     alignment and structure
>1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 Back     alignment and structure
>3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A Back     alignment and structure
>2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Back     alignment and structure
>2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Back     alignment and structure
>3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A Back     alignment and structure
>3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Back     alignment and structure
>1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* Back     alignment and structure
>2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* Back     alignment and structure
>4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A Back     alignment and structure
>1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Back     alignment and structure
>3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* Back     alignment and structure
>2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* Back     alignment and structure
>4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B Back     alignment and structure
>2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A Back     alignment and structure
>2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A Back     alignment and structure
>2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} Back     alignment and structure
>3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... Back     alignment and structure
>2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} Back     alignment and structure
>2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A Back     alignment and structure
>3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 131
d1z63a1 230 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 h 2e-13
d1z3ix2 298 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fis 3e-12
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Length = 230 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Helicase of the SNF2/Rad54 hamily
species: Sulfolobus solfataricus [TaxId: 2287]

 Score = 62.0 bits (149), Expect = 2e-13
 Identities = 23/81 (28%), Positives = 37/81 (45%), Gaps = 3/81 (3%)

Query: 9  NLKLAGYQLVGLNWLAVMHNQQLCGILADEMGLGKTIQVISFLAYLHEAGLSRPKSPHLI 68
             L  YQ+ G +W+  M+       LAD+MGLGKT+Q I+  +   +       +P L+
Sbjct: 10 KANLRPYQIKGFSWMRFMNKLGFGICLADDMGLGKTLQTIAVFSDAKK---ENELTPSLV 66

Query: 69 IVPSSTLCKYKVPSRWRTSNC 89
          I P S L  ++        + 
Sbjct: 67 ICPLSVLKNWEEELSKFAPHL 87
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Length = 298 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query131
d1z63a1 230 Helicase of the SNF2/Rad54 hamily {Sulfolobus solf 99.94
d1z3ix2 298 Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI 99.92
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 99.6
d1rifa_282 DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] 99.42
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 99.17
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 99.11
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 98.96
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 98.52
d1oywa2206 RecQ helicase domain {Escherichia coli [TaxId: 562 98.47
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 98.18
d1hv8a1208 Putative DEAD box RNA helicase {Archaeon Methanoco 98.04
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 98.01
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 97.97
d1t6na_207 Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo 97.92
d2j0sa1222 Probable ATP-dependent RNA helicase DDX48 {Human ( 97.76
d1veca_206 DEAD box RNA helicase rck/p54 {Human (Homo sapiens 97.74
d2g9na1218 Initiation factor 4a {Human (Homo sapiens) [TaxId: 97.7
d1qdea_212 Initiation factor 4a {Baker's yeast (Saccharomyces 97.63
d1wrba1238 putative ATP-dependent RNA helicase VlgB {Flatworm 97.57
d1q0ua_209 Probable DEAD box RNA helicase YqfR {Bacillus stea 97.11
d2bmfa2 305 Dengue virus helicase {Dengue virus type 2 [TaxId: 97.08
d1s2ma1206 Putative ATP-dependent RNA helicase DHH1 {Baker's 97.04
d1t5la1 413 Nucleotide excision repair enzyme UvrB {Bacillus c 95.27
d1uaaa1 306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 94.81
d1c4oa1 408 Nucleotide excision repair enzyme UvrB {Thermus th 94.51
d1pjra1 318 DEXX box DNA helicase {Bacillus stearothermophilus 93.61
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 92.25
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 92.1
d1byia_ 224 Dethiobiotin synthetase {Escherichia coli [TaxId: 86.16
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 83.49
d1ihua1 296 Arsenite-translocating ATPase ArsA {Escherichia co 81.36
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 81.32
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 80.55
>d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Helicase of the SNF2/Rad54 hamily
species: Sulfolobus solfataricus [TaxId: 2287]

Probab=99.94  E-value=5.8e-27  Score=170.81  Aligned_cols=106  Identities=25%  Similarity=0.368  Sum_probs=90.6

Q ss_pred             CCCCCCcchHHHHHHHHHHHHhhcccCeeeeCCCCCCHHHHHHHHHHHHHHhCCCCCCCCEEEEecCCchhhhhh-hhcc
Q psy2050           6 KARNLKLAGYQLVGLNWLAVMHNQQLCGILADEMGLGKTIQVISFLAYLHEAGLSRPKSPHLIIVPSSTLCKYKV-PSRW   84 (131)
Q Consensus         6 ~~~~~~L~~~Q~~~v~~l~~~~~~~~g~ilad~mGlGKT~~~ia~l~~~~~~~~~~~~~~~LIv~P~sl~~~W~~-~~~~   84 (131)
                      ++.+.+|+|||++|++||..+...+.|||||||||+|||+++++++.........   .++|||||.+++.||.+ +.+|
T Consensus         7 ~~~~~~L~~yQ~~~v~~~~~~~~~~~g~iLaDe~GlGKT~~~i~~~~~~~~~~~~---~~~LIv~p~~l~~~W~~e~~~~   83 (230)
T d1z63a1           7 YNIKANLRPYQIKGFSWMRFMNKLGFGICLADDMGLGKTLQTIAVFSDAKKENEL---TPSLVICPLSVLKNWEEELSKF   83 (230)
T ss_dssp             CSCSSCCCHHHHHHHHHHHHHHHTTCCEEECCCTTSCHHHHHHHHHHHHHHTTCC---SSEEEEECSTTHHHHHHHHHHH
T ss_pred             hhhhcchhHHHHHHHHHHHHhhhcCCCEEEEeCCCCChHHHHHHhhhhhhhcccc---cccceecchhhhhHHHHHHHhh
Confidence            4678899999999999999999999999999999999999999999888776654   89999999999999999 9999


Q ss_pred             cCCCceeeccCCCcchhhhhhcCccCCCCCCCCCCCcEEEEcccc
Q psy2050          85 RTSNCDKTSPVKPQTITVAQLRVPECDQSPSQEVGYNDIIMYLNI  129 (131)
Q Consensus        85 ~p~~~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~VvIttY~~  129 (131)
                      .+..++..++.......               ..+++||||+|++
T Consensus        84 ~~~~~~~~~~~~~~~~~---------------~~~~~vvi~~~~~  113 (230)
T d1z63a1          84 APHLRFAVFHEDRSKIK---------------LEDYDIILTTYAV  113 (230)
T ss_dssp             CTTSCEEECSSSTTSCC---------------GGGSSEEEEEHHH
T ss_pred             cccccceeeccccchhh---------------ccCcCEEEeeHHH
Confidence            99888877655443321               1147899999986
>d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Back     information, alignment and structure
>d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure