Psyllid ID: psy207

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MSTESSFSSVQQGPPIEVFAVNKAYLDDPHPKKVNLSVGGCDPTEDQWKQLAQLFKERPSLFVFFDSAYQGFASGDLERDAFAVRYFAQEGFEFLCSQSFAKNFGLYSR
ccHHHHHHHHHccccccEEEEEcHHHccccccccccccccccccHHHHHHHHHHHHHcccccEEEEcccccccccccHHHHHHHHHHHHccccEEEEEccccHHccccc
ccHHHHHHHHHHcccccEEEEEccccccccccEEEEEEccccccHHHHHHHHHHHHHHHccEEEEEEcccccccccHHHHcHHHHHHHHccccEEEEEEcccccccHHc
mstessfssvqqgppieVFAVnkaylddphpkkvnlsvggcdpteDQWKQLAQLFKerpslfvffdsayqgfasgdLERDAFAVRYFAQEGFEFLcsqsfaknfglysr
mstessfssvqqgpPIEVFAVNKAYLDDPHPKKVNLSVGGCDPTEDQWKQLAQLFKERPSLFVFFDSAYQGFASGDLERDAFAVRYFAQEGFeflcsqsfaknfglysr
MSTESSFSSVQQGPPIEVFAVNKAYLDDPHPKKVNLSVGGCDPTEDQWKQLAQLFKERPSLFVFFDSAYQGFASGDLERDAFAVRYFAQEGFEFLCSQSFAKNFGLYSR
***************IEVFAVNKAYLDDPHPKKVNLSVGGCDPTEDQWKQLAQLFKERPSLFVFFDSAYQGFASGDLERDAFAVRYFAQEGFEFLCSQSFAKNFGL***
MSTESSFSSVQQGPPIEVFAVNKAYLDDPHPKKVNLSVGGCDPTEDQWKQLAQLFKERPSLFVFFDSAYQGFASGDLERDAFAVRYFAQEGFEFLCSQSFAKNFGLYS*
************GPPIEVFAVNKAYLDDPHPKKVNLSVGGCDPTEDQWKQLAQLFKERPSLFVFFDSAYQGFASGDLERDAFAVRYFAQEGFEFLCSQSFAKNFGLYSR
MSTESSFSSVQQGPPIEVFAVNKAYLDDPHPKKVNLSVGGCDPTEDQWKQLAQLFKERPSLFVFFDSAYQGFASGDLERDAFAVRYFAQEGFEFLCSQSFAKNFGLYSR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSTESSFSSVQQGPPIEVFAVNKAYLDDPHPKKVNLSVGGCDPTEDQWKQLAQLFKERPSLFVFFDSAYQGFASGDLERDAFAVRYFAQEGFEFLCSQSFAKNFGLYSR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query109 2.2.26 [Sep-21-2011]
Q4R5L1 413 Aspartate aminotransferas N/A N/A 0.623 0.164 0.710 3e-23
Q5R691 413 Aspartate aminotransferas yes N/A 0.623 0.164 0.710 3e-23
A5A6K8 413 Aspartate aminotransferas yes N/A 0.623 0.164 0.710 3e-23
P17174 413 Aspartate aminotransferas yes N/A 0.623 0.164 0.710 3e-23
P13221 413 Aspartate aminotransferas yes N/A 0.623 0.164 0.695 7e-23
P08906 413 Aspartate aminotransferas yes N/A 0.623 0.164 0.695 3e-22
P00503 413 Aspartate aminotransferas yes N/A 0.623 0.164 0.681 4e-22
P05201 413 Aspartate aminotransferas yes N/A 0.623 0.164 0.681 4e-22
P00504 412 Aspartate aminotransferas yes N/A 0.623 0.165 0.681 5e-22
P33097 413 Aspartate aminotransferas yes N/A 0.623 0.164 0.681 7e-22
>sp|Q4R5L1|AATC_MACFA Aspartate aminotransferase, cytoplasmic OS=Macaca fascicularis GN=GOT1 PE=2 SV=1 Back     alignment and function desciption
 Score =  107 bits (266), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 58/69 (84%), Gaps = 1/69 (1%)

Query: 40  GCDPTEDQWKQLAQLFKERPSLFVFFDSAYQGFASGDLERDAFAVRYFAQEGFEFLCSQS 99
           G DPT +QWKQ+A + K R  LF FFDSAYQGFASG+LERDA+A+RYF  EGFEF C+QS
Sbjct: 198 GTDPTPEQWKQIASVMKHR-FLFPFFDSAYQGFASGNLERDAWAIRYFVSEGFEFFCAQS 256

Query: 100 FAKNFGLYS 108
           F+KNFGLY+
Sbjct: 257 FSKNFGLYN 265
Plays a key role in amino acid metabolism.
Macaca fascicularis (taxid: 9541)
EC: 2EC: .EC: 6EC: .EC: 1EC: .EC: 1
>sp|Q5R691|AATC_PONAB Aspartate aminotransferase, cytoplasmic OS=Pongo abelii GN=GOT1 PE=2 SV=1 Back     alignment and function description
>sp|A5A6K8|AATC_PANTR Aspartate aminotransferase, cytoplasmic OS=Pan troglodytes GN=GOT1 PE=2 SV=1 Back     alignment and function description
>sp|P17174|AATC_HUMAN Aspartate aminotransferase, cytoplasmic OS=Homo sapiens GN=GOT1 PE=1 SV=3 Back     alignment and function description
>sp|P13221|AATC_RAT Aspartate aminotransferase, cytoplasmic OS=Rattus norvegicus GN=Got1 PE=1 SV=3 Back     alignment and function description
>sp|P08906|AATC_HORSE Aspartate aminotransferase, cytoplasmic OS=Equus caballus GN=GOT1 PE=1 SV=2 Back     alignment and function description
>sp|P00503|AATC_PIG Aspartate aminotransferase, cytoplasmic OS=Sus scrofa GN=GOT1 PE=1 SV=3 Back     alignment and function description
>sp|P05201|AATC_MOUSE Aspartate aminotransferase, cytoplasmic OS=Mus musculus GN=Got1 PE=1 SV=3 Back     alignment and function description
>sp|P00504|AATC_CHICK Aspartate aminotransferase, cytoplasmic OS=Gallus gallus GN=GOT1 PE=1 SV=3 Back     alignment and function description
>sp|P33097|AATC_BOVIN Aspartate aminotransferase, cytoplasmic OS=Bos taurus GN=GOT1 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
321460829 411 hypothetical protein DAPPUDRAFT_308666 [ 0.623 0.165 0.739 1e-23
224486256 402 glutamine-oxaloacetic transaminase [Daph 0.623 0.169 0.724 1e-23
224486248 401 glutamine-oxaloacetic transaminase [Daph 0.623 0.169 0.724 1e-23
224486250 402 glutamine-oxaloacetic transaminase [Daph 0.623 0.169 0.724 1e-23
224486258 403 glutamine-oxaloacetic transaminase [Daph 0.623 0.168 0.724 1e-23
224486246 407 glutamine-oxaloacetic transaminase [Daph 0.623 0.167 0.724 1e-23
224486252 404 glutamine-oxaloacetic transaminase [Daph 0.623 0.168 0.724 2e-23
224486244 407 glutamine-oxaloacetic transaminase [Daph 0.623 0.167 0.724 2e-23
193636478 405 PREDICTED: aspartate aminotransferase, c 0.623 0.167 0.710 2e-23
312090199 406 aspartate aminotransferase [Loa loa] gi| 0.623 0.167 0.724 3e-23
>gi|321460829|gb|EFX71867.1| hypothetical protein DAPPUDRAFT_308666 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  113 bits (283), Expect = 1e-23,   Method: Composition-based stats.
 Identities = 51/69 (73%), Positives = 59/69 (85%), Gaps = 1/69 (1%)

Query: 40  GCDPTEDQWKQLAQLFKERPSLFVFFDSAYQGFASGDLERDAFAVRYFAQEGFEFLCSQS 99
           G DPT+DQWKQ+A L +ER  LF FFDSAYQGFASGDL+RDA+AVRYF   GFE +C+QS
Sbjct: 192 GVDPTQDQWKQIADLIEER-GLFPFFDSAYQGFASGDLDRDAWAVRYFDSRGFEMVCAQS 250

Query: 100 FAKNFGLYS 108
           FAKNFGLY+
Sbjct: 251 FAKNFGLYN 259

Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|224486256|gb|ACN51893.1| glutamine-oxaloacetic transaminase [Daphnia magna] Back     alignment and taxonomy information
>gi|224486248|gb|ACN51889.1| glutamine-oxaloacetic transaminase [Daphnia magna] Back     alignment and taxonomy information
>gi|224486250|gb|ACN51890.1| glutamine-oxaloacetic transaminase [Daphnia magna] Back     alignment and taxonomy information
>gi|224486258|gb|ACN51894.1| glutamine-oxaloacetic transaminase [Daphnia magna] Back     alignment and taxonomy information
>gi|224486246|gb|ACN51888.1| glutamine-oxaloacetic transaminase [Daphnia magna] gi|224486254|gb|ACN51892.1| glutamine-oxaloacetic transaminase [Daphnia magna] Back     alignment and taxonomy information
>gi|224486252|gb|ACN51891.1| glutamine-oxaloacetic transaminase [Daphnia magna] Back     alignment and taxonomy information
>gi|224486244|gb|ACN51887.1| glutamine-oxaloacetic transaminase [Daphnia magna] gi|224486260|gb|ACN51895.1| glutamine-oxaloacetic transaminase [Daphnia magna] Back     alignment and taxonomy information
>gi|193636478|ref|XP_001947848.1| PREDICTED: aspartate aminotransferase, cytoplasmic-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|312090199|ref|XP_003146526.1| aspartate aminotransferase [Loa loa] gi|307758309|gb|EFO17543.1| aspartate aminotransferase [Loa loa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query109
RGD|2721 413 Got1 "glutamic-oxaloacetic tra 0.623 0.164 0.695 1.7e-31
MGI|MGI:95791 413 Got1 "glutamate oxaloacetate t 0.623 0.164 0.681 2.9e-31
UNIPROTKB|Q4R5L1 413 GOT1 "Aspartate aminotransfera 0.623 0.164 0.710 8e-31
UNIPROTKB|P17174 413 GOT1 "Aspartate aminotransfera 0.623 0.164 0.710 1.7e-30
UNIPROTKB|A5A6K8 413 GOT1 "Aspartate aminotransfera 0.623 0.164 0.710 1.7e-30
UNIPROTKB|Q5R691 413 GOT1 "Aspartate aminotransfera 0.623 0.164 0.710 1.7e-30
ZFIN|ZDB-GENE-040426-2003 410 got1 "glutamic-oxaloacetic tra 0.623 0.165 0.710 4e-30
UNIPROTKB|P33097 413 GOT1 "Aspartate aminotransfera 0.623 0.164 0.681 1.5e-29
UNIPROTKB|P08906 413 GOT1 "Aspartate aminotransfera 0.623 0.164 0.695 2.2e-29
UNIPROTKB|P00503 413 GOT1 "Aspartate aminotransfera 0.623 0.164 0.681 4.6e-29
RGD|2721 Got1 "glutamic-oxaloacetic transaminase 1, soluble (aspartate aminotransferase 1)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 266 (98.7 bits), Expect = 1.7e-31, Sum P(2) = 1.7e-31
 Identities = 48/69 (69%), Positives = 58/69 (84%)

Query:    40 GCDPTEDQWKQLAQLFKERPSLFVFFDSAYQGFASGDLERDAFAVRYFAQEGFEFLCSQS 99
             G DPTE++WKQ+A + K R  LF FFDSAYQGFASGDLE+DA+A+RYF  EGFE  C+QS
Sbjct:   198 GTDPTEEEWKQIAAVMKRR-FLFPFFDSAYQGFASGDLEKDAWAIRYFVSEGFELFCAQS 256

Query:   100 FAKNFGLYS 108
             F+KNFGLY+
Sbjct:   257 FSKNFGLYN 265
GO:0004069 "L-aspartate:2-oxoglutarate aminotransferase activity" evidence=ISO;ISS;IDA;IMP
GO:0004609 "phosphatidylserine decarboxylase activity" evidence=IEA;ISO
GO:0005737 "cytoplasm" evidence=ISO;IDA
GO:0005764 "lysosome" evidence=IDA
GO:0005829 "cytosol" evidence=ISO;TAS
GO:0006103 "2-oxoglutarate metabolic process" evidence=ISS
GO:0006107 "oxaloacetate metabolic process" evidence=IEA;ISO
GO:0006114 "glycerol biosynthetic process" evidence=ISO;IDA
GO:0006531 "aspartate metabolic process" evidence=ISS;IDA
GO:0006532 "aspartate biosynthetic process" evidence=IEA;ISO
GO:0006533 "aspartate catabolic process" evidence=IEA;ISO
GO:0006536 "glutamate metabolic process" evidence=ISS
GO:0019550 "glutamate catabolic process to aspartate" evidence=IEA;ISO
GO:0019551 "glutamate catabolic process to 2-oxoglutarate" evidence=IEA;ISO
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0031406 "carboxylic acid binding" evidence=IDA
GO:0032869 "cellular response to insulin stimulus" evidence=IEA;ISO
GO:0043648 "dicarboxylic acid metabolic process" evidence=IDA;IMP
GO:0043679 "axon terminus" evidence=IDA
GO:0047801 "L-cysteine:2-oxoglutarate aminotransferase activity" evidence=IDA
GO:0051384 "response to glucocorticoid stimulus" evidence=IEA;ISO
GO:0055089 "fatty acid homeostasis" evidence=IEA;ISO
GO:0080130 "L-phenylalanine:2-oxoglutarate aminotransferase activity" evidence=IEA
MGI|MGI:95791 Got1 "glutamate oxaloacetate transaminase 1, soluble" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R5L1 GOT1 "Aspartate aminotransferase, cytoplasmic" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|P17174 GOT1 "Aspartate aminotransferase, cytoplasmic" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A5A6K8 GOT1 "Aspartate aminotransferase, cytoplasmic" [Pan troglodytes (taxid:9598)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R691 GOT1 "Aspartate aminotransferase, cytoplasmic" [Pongo abelii (taxid:9601)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-2003 got1 "glutamic-oxaloacetic transaminase 1, soluble" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P33097 GOT1 "Aspartate aminotransferase, cytoplasmic" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P08906 GOT1 "Aspartate aminotransferase, cytoplasmic" [Equus caballus (taxid:9796)] Back     alignment and assigned GO terms
UNIPROTKB|P00503 GOT1 "Aspartate aminotransferase, cytoplasmic" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P46643AAT1_ARATH2, ., 6, ., 1, ., 10.55710.63300.1604yesN/A
P05201AATC_MOUSE2, ., 6, ., 1, ., 10.68110.62380.1646yesN/A
P13221AATC_RAT2, ., 6, ., 1, ., 10.69560.62380.1646yesN/A
P33097AATC_BOVIN2, ., 6, ., 1, ., 10.68110.62380.1646yesN/A
P58661AAT_SALTY2, ., 6, ., 1, ., 10.50720.61460.1691yesN/A
P17174AATC_HUMAN2, ., 6, ., 1, ., 10.71010.62380.1646yesN/A
Q5R691AATC_PONAB2, ., 6, ., 1, ., 10.71010.62380.1646yesN/A
P00503AATC_PIG2, ., 6, ., 1, ., 10.68110.62380.1646yesN/A
P00504AATC_CHICK2, ., 6, ., 1, ., 10.68110.62380.1650yesN/A
Q55F21AATM_DICDI2, ., 6, ., 1, ., 10.58820.61460.1572yesN/A
P08906AATC_HORSE2, ., 6, ., 1, ., 10.69560.62380.1646yesN/A
A5A6K8AATC_PANTR2, ., 6, ., 1, ., 10.71010.62380.1646yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
PLN02397 423 PLN02397, PLN02397, aspartate transaminase 2e-37
PTZ00376 404 PTZ00376, PTZ00376, aspartate aminotransferase; Pr 3e-37
COG1448 396 COG1448, TyrB, Aspartate/tyrosine/aromatic aminotr 2e-27
PRK09257 396 PRK09257, PRK09257, aromatic amino acid aminotrans 2e-26
pfam00155 357 pfam00155, Aminotran_1_2, Aminotransferase class I 2e-15
PLN02397 423 PLN02397, PLN02397, aspartate transaminase 2e-08
cd00609 350 cd00609, AAT_like, Aspartate aminotransferase fami 5e-07
PTZ00376 404 PTZ00376, PTZ00376, aspartate aminotransferase; Pr 7e-07
PRK09257 396 PRK09257, PRK09257, aromatic amino acid aminotrans 0.001
>gnl|CDD|215222 PLN02397, PLN02397, aspartate transaminase Back     alignment and domain information 
 Score =  130 bits (328), Expect = 2e-37
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 1/68 (1%)

Query: 40  GCDPTEDQWKQLAQLFKERPSLFVFFDSAYQGFASGDLERDAFAVRYFAQEGFEFLCSQS 99
           G DPT +QW+Q++ L K + +   FFDSAYQGFASGDL+ DA +VR F ++G E L +QS
Sbjct: 208 GVDPTPEQWEQISDLIKSK-NHLPFFDSAYQGFASGDLDADAQSVRMFVEDGHEILVAQS 266

Query: 100 FAKNFGLY 107
           +AKN GLY
Sbjct: 267 YAKNMGLY 274

Length = 423
>gnl|CDD|240390 PTZ00376, PTZ00376, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|224365 COG1448, TyrB, Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|181731 PRK09257, PRK09257, aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|215756 pfam00155, Aminotran_1_2, Aminotransferase class I and II Back     alignment and domain information
>gnl|CDD|215222 PLN02397, PLN02397, aspartate transaminase Back     alignment and domain information
>gnl|CDD|99734 cd00609, AAT_like, Aspartate aminotransferase family Back     alignment and domain information
>gnl|CDD|240390 PTZ00376, PTZ00376, aspartate aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|181731 PRK09257, PRK09257, aromatic amino acid aminotransferase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 109
KOG1411|consensus 427 99.97
KOG1412|consensus 410 99.96
COG1448 396 TyrB Aspartate/tyrosine/aromatic aminotransferase 99.94
PLN02397 423 aspartate transaminase 99.59
PTZ00376 404 aspartate aminotransferase; Provisional 99.58
PRK09257 396 aromatic amino acid aminotransferase; Provisional 99.55
COG0436 393 Aspartate/tyrosine/aromatic aminotransferase [Amin 99.5
PRK06425 332 histidinol-phosphate aminotransferase; Validated 99.44
TIGR03542 402 DAPAT_plant LL-diaminopimelate aminotransferase. T 99.43
PRK07590 409 L,L-diaminopimelate aminotransferase; Validated 99.4
COG0079 356 HisC Histidinol-phosphate/aromatic aminotransferas 99.38
PRK06348 384 aspartate aminotransferase; Provisional 99.37
PLN00143 409 tyrosine/nicotianamine aminotransferase; Provision 99.37
PRK06358 354 threonine-phosphate decarboxylase; Provisional 99.37
PRK07366 388 succinyldiaminopimelate transaminase; Validated 99.37
PF00155 363 Aminotran_1_2: Aminotransferase class I and II 1-a 99.37
PRK08056 356 threonine-phosphate decarboxylase; Provisional 99.35
KOG0633|consensus 375 99.34
TIGR01264 401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 99.33
PRK09276 385 LL-diaminopimelate aminotransferase; Provisional 99.32
PRK08354 311 putative aminotransferase; Provisional 99.32
PRK08068 389 transaminase; Reviewed 99.32
PLN02187 462 rooty/superroot1 99.32
PRK07568 397 aspartate aminotransferase; Provisional 99.31
PLN00175 413 aminotransferase family protein; Provisional 99.31
PRK01688 351 histidinol-phosphate aminotransferase; Provisional 99.3
PLN02656 409 tyrosine transaminase 99.3
PRK08960 387 hypothetical protein; Provisional 99.3
PLN00145 430 tyrosine/nicotianamine aminotransferase; Provision 99.29
PRK07683 387 aminotransferase A; Validated 99.29
PRK06108 382 aspartate aminotransferase; Provisional 99.29
PRK07681 399 aspartate aminotransferase; Provisional 99.29
PRK12414 384 putative aminotransferase; Provisional 99.29
PRK06959 339 putative threonine-phosphate decarboxylase; Provis 99.28
PRK05957 389 aspartate aminotransferase; Provisional 99.28
PLN02368 407 alanine transaminase 99.28
PRK07324 373 transaminase; Validated 99.28
PRK07777 387 aminotransferase; Validated 99.28
PRK04781 364 histidinol-phosphate aminotransferase; Provisional 99.27
PRK07337 388 aminotransferase; Validated 99.27
PRK05664 330 threonine-phosphate decarboxylase; Reviewed 99.27
PRK07682 378 hypothetical protein; Validated 99.27
PTZ00433 412 tyrosine aminotransferase; Provisional 99.27
PRK08912 387 hypothetical protein; Provisional 99.27
TIGR01140 330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 99.26
PRK09105 370 putative aminotransferase; Provisional 99.26
PRK08636 403 aspartate aminotransferase; Provisional 99.26
PRK09082 386 methionine aminotransferase; Validated 99.26
PRK05942 394 aspartate aminotransferase; Provisional 99.26
TIGR03540 383 DapC_direct LL-diaminopimelate aminotransferase. T 99.25
PRK06207 405 aspartate aminotransferase; Provisional 99.25
PRK09147 396 succinyldiaminopimelate transaminase; Provisional 99.24
TIGR01265 403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 99.24
TIGR03538 393 DapC_gpp succinyldiaminopimelate transaminase. Thi 99.24
PLN02450 468 1-aminocyclopropane-1-carboxylate synthase 99.24
PRK09148 405 aminotransferase; Validated 99.23
TIGR03801 521 asp_4_decarbox aspartate 4-decarboxylase. This enz 99.23
PRK07865 364 N-succinyldiaminopimelate aminotransferase; Review 99.22
PRK06855 433 aminotransferase; Validated 99.22
PRK13355 517 bifunctional HTH-domain containing protein/aminotr 99.21
PLN02376 496 1-aminocyclopropane-1-carboxylate synthase 99.21
PRK07309 391 aromatic amino acid aminotransferase; Validated 99.21
PLN02607 447 1-aminocyclopropane-1-carboxylate synthase 99.21
PRK06290 410 aspartate aminotransferase; Provisional 99.21
PRK05166 371 histidinol-phosphate aminotransferase; Provisional 99.21
PRK08175 395 aminotransferase; Validated 99.2
PRK09275 527 aspartate aminotransferase; Provisional 99.19
PRK05839 374 hypothetical protein; Provisional 99.19
PRK07550 386 hypothetical protein; Provisional 99.18
PRK08637 388 hypothetical protein; Provisional 99.18
PRK01533 366 histidinol-phosphate aminotransferase; Validated 99.18
PRK04635 354 histidinol-phosphate aminotransferase; Provisional 99.18
TIGR03539 357 DapC_actino succinyldiaminopimelate transaminase. 99.18
KOG0257|consensus 420 99.18
PTZ00377 481 alanine aminotransferase; Provisional 99.17
PRK03158 359 histidinol-phosphate aminotransferase; Provisional 99.16
PRK08153 369 histidinol-phosphate aminotransferase; Provisional 99.16
PRK09265 404 aminotransferase AlaT; Validated 99.16
PRK15481 431 transcriptional regulatory protein PtsJ; Provision 99.16
PLN02231 534 alanine transaminase 99.16
PRK14809 357 histidinol-phosphate aminotransferase; Provisional 99.15
TIGR03537 350 DapC succinyldiaminopimelate transaminase. Note: t 99.15
PRK08363 398 alanine aminotransferase; Validated 99.14
PRK14808 335 histidinol-phosphate aminotransferase; Provisional 99.14
PRK02610 374 histidinol-phosphate aminotransferase; Provisional 99.13
PRK08361 391 aspartate aminotransferase; Provisional 99.11
PLN03026 380 histidinol-phosphate aminotransferase; Provisional 99.1
PRK03967 337 histidinol-phosphate aminotransferase; Provisional 99.1
PRK06836 394 aspartate aminotransferase; Provisional 99.1
PRK06107 402 aspartate aminotransferase; Provisional 99.1
PRK07392 360 threonine-phosphate decarboxylase; Validated 99.08
PRK03321 352 putative aminotransferase; Provisional 99.08
PRK05764 393 aspartate aminotransferase; Provisional 99.06
PRK06225 380 aspartate aminotransferase; Provisional 99.02
PRK02731 367 histidinol-phosphate aminotransferase; Validated 99.02
PRK03317 368 histidinol-phosphate aminotransferase; Provisional 99.01
PRK05387 353 histidinol-phosphate aminotransferase; Provisional 99.0
PRK09440 416 avtA valine--pyruvate transaminase; Provisional 99.0
PRK04870 356 histidinol-phosphate aminotransferase; Provisional 98.99
PRK14807 351 histidinol-phosphate aminotransferase; Provisional 98.97
PRK07908 349 hypothetical protein; Provisional 98.93
PLN02672 1082 methionine S-methyltransferase 98.91
PRK00950 361 histidinol-phosphate aminotransferase; Validated 98.89
COG1168 388 MalY Bifunctional PLP-dependent enzyme with beta-c 98.83
TIGR01141 346 hisC histidinol-phosphate aminotransferase. Histid 98.8
cd00609 350 AAT_like Aspartate aminotransferase family. This f 98.71
KOG0256|consensus 471 98.3
PRK10534 333 L-threonine aldolase; Provisional 98.27
KOG0259|consensus 447 98.26
PRK07505 402 hypothetical protein; Provisional 98.26
COG1167 459 ARO8 Transcriptional regulators containing a DNA-b 98.24
cd06502 338 TA_like Low-specificity threonine aldolase (TA). T 98.21
PRK07049 427 methionine gamma-lyase; Validated 98.18
TIGR03576 346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 98.18
TIGR00858 360 bioF 8-amino-7-oxononanoate synthase. This model r 98.11
PRK13392 410 5-aminolevulinate synthase; Provisional 98.11
PRK05958 385 8-amino-7-oxononanoate synthase; Reviewed 98.06
TIGR00707 379 argD acetylornithine and succinylornithine aminotr 98.05
PLN02242 418 methionine gamma-lyase 98.04
PRK04073 396 rocD ornithine--oxo-acid transaminase; Provisional 98.03
TIGR01825 385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 98.01
PRK02627 396 acetylornithine aminotransferase; Provisional 98.0
PLN02721 353 threonine aldolase 97.95
PRK03244 398 argD acetylornithine aminotransferase; Provisional 97.91
PRK09064 407 5-aminolevulinate synthase; Validated 97.91
PRK05093 403 argD bifunctional N-succinyldiaminopimelate-aminot 97.9
PRK02936 377 argD acetylornithine aminotransferase; Provisional 97.84
PRK01278 389 argD acetylornithine transaminase protein; Provisi 97.83
cd00610 413 OAT_like Acetyl ornithine aminotransferase family. 97.81
COG3977 417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) 97.79
PRK06234 400 methionine gamma-lyase; Provisional 97.78
PRK07504 398 O-succinylhomoserine sulfhydrylase; Reviewed 97.78
PRK06460 376 hypothetical protein; Provisional 97.77
TIGR01328 391 met_gam_lyase methionine gamma-lyase. This model d 97.75
PLN02822 481 serine palmitoyltransferase 97.73
PRK08045 386 cystathionine gamma-synthase; Provisional 97.72
PRK05968 389 hypothetical protein; Provisional 97.69
cd06454 349 KBL_like KBL_like; this family belongs to the pyri 97.68
TIGR01821 402 5aminolev_synth 5-aminolevulinic acid synthase. Th 97.68
PRK02948 381 cysteine desulfurase; Provisional 97.65
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 97.63
PRK07503 403 methionine gamma-lyase; Provisional 97.63
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 97.61
TIGR02080 382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 97.59
PRK08249 398 cystathionine gamma-synthase; Provisional 97.58
PLN02955 476 8-amino-7-oxononanoate synthase 97.58
PRK08360 443 4-aminobutyrate aminotransferase; Provisional 97.57
PRK06767 386 methionine gamma-lyase; Provisional 97.56
COG1448 396 TyrB Aspartate/tyrosine/aromatic aminotransferase 97.56
TIGR01326 418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 97.55
PRK08133 390 O-succinylhomoserine sulfhydrylase; Validated 97.55
PRK08247 366 cystathionine gamma-synthase; Reviewed 97.54
PLN02483 489 serine palmitoyltransferase 97.53
PTZ00125 400 ornithine aminotransferase-like protein; Provision 97.53
PRK06939 397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 97.52
TIGR00713 423 hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi 97.51
PRK05937 370 8-amino-7-oxononanoate synthase; Provisional 97.5
KOG0258|consensus 475 97.49
PLN02624 474 ornithine-delta-aminotransferase 97.48
cd06452 361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 97.47
PRK13393 406 5-aminolevulinate synthase; Provisional 97.46
PRK07811 388 cystathionine gamma-synthase; Provisional 97.46
PRK06777 421 4-aminobutyrate aminotransferase; Provisional 97.42
PRK07269 364 cystathionine gamma-synthase; Reviewed 97.42
PRK08064 390 cystathionine beta-lyase; Provisional 97.42
TIGR02539 370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 97.41
TIGR01822 393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 97.41
PRK07671 377 cystathionine beta-lyase; Provisional 97.38
PRK06084 425 O-acetylhomoserine aminocarboxypropyltransferase; 97.37
PRK12381 406 bifunctional succinylornithine transaminase/acetyl 97.36
TIGR00700 420 GABAtrnsam 4-aminobutyrate aminotransferase, proka 97.33
TIGR00709 442 dat 2,4-diaminobutyrate 4-transaminases. This fami 97.31
TIGR01325 380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 97.3
PRK05939 397 hypothetical protein; Provisional 97.3
PRK13479 368 2-aminoethylphosphonate--pyruvate transaminase; Pr 97.29
PRK07179 407 hypothetical protein; Provisional 97.28
TIGR03246 397 arg_catab_astC succinylornithine transaminase fami 97.28
TIGR01979 403 sufS cysteine desulfurases, SufS subfamily. This m 97.28
KOG1412|consensus 410 97.26
PRK09792 421 4-aminobutyrate transaminase; Provisional 97.25
TIGR03301 355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 97.23
PRK08776 405 cystathionine gamma-synthase; Provisional 97.22
cd00614 369 CGS_like CGS_like: Cystathionine gamma-synthase is 97.22
PRK13238 460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 97.2
PRK04260 375 acetylornithine aminotransferase; Provisional 97.19
PRK07050 394 cystathionine beta-lyase; Provisional 97.18
PRK08088 425 4-aminobutyrate aminotransferase; Validated 97.18
PRK08861 388 cystathionine gamma-synthase; Provisional 97.16
PRK00854 401 rocD ornithine--oxo-acid transaminase; Reviewed 97.14
PRK07810 403 O-succinylhomoserine sulfhydrylase; Provisional 97.14
PRK08574 385 cystathionine gamma-synthase; Provisional 97.13
cd00378 402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 97.13
TIGR01885 401 Orn_aminotrans ornithine aminotransferase. This mo 97.1
PRK06918 451 4-aminobutyrate aminotransferase; Reviewed 97.07
TIGR01976 397 am_tr_V_VC1184 cysteine desulfurase family protein 97.0
TIGR02326 363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 97.0
TIGR01324 377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 96.99
PRK05967 395 cystathionine beta-lyase; Provisional 96.97
PRK06176 380 cystathionine gamma-synthase/cystathionine beta-ly 96.95
PRK07582 366 cystathionine gamma-lyase; Validated 96.95
PRK10874 401 cysteine sulfinate desulfinase; Provisional 96.95
PRK08248 431 O-acetylhomoserine aminocarboxypropyltransferase; 96.93
PRK09295 406 bifunctional cysteine desulfurase/selenocysteine l 96.92
TIGR03403 382 nifS_epsilon cysteine desulfurase, NifS family, ep 96.9
PRK08117 433 4-aminobutyrate aminotransferase; Provisional 96.85
TIGR03392 398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 96.82
PRK00062 426 glutamate-1-semialdehyde aminotransferase; Provisi 96.81
PRK05994 427 O-acetylhomoserine aminocarboxypropyltransferase; 96.75
PLN02509 464 cystathionine beta-lyase 96.71
PLN02855 424 Bifunctional selenocysteine lyase/cysteine desulfu 96.67
PLN03227 392 serine palmitoyltransferase-like protein; Provisio 96.65
PRK04612 408 argD acetylornithine transaminase protein; Provisi 96.64
TIGR03531 444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 96.54
cd06450 345 DOPA_deC_like DOPA decarboxylase family. This fami 96.43
PRK09264 425 diaminobutyrate--2-oxoglutarate aminotransferase; 96.42
PLN00144 382 acetylornithine transaminase 96.42
PRK05964 423 adenosylmethionine--8-amino-7-oxononanoate transam 96.37
TIGR01329 378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 96.35
cd00617 431 Tnase_like Tryptophanase family (Tnase). This fami 96.35
PRK08593 445 4-aminobutyrate aminotransferase; Provisional 96.29
PRK09028 394 cystathionine beta-lyase; Provisional 96.25
cd00613 398 GDC-P Glycine cleavage system P-protein, alpha- an 96.2
PRK06541 460 hypothetical protein; Provisional 96.19
KOG0634|consensus 472 96.19
PRK00011 416 glyA serine hydroxymethyltransferase; Reviewed 96.14
TIGR03235 353 DNA_S_dndA cysteine desulfurase DndA. This model d 96.07
PRK09331 387 Sep-tRNA:Cys-tRNA synthetase; Provisional 96.0
TIGR02407 412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 95.95
PLN02409 401 serine--glyoxylate aminotransaminase 95.95
PF12897 425 Aminotran_MocR: Alanine-glyoxylate amino-transfera 95.83
PRK06702 432 O-acetylhomoserine aminocarboxypropyltransferase; 95.78
PRK06058 443 4-aminobutyrate aminotransferase; Provisional 95.68
PRK03715 395 argD acetylornithine transaminase protein; Provisi 95.66
PF06838 403 Met_gamma_lyase: Methionine gamma-lyase ; InterPro 95.66
cd06453 373 SufS_like Cysteine desulfurase (SufS)-like. This f 95.62
PRK07495 425 4-aminobutyrate aminotransferase; Provisional 95.61
COG0156 388 BioF 7-keto-8-aminopelargonate synthetase and rela 95.54
PRK05769 441 4-aminobutyrate aminotransferase; Provisional 95.33
TIGR01437 363 selA_rel uncharacterized pyridoxal phosphate-depen 95.31
PRK07812 436 O-acetylhomoserine aminocarboxypropyltransferase; 95.25
cd06451 356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 95.21
PRK14012 404 cysteine desulfurase; Provisional 95.08
PRK08297 443 L-lysine aminotransferase; Provisional 95.01
PRK06173 429 adenosylmethionine--8-amino-7-oxononanoate transam 94.76
TIGR00508 427 bioA adenosylmethionine-8-amino-7-oxononanoate tra 94.74
PRK00615 433 glutamate-1-semialdehyde aminotransferase; Provisi 94.46
PRK04013 364 argD acetylornithine/acetyl-lysine aminotransferas 93.96
PRK11658 379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 93.92
PRK00451 447 glycine dehydrogenase subunit 1; Validated 93.91
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 93.9
PRK11522 459 putrescine--2-oxoglutarate aminotransferase; Provi 93.72
PRK06082 459 4-aminobutyrate aminotransferase; Provisional 93.59
PRK06209 431 glutamate-1-semialdehyde 2,1-aminomutase; Provisio 93.52
TIGR03251 431 LAT_fam L-lysine 6-transaminase. Characterized mem 93.49
TIGR03402 379 FeS_nifS cysteine desulfurase NifS. Members of thi 93.43
TIGR03372 442 putres_am_tran putrescine aminotransferase. Member 93.38
PRK05630 422 adenosylmethionine--8-amino-7-oxononanoate transam 93.3
TIGR02006 402 IscS cysteine desulfurase IscS. This model represe 93.09
PRK05639 457 4-aminobutyrate aminotransferase; Provisional 93.02
COG0626 396 MetC Cystathionine beta-lyases/cystathionine gamma 92.84
PRK07678 451 aminotransferase; Validated 92.55
PF01053 386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 92.53
PRK13520 371 L-tyrosine decarboxylase; Provisional 92.47
PRK07986 428 adenosylmethionine--8-amino-7-oxononanoate transam 92.42
PLN02482 474 glutamate-1-semialdehyde 2,1-aminomutase 92.33
PRK13360 442 omega amino acid--pyruvate transaminase; Provision 92.25
PLN02760 504 4-aminobutyrate:pyruvate transaminase 92.2
PF00202339 Aminotran_3: Aminotransferase class-III; InterPro: 92.1
PRK07480 456 putative aminotransferase; Validated 91.9
PRK07036 466 hypothetical protein; Provisional 91.87
PRK06062 451 hypothetical protein; Provisional 91.79
KOG0053|consensus 409 91.55
PRK06105 460 aminotransferase; Provisional 91.36
PRK06938 464 diaminobutyrate--2-oxoglutarate aminotransferase; 91.3
PRK07483 443 hypothetical protein; Provisional 91.29
PRK12389 428 glutamate-1-semialdehyde aminotransferase; Provisi 91.27
PRK12403 460 putative aminotransferase; Provisional 91.26
PRK06149 972 hypothetical protein; Provisional 91.11
TIGR01977 376 am_tr_V_EF2568 cysteine desulfurase family protein 91.1
PRK08134 433 O-acetylhomoserine aminocarboxypropyltransferase; 91.04
PRK07482 461 hypothetical protein; Provisional 90.99
COG0160 447 GabT 4-aminobutyrate aminotransferase and related 90.83
PRK05965 459 hypothetical protein; Provisional 90.8
PRK06931 459 diaminobutyrate--2-oxoglutarate aminotransferase; 90.78
PRK11706 375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 90.68
PRK06943 453 adenosylmethionine--8-amino-7-oxononanoate transam 90.51
TIGR03812 373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 90.42
PRK13580 493 serine hydroxymethyltransferase; Provisional 90.28
PRK09221 445 beta alanine--pyruvate transaminase; Provisional 90.26
PRK06917 447 hypothetical protein; Provisional 90.17
COG2873 426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 90.13
COG4992 404 ArgD Ornithine/acetylornithine aminotransferase [A 89.59
PRK06916 460 adenosylmethionine--8-amino-7-oxononanoate transam 89.16
TIGR00699 464 GABAtrns_euk 4-aminobutyrate aminotransferase, euk 89.02
PF01276 417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 88.69
cd00616 352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 88.68
PRK08742 472 adenosylmethionine--8-amino-7-oxononanoate transam 88.41
PRK07481 449 hypothetical protein; Provisional 87.96
TIGR02379 376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 87.41
PRK08114 395 cystathionine beta-lyase; Provisional 87.3
PRK07030 466 adenosylmethionine--8-amino-7-oxononanoate transam 87.23
PRK05613 437 O-acetylhomoserine aminocarboxypropyltransferase; 86.99
PRK15029 755 arginine decarboxylase; Provisional 86.78
COG4100 416 Cystathionine beta-lyase family protein involved i 86.53
PRK04366 481 glycine dehydrogenase subunit 2; Validated 86.31
PF14488166 DUF4434: Domain of unknown function (DUF4434) 86.3
PLN02651 364 cysteine desulfurase 86.03
TIGR00474 454 selA seryl-tRNA(sec) selenium transferase. In bact 85.94
COG0520 405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 84.67
PRK04311 464 selenocysteine synthase; Provisional 84.54
PLN02974 817 adenosylmethionine-8-amino-7-oxononanoate transami 84.31
TIGR03588 380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 83.37
PRK13034 416 serine hydroxymethyltransferase; Reviewed 83.2
PRK13237 460 tyrosine phenol-lyase; Provisional 83.11
PRK15407 438 lipopolysaccharide biosynthesis protein RfbH; Prov 82.05
TIGR00519 336 asnASE_I L-asparaginases, type I. Two related fami 81.66
smart00870 323 Asparaginase Asparaginase, which is found in vario 81.31
COG2008 342 GLY1 Threonine aldolase [Amino acid transport and 80.15
cd00411 323 Asparaginase Asparaginase (amidohydrolase): Aspara 80.09
>KOG1411|consensus Back     alignment and domain information 
Probab=99.97  E-value=4.5e-32  Score=212.31  Aligned_cols=72  Identities=56%  Similarity=1.007  Sum_probs=70.4

Q ss_pred             ccCCCCCCHHHHHHHHHHHHhCCCcEEEEecccccccCCChhhhHHHHHHhHHhCCcEEEEechhhhhccCCC
Q psy207           37 SVGGCDPTEDQWKQLAQLFKERPSLFVFFDSAYQGFASGDLERDAFAVRYFAQEGFEFLCSQSFAKNFGLYSR  109 (109)
Q Consensus        37 ~~~~~~lt~eqw~~i~~~~~~~p~~~~~~D~AY~gf~~g~~~~d~~~l~~~~~~~~~~~v~~SfSK~fglyg~  109 (109)
                      ||||.|+|.|||++|.++++++ +++|++|+|||||++|++++|++++|+|++.+.++++||||+|||||||.
T Consensus       209 NPTGvDPt~eqw~ki~~~~~~k-~~~pffDmAYQGfaSG~~d~DA~avR~F~~~g~~~~laQSyAKNMGLYgE  280 (427)
T KOG1411|consen  209 NPTGVDPTKEQWEKISDLIKEK-NLLPFFDMAYQGFASGDLDKDAQAVRLFVEDGHEILLAQSYAKNMGLYGE  280 (427)
T ss_pred             CCCCCCccHHHHHHHHHHhhhc-cccchhhhhhcccccCCchhhHHHHHHHHHcCCceEeehhhhhhcchhhh
Confidence            6899999999999999999999 99999999999999999999999999999999999999999999999995

>KOG1412|consensus Back     alignment and domain information
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>KOG0633|consensus Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>KOG0257|consensus Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>KOG0256|consensus Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>KOG0259|consensus Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>PRK07049 methionine gamma-lyase; Validated Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK08360 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>KOG0258|consensus Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK06777 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>TIGR00709 dat 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>KOG1412|consensus Back     alignment and domain information
>PRK09792 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08088 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>PRK06918 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PRK04612 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>PRK08593 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>PRK06541 hypothetical protein; Provisional Back     alignment and domain information
>KOG0634|consensus Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>PF12897 Aminotran_MocR: Alanine-glyoxylate amino-transferase; InterPro: IPR024551 This entry represents a family of putative aminotransferases Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK06058 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PF06838 Met_gamma_lyase: Methionine gamma-lyase ; InterPro: IPR009651 This family represents the aluminium resistance protein, which confers resistance to aluminium in bacteria [] Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>PRK07495 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PRK05769 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK08297 L-lysine aminotransferase; Provisional Back     alignment and domain information
>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK06082 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional Back     alignment and domain information
>TIGR03251 LAT_fam L-lysine 6-transaminase Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>TIGR03372 putres_am_tran putrescine aminotransferase Back     alignment and domain information
>PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>PRK05639 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>COG0626 MetC Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07678 aminotransferase; Validated Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PRK07986 adenosylmethionine--8-amino-7-oxononanoate transaminase; Validated Back     alignment and domain information
>PLN02482 glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>PRK13360 omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>PLN02760 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>PF00202 Aminotran_3: Aminotransferase class-III; InterPro: IPR005814 Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue Back     alignment and domain information
>PRK07480 putative aminotransferase; Validated Back     alignment and domain information
>PRK07036 hypothetical protein; Provisional Back     alignment and domain information
>PRK06062 hypothetical protein; Provisional Back     alignment and domain information
>KOG0053|consensus Back     alignment and domain information
>PRK06105 aminotransferase; Provisional Back     alignment and domain information
>PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK07483 hypothetical protein; Provisional Back     alignment and domain information
>PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK12403 putative aminotransferase; Provisional Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information
>COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK09221 beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK06917 hypothetical protein; Provisional Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>TIGR00699 GABAtrns_euk 4-aminobutyrate aminotransferase, eukaryotic type Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PRK08742 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>COG4100 Cystathionine beta-lyase family protein involved in aluminum resistance [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>PF14488 DUF4434: Domain of unknown function (DUF4434) Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>PLN02974 adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>TIGR00519 asnASE_I L-asparaginases, type I Back     alignment and domain information
>smart00870 Asparaginase Asparaginase, which is found in various plant, animal and bacterial cells, catalyses the deamination of asparagine to yield aspartic acid and an ammonium ion, resulting in a depletion of free circulatory asparagine in plasma PUBMED:3026924 Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>cd00411 Asparaginase Asparaginase (amidohydrolase): Asparaginases are tetrameric enzymes that catalyze the hydrolysis of asparagine to aspartic acid and ammonia Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
3ii0_A 422 Crystal Structure Of Human Glutamate Oxaloacetate T 3e-24
1aat_A 411 Oxoglutarate-Induced Conformational Changes In Cyto 8e-24
1ajs_A 412 Refinement And Comparison Of The Crystal Structures 3e-23
2cst_A 411 Crystal Structure Of The Closed Form Of Chicken Cyt 4e-23
1ajr_A 412 Refinement And Comparison Of The Crystal Structures 1e-22
7aat_A 401 X-Ray Structure Refinement And Comparison Of Three 1e-18
1aka_A 401 Structural Basis For The Catalytic Activity Of Aspa 4e-18
3meb_A 448 Structure Of Cytoplasmic Aspartate Aminotransferase 2e-17
3pd6_A 401 Crystal Structure Of Mouse Mitochondrial Aspartate 4e-17
4h51_A 420 Crystal Structure Of A Putative Aspartate Aminotran 9e-17
3hlm_A 401 Crystal Structure Of Mouse Mitochondrial Aspartate 2e-16
4eu1_A 409 Structure Of A Mitochondrial Aspartate Aminotransfe 2e-12
1yoo_A 396 Aspartate Aminotransferase Mutant Atb17 With Isoval 2e-11
1czc_A 396 Aspartate Aminotransferase Mutant Atb17139S142N WIT 2e-11
1qis_A 396 Aspartate Aminotransferase From Escherichia Coli, C 2e-11
1b4x_A 396 Aspartate Aminotransferase From E. Coli, C191s Muta 2e-11
1qir_A 396 Aspartate Aminotransferase From Escherichia Coli, C 2e-11
2d66_A 396 Aspartate Aminotransferase Mutant Mab Length = 396 2e-11
1qit_A 396 Aspartate Aminotransferase From Escherichia Coli, C 2e-11
2d61_A 396 Aspartate Aminotransferase Mutant Ma With Maleic Ac 2e-11
1ari_A 396 Aspartate Aminotransferase, W140h Mutant, Maleate C 2e-11
1aam_A 396 The Structural Basis For The Altered Substrate Spec 2e-11
1asl_A 396 Crystal Structures Of Escherichia Coli Aspartate Am 2e-11
1ahy_A 396 Aspartate Aminotransferase Hexamutant Length = 396 2e-11
1g7x_A 396 Aspartate Aminotransferase Active Site Mutant N194a 2e-11
1g7w_A 396 Aspartate Aminotransferase Active Site Mutant N194a 2e-11
1g4x_A 396 Aspartate Aminotransferase Active Site Mutant N194a 2e-11
2d64_A 396 Aspartate Aminotransferase Mutant Mabc With Isovale 2e-11
3aat_A 396 Activity And Structure Of The Active-Site Mutants R 2e-11
1yaa_A 412 Aspartate Aminotransferase From Saccharomyces Cerev 2e-11
2d5y_A 396 Aspartate Aminotransferase Mutant Mc With Isovaleri 2e-11
1ix6_A 396 Aspartate Aminotransferase Active Site Mutant V39f 2e-11
1ix8_A 396 Aspartate Aminotransferase Active Site Mutant V39fN 2e-11
3tat_A 397 Tyrosine Aminotransferase From E. Coli Length = 397 7e-11
3fsl_A 397 Crystal Structure Of Tyrosine Aminotransferase Trip 7e-11
1asf_A 396 The Structural Basis For The Reduced Activity Of Th 7e-11
1g4v_A 396 Aspartate Aminotransferase Active Site Mutant N194a 7e-11
1aia_A 396 Structural Basis For The Catalytic Activity Of Aspa 8e-11
1bqa_A 396 Aspartate Aminotransferase P195a Mutant Length = 39 9e-11
2aat_A 396 2.8-Angstroms-Resolution Crystal Structure Of An Ac 9e-11
4f5m_A 406 Wild-type E. Coli Aspartate Aminotransferase: A Tem 9e-11
2q7w_A 396 Structural Studies Reveals The Inactivation Of E. C 9e-11
1toe_A 396 Unliganded Structure Of Hexamutant + A293d Mutant O 1e-10
1bqd_A 396 Aspartate Aminotransferase P138aP195A DOUBLE MUTANT 1e-10
3uak_A 406 Crystal Structure Of De Novo Designed Cysteine Este 1e-10
1asb_A 396 The Structural Basis For The Reduced Activity Of Th 2e-10
1arh_A 396 Aspartate Aminotransferase, Y225rR386A MUTANT Lengt 2e-10
3zzj_A 396 Structure Of An Engineered Aspartate Aminotransfera 2e-10
1toj_A 396 Hydrocinnamic Acid-Bound Structure Of Srhept Mutant 5e-10
1tog_A 396 Hydrocinnamic Acid-Bound Structure Of Srhept + A293 5e-10
4f5h_A 406 Intercoversion Of Substrate Specificity: E. Coli As 9e-10
4f5f_A 406 Structure Of Aspartate Aminotransferase Conversion 9e-10
4f5j_A 406 Rational Design And Directed Evolution For Conversi 2e-09
4f5g_A 406 Rational Design And Directed Evolution Of E. Coli A 2e-09
4f5k_A 406 Substrate Specificity Conversion Of Aspartate Amino 2e-08
4f5i_A 406 Substrate Specificity Conversion Of E. Coli Pyridox 2e-08
1ay4_A 394 Aromatic Amino Acid Aminotransferase Without Substr 3e-07
3k7y_A 405 Aspartate Aminotransferase Of Plasmodium Falciparum 2e-06
>pdb|3II0|A Chain A, Crystal Structure Of Human Glutamate Oxaloacetate Transaminase 1 (Got1) Length = 422 Back     alignment and structure 
Iteration: 1

 Score =  106 bits (265), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 49/69 (71%), Positives = 58/69 (84%), Gaps = 1/69 (1%)
Query: 40  GCDPTEDQWKQLAQLFKERPSLFVFFDSAYQGFASGDLERDAFAVRYFAQEGFEFLCSQS 99
           G DPT +QWKQ+A + K R  LF FFDSAYQGFASG+LERDA+A+RYF  EGFEF C+QS
Sbjct: 186 GIDPTPEQWKQIASVMKHR-FLFPFFDSAYQGFASGNLERDAWAIRYFVSEGFEFFCAQS 244
Query: 100 FAKNFGLYS 108
           F+KNFGLY+
Sbjct: 245 FSKNFGLYN 253
>pdb|1AAT|A Chain A, Oxoglutarate-Induced Conformational Changes In Cytosolic Aspartate Aminotransferase Length = 411 Back     alignment and structure
>pdb|1AJS|A Chain A, Refinement And Comparison Of The Crystal Structures Of Pig Cytosolic Aspartate Aminotransferase And Its Complex With 2-Methylaspartate Length = 412 Back     alignment and structure
>pdb|2CST|A Chain A, Crystal Structure Of The Closed Form Of Chicken Cytosolic Aspartate Aminotransferase At 1.9 Angstroms Resolution Length = 411 Back     alignment and structure
>pdb|1AJR|A Chain A, Refinement And Comparison Of The Crystal Structures Of Pig Cytosolic Aspartate Aminotransferase And Its Complex With 2-Methylaspartate Length = 412 Back     alignment and structure
>pdb|7AAT|A Chain A, X-Ray Structure Refinement And Comparison Of Three Forms Of Mitochondrial Aspartate Aminotransferase Length = 401 Back     alignment and structure
>pdb|1AKA|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate Aminotransferase K258h Lacking Its Pyridoxal-5'-Phosphate-Binding Lysine Residue Length = 401 Back     alignment and structure
>pdb|3MEB|A Chain A, Structure Of Cytoplasmic Aspartate Aminotransferase From Giardia Lamblia Length = 448 Back     alignment and structure
>pdb|3PD6|A Chain A, Crystal Structure Of Mouse Mitochondrial Aspartate Aminotransferase, A Newly Identified Kynurenine Aminotransferase-Iv Length = 401 Back     alignment and structure
>pdb|4H51|A Chain A, Crystal Structure Of A Putative Aspartate Aminotransferase From Leishmania Major Friedlin Length = 420 Back     alignment and structure
>pdb|3HLM|A Chain A, Crystal Structure Of Mouse Mitochondrial Aspartate AminotransferaseKYNURENINE AMINOTRANSFERASE IV Length = 401 Back     alignment and structure
>pdb|4EU1|A Chain A, Structure Of A Mitochondrial Aspartate Aminotransferase From Trypanosoma Brucei Length = 409 Back     alignment and structure
>pdb|1YOO|A Chain A, Aspartate Aminotransferase Mutant Atb17 With Isovaleric Acid Length = 396 Back     alignment and structure
>pdb|1CZC|A Chain A, Aspartate Aminotransferase Mutant Atb17139S142N WITH GLUTARIC ACID Length = 396 Back     alignment and structure
>pdb|1QIS|A Chain A, Aspartate Aminotransferase From Escherichia Coli, C191f Mutation, With Bound Maleate Length = 396 Back     alignment and structure
>pdb|1B4X|A Chain A, Aspartate Aminotransferase From E. Coli, C191s Mutation, With Bound Maleate Length = 396 Back     alignment and structure
>pdb|1QIR|A Chain A, Aspartate Aminotransferase From Escherichia Coli, C191y Mutation, With Bound Maleate Length = 396 Back     alignment and structure
>pdb|2D66|A Chain A, Aspartate Aminotransferase Mutant Mab Length = 396 Back     alignment and structure
>pdb|1QIT|A Chain A, Aspartate Aminotransferase From Escherichia Coli, C191w Mutation, With Bound Maleate Length = 396 Back     alignment and structure
>pdb|2D61|A Chain A, Aspartate Aminotransferase Mutant Ma With Maleic Acid Length = 396 Back     alignment and structure
>pdb|1ARI|A Chain A, Aspartate Aminotransferase, W140h Mutant, Maleate Complex Length = 396 Back     alignment and structure
>pdb|1AAM|A Chain A, The Structural Basis For The Altered Substrate Specificity Of The R292d Active Site Mutant Of Aspartate Aminotransferase From E. Coli Length = 396 Back     alignment and structure
>pdb|1ASL|A Chain A, Crystal Structures Of Escherichia Coli Aspartate Aminotransferase In Two Conformations: Comparison Of An Unliganded Open And Two Liganded Closed Forms Length = 396 Back     alignment and structure
>pdb|1AHY|A Chain A, Aspartate Aminotransferase Hexamutant Length = 396 Back     alignment and structure
>pdb|1G7X|A Chain A, Aspartate Aminotransferase Active Site Mutant N194aR292LR386L Length = 396 Back     alignment and structure
>pdb|1G7W|A Chain A, Aspartate Aminotransferase Active Site Mutant N194aR386L Length = 396 Back     alignment and structure
>pdb|1G4X|A Chain A, Aspartate Aminotransferase Active Site Mutant N194aR292L Length = 396 Back     alignment and structure
>pdb|2D64|A Chain A, Aspartate Aminotransferase Mutant Mabc With Isovaleric Acid Length = 396 Back     alignment and structure
>pdb|3AAT|A Chain A, Activity And Structure Of The Active-Site Mutants R386y And R386f Of Escherichia Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1YAA|A Chain A, Aspartate Aminotransferase From Saccharomyces Cerevisiae Cytoplasm Length = 412 Back     alignment and structure
>pdb|2D5Y|A Chain A, Aspartate Aminotransferase Mutant Mc With Isovaleric Acid Length = 396 Back     alignment and structure
>pdb|1IX6|A Chain A, Aspartate Aminotransferase Active Site Mutant V39f Length = 396 Back     alignment and structure
>pdb|1IX8|A Chain A, Aspartate Aminotransferase Active Site Mutant V39fN194A Length = 396 Back     alignment and structure
>pdb|3TAT|A Chain A, Tyrosine Aminotransferase From E. Coli Length = 397 Back     alignment and structure
>pdb|3FSL|A Chain A, Crystal Structure Of Tyrosine Aminotransferase Tripple Mutant (P181q, R183g,A321k) From Escherichia Coli At 2.35 A Resolution Length = 397 Back     alignment and structure
>pdb|1ASF|A Chain A, The Structural Basis For The Reduced Activity Of The Y226f(Y225f) Active Site Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1G4V|A Chain A, Aspartate Aminotransferase Active Site Mutant N194a/y225f Length = 396 Back     alignment and structure
>pdb|1AIA|A Chain A, Structural Basis For The Catalytic Activity Of Aspartate Aminotransferase K258h Lacking The Pyridoxal-5'-Phosphate Binding Lysine Residue Length = 396 Back     alignment and structure
>pdb|1BQA|A Chain A, Aspartate Aminotransferase P195a Mutant Length = 396 Back     alignment and structure
>pdb|2AAT|A Chain A, 2.8-Angstroms-Resolution Crystal Structure Of An Active-Site Mutant Of Aspartate Aminotransferase From Escherichia Coli Length = 396 Back     alignment and structure
>pdb|4F5M|A Chain A, Wild-type E. Coli Aspartate Aminotransferase: A Template For The Interconversion Of Substrate Specificity And Activity To Tyrosine Aminotransferase By The Janus Algorithm. Length = 406 Back     alignment and structure
>pdb|2Q7W|A Chain A, Structural Studies Reveals The Inactivation Of E. Coli L-Aspartate Aminotransferase (S)-4,5-Amino-Dihydro-2-Thiophenecarboxylic Acid (Sadta) Via Two Mechanisms At Ph 6.0 Length = 396 Back     alignment and structure
>pdb|1TOE|A Chain A, Unliganded Structure Of Hexamutant + A293d Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1BQD|A Chain A, Aspartate Aminotransferase P138aP195A DOUBLE MUTANT Length = 396 Back     alignment and structure
>pdb|3UAK|A Chain A, Crystal Structure Of De Novo Designed Cysteine Esterase Ech14, Northeast Structural Genomics Consortium Target Or54 Length = 406 Back     alignment and structure
>pdb|1ASB|A Chain A, The Structural Basis For The Reduced Activity Of The D223a(D222a) Active Site Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1ARH|A Chain A, Aspartate Aminotransferase, Y225rR386A MUTANT Length = 396 Back     alignment and structure
>pdb|3ZZJ|A Chain A, Structure Of An Engineered Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1TOJ|A Chain A, Hydrocinnamic Acid-Bound Structure Of Srhept Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|1TOG|A Chain A, Hydrocinnamic Acid-Bound Structure Of Srhept + A293d Mutant Of E. Coli Aspartate Aminotransferase Length = 396 Back     alignment and structure
>pdb|4F5H|A Chain A, Intercoversion Of Substrate Specificity: E. Coli Aspatate Aminotransferase To Tyrosine Aminotransferase: Chimera P3. Length = 406 Back     alignment and structure
>pdb|4F5F|A Chain A, Structure Of Aspartate Aminotransferase Conversion To Tyrosine Aminotransferase: Chimera P1. Length = 406 Back     alignment and structure
>pdb|4F5J|A Chain A, Rational Design And Directed Evolution For Conversion Of Substrate Specificity From E.coli Aspartate Aminotransferase To Tyrosine Aminotransferase: Mutant P5. Length = 406 Back     alignment and structure
>pdb|4F5G|A Chain A, Rational Design And Directed Evolution Of E. Coli Apartate Aminotransferase To Tyrosine Aminotransferase: Mutant P2. Length = 406 Back     alignment and structure
>pdb|4F5K|A Chain A, Substrate Specificity Conversion Of Aspartate Aminotransferase To Tyrosine Aminotransferase By The Janus Algorithm: Chimera P6. Length = 406 Back     alignment and structure
>pdb|4F5I|A Chain A, Substrate Specificity Conversion Of E. Coli Pyridoxal-5'-phosphate Dependent Aspartate Aminotransferase To Tyrosine Aminotransferase: Chimera P4. Length = 406 Back     alignment and structure
>pdb|1AY4|A Chain A, Aromatic Amino Acid Aminotransferase Without Substrate Length = 394 Back     alignment and structure
>pdb|3K7Y|A Chain A, Aspartate Aminotransferase Of Plasmodium Falciparum Length = 405 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query109
1ajs_A 412 Aspartate aminotransferase; PIG, in the presence o 4e-40
1ajs_A 412 Aspartate aminotransferase; PIG, in the presence o 4e-11
7aat_A 401 Aspartate aminotransferase; transferase(aminotrans 7e-40
7aat_A 401 Aspartate aminotransferase; transferase(aminotrans 2e-10
3meb_A 448 Aspartate aminotransferase; pyridoxal PHOS transfe 9e-40
3meb_A 448 Aspartate aminotransferase; pyridoxal PHOS transfe 2e-10
4eu1_A 409 Mitochondrial aspartate aminotransferase; ssgcid, 2e-39
4eu1_A 409 Mitochondrial aspartate aminotransferase; ssgcid, 3e-10
3k7y_A 405 Aspartate aminotransferase; aminotrans pyridoxal p 5e-39
3k7y_A 405 Aspartate aminotransferase; aminotrans pyridoxal p 2e-10
1yaa_A 412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 1e-37
1yaa_A 412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 4e-10
2ay1_A 394 Aroat, aromatic amino acid aminotransferase; HET: 7e-37
2ay1_A 394 Aroat, aromatic amino acid aminotransferase; HET: 8e-10
4f4e_A 420 Aromatic-amino-acid aminotransferase; ssgcid, stru 7e-37
4f4e_A 420 Aromatic-amino-acid aminotransferase; ssgcid, stru 2e-10
3fsl_A 397 Aromatic-amino-acid aminotransferase; tyrosine ami 8e-37
3fsl_A 397 Aromatic-amino-acid aminotransferase; tyrosine ami 1e-09
2q7w_A 396 Aspartate aminotransferase; mechanism-based inhibi 8e-34
2q7w_A 396 Aspartate aminotransferase; mechanism-based inhibi 1e-09
3t18_A 413 Aminotransferase class I and II; PSI-biology, MCSG 5e-31
3t18_A 413 Aminotransferase class I and II; PSI-biology, MCSG 3e-06
3rq1_A 418 Aminotransferase class I and II; structural genomi 2e-29
3rq1_A 418 Aminotransferase class I and II; structural genomi 3e-06
2x5f_A 430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 1e-22
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Length = 412 Back     alignment and structure
 Score =  136 bits (344), Expect = 4e-40
 Identities = 47/69 (68%), Positives = 57/69 (82%), Gaps = 1/69 (1%)

Query: 40  GCDPTEDQWKQLAQLFKERPSLFVFFDSAYQGFASGDLERDAFAVRYFAQEGFEFLCSQS 99
           G DPT +QWKQ+A + K R  LF FFDSAYQGFASG+LE+DA+A+RYF  EGFE  C+QS
Sbjct: 197 GTDPTPEQWKQIASVMKRR-FLFPFFDSAYQGFASGNLEKDAWAIRYFVSEGFELFCAQS 255

Query: 100 FAKNFGLYS 108
           F+KNFGLY+
Sbjct: 256 FSKNFGLYN 264
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Length = 412 Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Length = 401 Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Length = 401 Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Length = 448 Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Length = 448 Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Length = 409 Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Length = 409 Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} Length = 405 Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} Length = 405 Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Length = 412 Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Length = 412 Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Length = 394 Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Length = 394 Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Length = 420 Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Length = 420 Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} PDB: 3tat_A* Length = 397 Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} PDB: 3tat_A* Length = 397 Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Length = 396 Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Length = 396 Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Length = 418 Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Length = 418 Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Length = 430 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
4h51_A 420 Aspartate aminotransferase; ssgcid, structural gen 99.81
3k7y_A 405 Aspartate aminotransferase; aminotrans pyridoxal p 99.7
3meb_A 448 Aspartate aminotransferase; pyridoxal PHOS transfe 99.63
7aat_A 401 Aspartate aminotransferase; transferase(aminotrans 99.54
4f4e_A 420 Aromatic-amino-acid aminotransferase; ssgcid, stru 99.53
4eu1_A 409 Mitochondrial aspartate aminotransferase; ssgcid, 99.51
3fsl_A 397 Aromatic-amino-acid aminotransferase; tyrosine ami 99.41
3ei9_A 432 LL-diaminopimelate aminotransferase; lysine biosyn 99.4
3qgu_A 449 LL-diaminopimelate aminotransferase; L-lysine, pyr 99.39
1yaa_A 412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 99.35
3dyd_A 427 Tyrosine aminotransferase; PLP, SGC, structural ge 99.34
2q7w_A 396 Aspartate aminotransferase; mechanism-based inhibi 99.32
2ay1_A 394 Aroat, aromatic amino acid aminotransferase; HET: 99.32
1ajs_A 412 Aspartate aminotransferase; PIG, in the presence o 99.29
3rq1_A 418 Aminotransferase class I and II; structural genomi 99.23
3tcm_A 500 Alanine aminotransferase 2; pyridoxal phosphate (P 99.21
3nra_A 407 Aspartate aminotransferase; structural genomics, j 99.18
3asa_A 400 LL-diaminopimelate aminotransferase; PLP dependent 99.17
3t18_A 413 Aminotransferase class I and II; PSI-biology, MCSG 99.15
1iay_A 428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 99.15
3e2y_A 410 Kynurenine-oxoglutarate transaminase 3; alpha beta 99.14
1b5p_A 385 Protein (aspartate aminotransferase); pyridoxal en 99.13
3h14_A 391 Aminotransferase, classes I and II; YP_167802.1, S 99.13
3piu_A 435 1-aminocyclopropane-1-carboxylate synthase; fruit 99.13
3fvs_A 422 Kynurenine--oxoglutarate transaminase 1; alpha bet 99.12
3ihj_A 498 Alanine aminotransferase 2; helix, structural geno 99.12
3ezs_A 376 Aminotransferase ASPB; NP_207418.1, structural gen 99.12
3jtx_A 396 Aminotransferase; NP_283882.1, structural genomics 99.11
3ele_A 398 Amino transferase; RER070207001803, structural gen 99.1
2zy4_A 546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 99.08
3f6t_A 533 Aspartate aminotransferase; YP_194538.1, STRU geno 99.07
3ftb_A 361 Histidinol-phosphate aminotransferase; structural 99.06
3g0t_A 437 Putative aminotransferase; NP_905498.1, putative a 99.05
3kax_A 383 Aminotransferase, classes I and II; PLP, C-S lyase 99.05
2x5f_A 430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 99.04
3b46_A 447 Aminotransferase BNA3; kynurenine aminotransferase 99.04
1fg7_A 356 Histidinol phosphate aminotransferase; HISC, histi 99.03
3dzz_A 391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 99.03
3ly1_A 354 Putative histidinol-phosphate aminotransferase; st 99.03
3op7_A 375 Aminotransferase class I and II; PLP-dependent tra 99.02
1c7n_A 399 Cystalysin; transferase, aminotransferase, pyridox 99.02
3fdb_A 377 Beta C-S lyase, putative PLP-dependent beta-cystat 99.01
1lc5_A 364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 99.01
2x5d_A 412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 99.0
1v2d_A 381 Glutamine aminotransferase; PLP, riken structural 98.99
1u08_A 386 Hypothetical aminotransferase YBDL; alpha beta pro 98.98
2r2n_A 425 Kynurenine/alpha-aminoadipate aminotransferase mit 98.98
4dq6_A 391 Putative pyridoxal phosphate-dependent transferas; 98.98
2dou_A 376 Probable N-succinyldiaminopimelate aminotransfera; 98.97
2o0r_A 411 RV0858C (N-succinyldiaminopimelate aminotransfera; 98.97
1xi9_A 406 Putative transaminase; alanine aminotransferase, s 98.94
1gd9_A 389 Aspartate aminotransferase; pyridoxal enzyme, temp 98.94
1yiz_A 429 Kynurenine aminotransferase; glutamine transaminas 98.93
1o4s_A 389 Aspartate aminotransferase; TM1255, structural gen 98.92
3b1d_A 392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 98.44
3ppl_A 427 Aspartate aminotransferase; dimer, PLP-dependent t 98.91
3get_A 365 Histidinol-phosphate aminotransferase; NP_281508.1 98.91
3ez1_A 423 Aminotransferase MOCR family; YP_604413.1, struct 98.91
1vp4_A 425 Aminotransferase, putative; structural genomics, j 98.9
3hdo_A 360 Histidinol-phosphate aminotransferase; PSI-II, his 98.89
1bw0_A 416 TAT, protein (tyrosine aminotransferase); tyrosine 98.88
2gb3_A 409 Aspartate aminotransferase; TM1698, structural gen 98.88
1j32_A 388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 98.87
3l8a_A 421 METC, putative aminotransferase, probable beta-cys 98.86
3g7q_A 417 Valine-pyruvate aminotransferase; NP_462565.1, str 98.85
2o1b_A 404 Aminotransferase, class I; aminotrasferase; HET: P 98.84
3ffh_A 363 Histidinol-phosphate aminotransferase; APC88260, l 98.84
3fkd_A 350 L-threonine-O-3-phosphate decarboxylase; structura 98.83
2zc0_A 407 Alanine glyoxylate transaminase; alanine:glyoxylat 98.82
2zyj_A 397 Alpha-aminodipate aminotransferase; alpha-aminoadi 98.82
3aow_A 448 Putative uncharacterized protein PH0207; protein-P 98.81
3euc_A 367 Histidinol-phosphate aminotransferase 2; YP_297314 98.79
3d6k_A 422 Putative aminotransferase; APC82464, corynebacteri 98.76
3p1t_A 337 Putative histidinol-phosphate aminotransferase; PL 98.75
1d2f_A 390 MALY protein; aminotransferase fold, large PLP-bin 98.72
1uu1_A 335 Histidinol-phosphate aminotransferase; histidine b 98.59
3if2_A 444 Aminotransferase; YP_265399.1, structura genomics, 98.58
2z61_A 370 Probable aspartate aminotransferase 2; amino acid 98.57
3cq5_A 369 Histidinol-phosphate aminotransferase; PLP, PMP, a 98.52
2ord_A 397 Acoat, acetylornithine aminotransferase; TM1785, a 98.47
3a2b_A 398 Serine palmitoyltransferase; vitamin B6-dependent 98.42
3tqx_A 399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 98.42
1bs0_A 384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 98.4
4adb_A 406 Succinylornithine transaminase; transferase, PLP e 98.4
3lws_A 357 Aromatic amino acid beta-eliminating lyase/threoni 98.39
1e5e_A 404 MGL, methionine gamma-lyase; methionine biosynthes 98.35
1fc4_A 401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 98.31
2w8t_A 427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 98.3
3kki_A 409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 98.26
2eh6_A 375 Acoat, acetylornithine aminotransferase; ARGD, str 98.25
1sff_A 426 4-aminobutyrate aminotransferase; enzyme complexes 98.23
1kmj_A 406 Selenocysteine lyase; persulfide perselenide NIFS 98.21
2bwn_A 401 5-aminolevulinate synthase; tetrapyrrole biosynthe 98.19
1vef_A 395 Acetylornithine/acetyl-lysine aminotransferase; PL 98.19
3pj0_A 359 LMO0305 protein; structural genomics, joint center 98.18
2eo5_A 419 419AA long hypothetical aminotransferase; PLP enzy 98.16
1zod_A 433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 98.12
2rfv_A 398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 98.1
1pff_A 331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 98.1
2pb2_A 420 Acetylornithine/succinyldiaminopimelate aminotran; 98.09
2dr1_A 386 PH1308 protein, 386AA long hypothetical serine ami 98.08
2epj_A 434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 98.08
1eg5_A 384 Aminotransferase; PLP-dependent enzymes, iron-sulf 98.06
3dxv_A 439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 98.06
3acz_A 389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 98.05
1jg8_A 347 L-ALLO-threonine aldolase; glycine biosynthesis, p 98.05
1t3i_A 420 Probable cysteine desulfurase; PLP-binding enzyme, 98.04
4h51_A 420 Aspartate aminotransferase; ssgcid, structural gen 98.03
1cs1_A 386 CGS, protein (cystathionine gamma-synthase); lyase 98.03
1svv_A 359 Threonine aldolase; structural genomics, structura 98.03
3cog_A 403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 98.02
3l44_A 434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 98.0
3bwn_A 391 AT1G70560, L-tryptophan aminotransferase; auxin sy 97.99
3ruy_A 392 Ornithine aminotransferase; structural genomics, c 97.99
3ht4_A 431 Aluminum resistance protein; lyase, putative cysta 97.99
1m32_A 366 2-aminoethylphosphonate-pyruvate aminotransferase; 97.98
3fq8_A 427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 97.96
3f0h_A 376 Aminotransferase; RER070207000802, structural geno 97.96
3n5m_A 452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 97.96
3i4j_A 430 Aminotransferase, class III; structural GENOMICS,N 97.95
3ffr_A 362 Phosphoserine aminotransferase SERC; structural ge 97.93
3lvm_A 423 Cysteine desulfurase; structural genomics, montrea 97.92
3nx3_A 395 Acoat, acetylornithine aminotransferase; csgid, st 97.92
2e7u_A 424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 97.9
2cy8_A 453 D-phgat, D-phenylglycine aminotransferase; structu 97.9
1gc0_A 398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 97.88
2cjg_A 449 L-lysine-epsilon aminotransferase; internal aldimi 97.87
4eb5_A 382 Probable cysteine desulfurase 2; scaffold, transfe 97.86
3k28_A 429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 97.85
2cb1_A 412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 97.85
1s0a_A 429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 97.84
3a8u_X 449 Omega-amino acid--pyruvate aminotransferase; large 97.84
3gju_A 460 Putative aminotransferase; pyridoxal phosphate, PL 97.82
3tfu_A 457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 97.81
2po3_A 424 4-dehydrase; external aldimine, PLP, aminotransfer 97.8
2ez2_A 456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 97.8
4e77_A 429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 97.79
3vax_A 400 Putative uncharacterized protein DNDA; desulfurase 97.79
3i16_A 427 Aluminum resistance protein; YP_878183.1, carbon-s 97.78
1n8p_A 393 Cystathionine gamma-lyase; three open alpha/beta s 97.78
3ndn_A 414 O-succinylhomoserine sulfhydrylase; seattle struct 97.78
3qhx_A 392 Cystathionine gamma-synthase METB (CGS); structura 97.78
3oks_A 451 4-aminobutyrate transaminase; ssgcid, transferase, 97.77
2e7j_A 371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 97.76
4a6r_A 459 Omega transaminase; transferase, PLP-binding enzym 97.76
1elu_A 390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 97.75
1z7d_A 433 Ornithine aminotransferase; structural genomics co 97.75
3i5t_A 476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 97.71
2huf_A 393 Alanine glyoxylate aminotransferase; alpha and bet 97.71
2z9v_A 392 Aspartate aminotransferase; pyridoxamine, pyruvate 97.69
3hmu_A 472 Aminotransferase, class III; structural genomics, 97.68
3hvy_A 427 Cystathionine beta-lyase family protein, YNBB B.S 97.68
4ffc_A 453 4-aminobutyrate aminotransferase (GABT); structura 97.67
2ctz_A 421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 97.67
2oat_A 439 Ornithine aminotransferase; 5-fluoromethylornithin 97.64
3jzl_A 409 Putative cystathionine beta-lyase involved in ALU 97.63
1ibj_A 464 CBL, cystathionine beta-lyase; PLP-dependent enzym 97.61
3dod_A 448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 97.6
1ax4_A 467 Tryptophanase; tryptophan biosynthesis, tryptophan 97.58
2yrr_A 353 Aminotransferase, class V; structural genomics, NP 97.58
2c81_A 418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 97.58
1ohv_A 472 4-aminobutyrate aminotransferase; PLP-dependent en 97.57
1vjo_A 393 Alanine--glyoxylate aminotransferase; 17130350, AL 97.56
1v72_A 356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 97.56
3zrp_A 384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 97.55
2oqx_A 467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 97.55
3cai_A 406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 97.53
3nmy_A 400 Xometc, cystathionine gamma-lyase-like protein; Cy 97.53
2aeu_A 374 Hypothetical protein MJ0158; selenocysteine syntha 97.53
3kgw_A 393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 97.52
4hvk_A 382 Probable cysteine desulfurase 2; transferase and I 97.52
2fq6_A 415 Cystathionine beta-lyase; protein-inhibitor comple 97.46
2oga_A 399 Transaminase; PLP-dependent enzyme, desosamine, de 97.41
3gbx_A 420 Serine hydroxymethyltransferase; structural genomi 97.41
3f9t_A 397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 97.4
1iug_A 352 Putative aspartate aminotransferase; wild type, py 97.39
3a9z_A 432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 97.39
1qgn_A 445 Protein (cystathionine gamma-synthase); methionine 97.39
2x3l_A 446 ORN/Lys/Arg decarboxylase family protein; lyase; H 97.38
2vi8_A 405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 97.35
1wyu_B 474 Glycine dehydrogenase subunit 2 (P-protein); alpha 97.34
3ecd_A 425 Serine hydroxymethyltransferase 2; ssgcid, decode, 97.19
1mdo_A 393 ARNB aminotransferase; type 1 aminotransferase fol 97.18
2ch1_A 396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 97.18
3isl_A 416 Purine catabolism protein PUCG; pyridoxalphosphate 97.18
3ri6_A 430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 97.17
2fyf_A 398 PSAT, phosphoserine aminotransferase; PLP-dependen 97.12
3nnk_A 411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 97.09
1o69_A 394 Aminotransferase; structural genomics, unknown fun 97.08
3nyt_A 367 Aminotransferase WBPE; PLP binding, nucleotide-sug 97.07
2bkw_A 385 Alanine-glyoxylate aminotransferase 1; analine-gly 97.05
1qz9_A 416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 97.03
3uwc_A 374 Nucleotide-sugar aminotransferase; lipopolysacchar 96.97
1w23_A 360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 96.96
2fnu_A 375 Aminotransferase; protein-product complex, structu 96.95
2z67_A 456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 96.94
2c0r_A 362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 96.93
2dkj_A 407 Serine hydroxymethyltransferase; PLP dependent enz 96.9
1b9h_A 388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 96.85
3dr4_A 391 Putative perosamine synthetase; deoxysugar, pyrido 96.82
3mad_A 514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 96.81
3n0l_A 417 Serine hydroxymethyltransferase; alpha beta class, 96.69
1rv3_A 483 Serine hydroxymethyltransferase, cytosolic; one-ca 96.66
3ke3_A 379 Putative serine-pyruvate aminotransferase; structu 96.63
3h7f_A 447 Serine hydroxymethyltransferase 1; cytoplasm, one- 96.62
2yky_A 465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 95.59
3bb8_A 437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 96.35
2vyc_A 755 Biodegradative arginine decarboxylase; pyridoxal p 96.34
3frk_A 373 QDTB; aminotransferase, sugar-modification, natura 96.17
3k7y_A 405 Aspartate aminotransferase; aminotrans pyridoxal p 96.06
2hox_A 427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 95.98
1c4k_A 730 Protein (ornithine decarboxylase); lyase; HET: PLP 95.92
3meb_A 448 Aspartate aminotransferase; pyridoxal PHOS transfe 95.89
2qma_A 497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 95.88
2jis_A 515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 95.75
2okj_A 504 Glutamate decarboxylase 1; PLP-dependent decarboxy 95.57
3e9k_A 465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 95.48
1js3_A 486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 95.38
4a0g_A 831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 95.36
1wyu_A 438 Glycine dehydrogenase (decarboxylating) subunit 1; 95.21
2a7v_A 490 Serine hydroxymethyltransferase; structural genomi 94.73
3b8x_A 390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 93.94
2dgk_A 452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 93.62
3mc6_A 497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 93.24
7aat_A 401 Aspartate aminotransferase; transferase(aminotrans 92.74
3n75_A 715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 91.51
4eu1_A 409 Mitochondrial aspartate aminotransferase; ssgcid, 90.95
4f4e_A 420 Aromatic-amino-acid aminotransferase; ssgcid, stru 90.95
3vp6_A 511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 90.48
3bc8_A 450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 88.69
3ju7_A 377 Putative PLP-dependent aminotransferase; NP_978343 88.26
3dyd_A 427 Tyrosine aminotransferase; PLP, SGC, structural ge 87.52
3fsl_A 397 Aromatic-amino-acid aminotransferase; tyrosine ami 87.11
4e3q_A 473 Pyruvate transaminase; aminotransferase, transfera 85.46
4ao9_A 454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 84.78
4e1o_A 481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 84.63
3hbx_A 502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 84.58
4atq_A 456 4-aminobutyrate transaminase; transferase; HET: PL 83.91
3k40_A 475 Aromatic-L-amino-acid decarboxylase; PLP dependent 82.36
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
Probab=99.81  E-value=3.3e-20  Score=146.98  Aligned_cols=86  Identities=49%  Similarity=0.837  Sum_probs=75.5

Q ss_pred             hhhcCCCCCCeeee-----ccCCCCCCHHHHHHHHHHHHhCCCcEEEEecccccccCCChhhhHHHHHHhHHhCCcEEEE
Q psy207           23 KAYLDDPHPKKVNL-----SVGGCDPTEDQWKQLAQLFKERPSLFVFFDSAYQGFASGDLERDAFAVRYFAQEGFEFLCS   97 (109)
Q Consensus        23 ~~~~~d~~~~kv~L-----~~~~~~lt~eqw~~i~~~~~~~p~~~~~~D~AY~gf~~g~~~~d~~~l~~~~~~~~~~~v~   97 (109)
                      +.....+...++.|     ||||.++|+|||++|+++++++ ++++++|++|+||.+|+.+.+++.++.+.+.+.+++++
T Consensus       182 ~~l~~~~~~~~vll~~~p~NPtG~~~~~~~~~~i~~~~~~~-~~~~~~D~~Y~~~~~~~~~~~~~~~~~~~~~~~~~i~~  260 (420)
T 4h51_A          182 KDILAAPDGSVFILHQCAHNPTGVDPSQEQWNEIASLMLAK-HHQVFFDSAYQGYASGSLDTDAYAARLFARRGIEVLLA  260 (420)
T ss_dssp             HHHHHSCSSCEEEEESSSCTTTCCCCCHHHHHHHHHHHHHH-TCEEEEEESCTTTTTSCHHHHTHHHHHHHHTTCCCEEE
T ss_pred             HHHhccCCCcEEEEeCCCCCCCCCCCCHHHHHHHHHHHHhc-CceEeeehhhhhhccCCcccchHHHHhHHhhCceEEEE
Confidence            33333344445555     9999999999999999999999 99999999999999998888989999988899999999


Q ss_pred             echhhhhccCCC
Q psy207           98 QSFAKNFGLYSR  109 (109)
Q Consensus        98 ~SfSK~fglyg~  109 (109)
                      +||||+|||||.
T Consensus       261 ~s~SK~~~~~G~  272 (420)
T 4h51_A          261 QSFSKNMGLYSE  272 (420)
T ss_dssp             EECTTTSCCGGG
T ss_pred             eccccccccccC
Confidence            999999999984
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 109
d1ajsa_ 412 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig 2e-10
d7aata_ 401 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chi 6e-10
d2q7wa1 396 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT 5e-09
d2q7wa1 396 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT 5e-05
d1yaaa_ 412 c.67.1.1 (A:) Aspartate aminotransferase, AAT {Bak 9e-09
d2ay1a_ 394 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 2e-08
d3tata_ 397 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 2e-08
d3tata_ 397 c.67.1.1 (A:) Aromatic aminoacid aminotransferase, 0.002
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Length = 412 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: AAT-like
domain: Aspartate aminotransferase, AAT
species: Pig (Sus scrofa), cytosolic form [TaxId: 9823]

 Score = 53.8 bits (128), Expect = 2e-10
 Identities = 16/38 (42%), Positives = 23/38 (60%)

Query: 2  STESSFSSVQQGPPIEVFAVNKAYLDDPHPKKVNLSVG 39
          +  S F+ V Q  P+ VF +   + +DP P+KVNL VG
Sbjct: 1  APPSVFAEVPQAQPVLVFKLIADFREDPDPRKVNLGVG 38
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Length = 401 Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Length = 396 Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Length = 396 Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Length = 412 Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Length = 394 Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Length = 397 Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Length = 397 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query109
d1yaaa_ 412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 99.6
d3tata_ 397 Aromatic aminoacid aminotransferase, AroAT {Escher 99.57
d7aata_ 401 Aspartate aminotransferase, AAT {Chicken (Gallus g 99.56
d2ay1a_ 394 Aromatic aminoacid aminotransferase, AroAT {Paraco 99.53
d2q7wa1 396 Aspartate aminotransferase, AAT {Escherichia coli 99.52
d1ajsa_ 412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 99.52
d1gdea_ 388 Aromatic aminoacid aminotransferase, AroAT {Archae 99.35
d1w7la_ 418 Kynurenine--oxoglutarate transaminase I {Human (Ho 99.31
d1c7na_ 394 Cystalysin {Treponema denticola [TaxId: 158]} 99.3
d1xi9a_ 395 Putative alanine aminotransferase {Pyrococcus furi 99.27
d1b5pa_ 382 Aspartate aminotransferase, AAT {Thermus thermophi 99.27
d1lc5a_ 355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 99.26
d1o4sa_ 375 Aspartate aminotransferase, AAT {Thermotoga mariti 99.26
d1j32a_ 388 Aspartate aminotransferase, AAT {Phormidium lapide 99.25
d1iaya_ 428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.21
d1bw0a_ 412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 99.18
d2r5ea1 418 Kynurenine--oxoglutarate transaminase I {Yellowfev 99.17
d1m7ya_ 431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 99.16
d1d2fa_ 361 Modulator in mal gene expression, MalY {Escherichi 99.12
d2gb3a1 389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 99.05
d1wsta1 403 Multiple substrate aminotransferase, MSAT {Thermoc 99.04
d1fg7a_ 354 Histidinol-phosphate aminotransferase HisC {Escher 99.04
d1v2da_ 368 Glutamine aminotransferase {Thermus thermophilus [ 98.91
d1vp4a_ 420 Putative aminotransferase TM1131 {Thermotoga marit 98.72
d2f8ja1 334 Histidinol-phosphate aminotransferase HisC {Thermo 98.61
d1u08a_ 382 Putative methionine aminotransferase YdbL {Escheri 98.56
d7aata_ 401 Aspartate aminotransferase, AAT {Chicken (Gallus g 98.08
d1yaaa_ 412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 97.94
d2hoxa1 425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 97.87
d1ajsa_ 412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 97.73
d2e7ja1 364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 97.69
d2aeua1 366 Hypothetical protein MJ0158 {Archaeon Methanococcu 97.66
d2q7wa1 396 Aspartate aminotransferase, AAT {Escherichia coli 97.48
d3tata_ 397 Aromatic aminoacid aminotransferase, AroAT {Escher 97.36
d2ay1a_ 394 Aromatic aminoacid aminotransferase, AroAT {Paraco 97.31
d1p3wa_ 391 Cysteine desulfurase IscS {Escherichia coli [TaxId 96.69
d1bs0a_ 383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 96.53
d1fc4a_ 401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 95.71
d2bwna1 396 5-aminolevulinate synthase {Rhodobacter capsulatus 94.96
d3bc8a1 445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 94.95
d2z67a1 434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 93.92
d1ax4a_ 465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 93.6
d2v1pa1 467 Tryptophan indol-lyase (tryptophanase) {Escherichi 93.5
d1sffa_ 425 4-aminobutyrate aminotransferase, GABA-aminotransf 93.49
d1m6sa_ 343 Low-specificity threonine aldolase {Thermotoga mar 93.25
d2byla1 404 Ornithine aminotransferase {Human (Homo sapiens) [ 93.13
d1y4ia1 397 Methionine gamma-lyase, MGL {Citrobacter freundii 92.97
d2gsaa_ 427 Glutamate-1-semialdehyde aminomutase (aminotransfe 92.8
d1qgna_ 398 Cystathionine gamma-synthase, CGS {Common tobacco 92.55
d1cs1a_ 384 Cystathionine gamma-synthase, CGS {Escherichia col 92.17
d1elua_ 381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 92.07
d1v72a1 345 Phenylserine aldolase PSALD {Pseudomonas putida [T 91.98
d1ibja_ 380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 91.97
d1gc0a_ 392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 91.72
d1z7da1 404 Ornithine aminotransferase {Plasmodium yoelii yoel 91.57
d1c4ka2 462 Ornithine decarboxylase major domain {Lactobacillu 91.24
d1ohwa_ 461 4-aminobutyrate aminotransferase, GABA-aminotransf 90.63
d1c7ga_ 456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 90.53
d2ctza1 421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 89.95
d1s0aa_ 429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 86.89
d1n8pa_ 393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 86.7
d1zoda1 431 Dialkylglycine decarboxylase {Pseudomonas cepacia 85.13
d1vefa1 387 Acetylornithine/acetyl-lysine aminotransferase Arg 84.94
d1eg5a_ 376 NifS-like protein/selenocysteine lyase {Thermotoga 83.43
d1e5ea_ 394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 83.15
d1cl1a_ 391 Cystathionine beta-lyase, CBL {Escherichia coli [T 81.45
d1t3ia_ 408 Probable cysteine desulfurase SufS {Synechocystis 81.12
d1jf9a_ 405 NifS-like protein/selenocysteine lyase {Escherichi 80.86
d1pffa_ 331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 80.52
d1qz9a_ 404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 80.36
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: AAT-like
domain: Aspartate aminotransferase, AAT
species: Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]

Probab=99.60  E-value=1e-15  Score=117.44  Aligned_cols=72  Identities=43%  Similarity=0.748  Sum_probs=61.5

Q ss_pred             ccCCCCCCHHHHHHHHHHHHhCCCcEEEEecccccccCCChhhhHHHHHHhH---HhCCcEEEEechhhhhccCCC
Q psy207           37 SVGGCDPTEDQWKQLAQLFKERPSLFVFFDSAYQGFASGDLERDAFAVRYFA---QEGFEFLCSQSFAKNFGLYSR  109 (109)
Q Consensus        37 ~~~~~~lt~eqw~~i~~~~~~~p~~~~~~D~AY~gf~~g~~~~d~~~l~~~~---~~~~~~~v~~SfSK~fglyg~  109 (109)
                      ||||..+|+|+|++|+++++++ ++++|.|++|++|.+++...+......+.   ....++++++||||+|||+|+
T Consensus       187 NPTG~~~s~~~~~~i~~~a~~~-~~~ii~De~Y~~l~~~~~~~~~~~~~~~~~~~~~~~~~i~~~s~SK~~~~~G~  261 (412)
T d1yaaa_         187 NPTGLDPTSEQWVQIVDAIASK-NHIALFDTAYQGFATGDLDKDAYAVRLGVEKLSTVSPVFVCQSFAKNAGMYGE  261 (412)
T ss_dssp             TTTCCCCCHHHHHHHHHHHHHT-TCEEEEEESCTTTSSSCHHHHTHHHHHHHHHTTTTCCEEEEEECTTTSCCGGG
T ss_pred             CCccccCCHHHHHHHHhhhccC-CEEEeecceeeecccCCcccchhhhhhhhhccccCCCeEEEEecCCccccCcC
Confidence            9999999999999999999999 99999999999999987554443333322   356789999999999999994
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure