Psyllid ID: psy2178

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------
MATAQYFSIISWPFNNPENPAYVPVIWTANTDSMTFWQRVTNTVQAMAYYWLHMRTLDKEQAILNQNLDEKYRKRSLREIYFDSAKDSFMFSFDSRITGYARPMQRKLVEVGPLHLVDPKPLDESLQKWMDGAPEGVIYFSLGTNMKGTSMGDFRRKAFLKAFARLPQYRVLWKWENDVMEGLGENIRLQKWMPQQDILAHPKVKLFIMQGGLQSLQEAFHYGVKLICIPMFADQDLNCQRVGKIKTGIVLEYEDLNEEIIFNALKLVLEDPQVFKSGWMSLQKWMDGAPEGVIYFSLGTNMKGTSMGDFRRKAFLKAFARLPQYRVLWKWENDVMEGLGENIRLQKWMPQQDILGT
cccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccccccHHHHccccEEEEEEccccccccccccccEEEEccccccccccccHHHHHHHHccccEEEEEEcccccccccccHHHHHHHHHHHHcccccEEEEEEcccccccccccEEEEccccccccccccccEEEEEccccHHHHHHHHHcccEEcccccccHHHHHHHHHHccEEEEEEcccccHHHHHHHHHHHHccHHHHHHHHHHHcccccccccEEEEEEEEcccccccccHHHHHHHHHHHHcccccEEEEEEcccccccccccEEEEccccccccccc
cccccccccccHccccccccccccHHHccccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccccccccHHcHHHHHccccEEEEEccccccccccccccEEEEEcEEccccccccHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHHHHcccccEEEEEEcccccccccccEEEEEcccHcHHccccccEEEEEccccccHHHHHHccccEEEEEcccccHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccccccccEEEEcccccccccHHHHHHHHHHHcccccccccccccccccccccccEEEHcccccccHccc
MATAQYFSiiswpfnnpenpayvpviWTANTDSMTFWQRVTNTVQAMAYYWLHMRTLDKEQAILNQNLDEKYRKRSLReiyfdsakdsfmfsfdsritgyarpmqrklvevgplhlvdpkpldESLQKWMdgapegviyfslgtnmkgtsmgdFRRKAFLKAFARLPQYRVLWKWENDVMEGLGEnirlqkwmpqqdilahpKVKLFIMQGGLQSLQEAFHYGVKLicipmfadqdlncqrvgkiKTGIVLEYEDLNEEIIFNALKLvledpqvfkSGWMSLQKWmdgapegviyfslgtnmkgtsmgdFRRKAFLKAFARLPQYRVLWKWENDVMEGLGEnirlqkwmpqqdilgt
MATAQYFSIISWPFNNPENPAYVPVIWTANTDSMTFWQRVTNTVQAMAYYWLHMRTLDKEQAILNQNLDEKYRKRSLREIyfdsakdsfmFSFDSRITGYARPMQRKLVEVGPLHLVDPKPLDESLQKWMDGAPEGVIYFSLGTNMKGTSMGDFRRKAFLKAFARLPQYRVLWKWENDVMEGLGENIRLQKWMPQQDILAHPKVKLFIMQGGLQSLQEAFHYGVKLICIPMFADQDLNCQRVGKIKTGIVLEYEDLNEEIIFNALKLVLEDPQVFKSGWMSLQKWMDGAPEGVIYFSLGTNMKGTSMGDFRRKAFLKAFARLPQYRVLWKWENDVMEGLgenirlqkwmpqqdilgt
MATAQYFSIISWPFNNPENPAYVPVIWTANTDSMTFWQRVTNTVQAMAYYWLHMRTLDKEQAILNQNLDEKYRKRSLREIYFDSAKDSFMFSFDSRITGYARPMQRKLVEVGPLHLVDPKPLDESLQKWMDGAPEGVIYFSLGTNMKGTSMGDFRRKAFLKAFARLPQYRVLWKWENDVMEGLGENIRLQKWMPQQDILAHPKVKLFIMQGGLQSLQEAFHYGVKLICIPMFADQDLNCQRVGKIKTGIVLEYEDLNEEIIFNALKLVLEDPQVFKSGWMSLQKWMDGAPEGVIYFSLGTNMKGTSMGDFRRKAFLKAFARLPQYRVLWKWENDVMEGLGENIRLQKWMPQQDILGT
****QYFSIISWPFNNPENPAYVPVIWTANTDSMTFWQRVTNTVQAMAYYWLHMRTLDKEQAILNQNLDEKYRKRSLREIYFDSAKDSFMFSFDSRITGYARPMQRKLVEVGPLHLVDPKPLDESLQKWMDGAPEGVIYFSLGTNMKGTSMGDFRRKAFLKAFARLPQYRVLWKWENDVMEGLGENIRLQKWMPQQDILAHPKVKLFIMQGGLQSLQEAFHYGVKLICIPMFADQDLNCQRVGKIKTGIVLEYEDLNEEIIFNALKLVLEDPQVFKSGWMSLQKWMDGAPEGVIYFSLGTNMKGTSMGDFRRKAFLKAFARLPQYRVLWKWENDVMEGLGENIRLQKWM********
**TAQYFSIISWPFNNPENPAYVPVIWTANTDSMTFWQRVTNTVQAMAYYWLHMRTLDKEQAILNQNLDEKYRKRSLREIYFDSAKDSFMFSFDSRITGYARPMQRKLVEVGPLHLVDPKPLDESLQKWMDGAPEGVIYFSLGTNMKGTSMGDFRRKAFLKAFARLPQYRVLWKWENDVMEGLGENIRLQKWMPQQDILAHPKVKLFIMQGGLQSLQEAFHYGVKLICIPMFADQDLNCQRVGKIKTGIVLEYEDLNEEIIFNALKLVLEDPQVFKS********MDGAPEGVIYFSLGTNMKGTSMGDFRRKAFLKAFARLPQYRVLWKWENDVMEGLGENIRLQKWMPQQDILG*
MATAQYFSIISWPFNNPENPAYVPVIWTANTDSMTFWQRVTNTVQAMAYYWLHMRTLDKEQAILNQNLDEKYRKRSLREIYFDSAKDSFMFSFDSRITGYARPMQRKLVEVGPLHLVDPKPLDESLQKWMDGAPEGVIYFSLGTNMKGTSMGDFRRKAFLKAFARLPQYRVLWKWENDVMEGLGENIRLQKWMPQQDILAHPKVKLFIMQGGLQSLQEAFHYGVKLICIPMFADQDLNCQRVGKIKTGIVLEYEDLNEEIIFNALKLVLEDPQVFKSGWMSLQKWMDGAPEGVIYFSLGTNMKGTSMGDFRRKAFLKAFARLPQYRVLWKWENDVMEGLGENIRLQKWMPQQDILGT
**TAQYFSIISWPFNNPENPAYVPVIWTANTDSMTFWQRVTNTVQAMAYYWLHMRTLDKEQAILNQNLDEKYRKRSLREIYFDSAKDSFMFSFDSRITGYARPMQRKLVEVGPLHLVDPKPLDESLQKWMDGAPEGVIYFSLGTNMKGTSMGDFRRKAFLKAFARLPQYRVLWKWENDVMEGLGENIRLQKWMPQQDILAHPKVKLFIMQGGLQSLQEAFHYGVKLICIPMFADQDLNCQRVGKIKTGIVLEYEDLNEEIIFNALKLVLEDPQVFKSGWMSLQKWMDGAPEGVIYFSLGTNMKGTSMGDFRRKAFLKAFARLPQYRVLWKWENDVMEGLGENIRLQKWMPQQD****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATAQYFSIISWPFNNPENPAYVPVIWTANTDSMTFWQRVTNTVQAMAYYWLHMRTLDKEQAILNQNLDEKYRKRSLREIYFDSAKDSFMFSFDSRITGYARPMQRKLVEVGPLHLVDPKPLDESLQKWMDGAPEGVIYFSLGTNMKGTSMGDFRRKAFLKAFARLPQYRVLWKWENDVMEGLGENIRLQKWMPQQDILAHPKVKLFIMQGGLQSLQEAFHYGVKLICIPMFADQDLNCQRVGKIKTGIVLEYEDLNEEIIFNALKLVLEDPQVFKSGWMSLQKWMDGAPEGVIYFSLGTNMKGTSMGDFRRKAFLKAFARLPQYRVLWKWENDVMEGLGENIRLQKWMPQQDILGT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query357 2.2.26 [Sep-21-2011]
P06133528 UDP-glucuronosyltransfera yes N/A 0.731 0.494 0.307 1e-31
P16662529 UDP-glucuronosyltransfera no N/A 0.719 0.485 0.306 5e-31
O02663529 UDP-glucuronosyltransfera N/A N/A 0.719 0.485 0.310 9e-31
O97951529 UDP-glucuronosyltransfera N/A N/A 0.719 0.485 0.310 1e-30
O77649530 UDP-glucuronosyltransfera N/A N/A 0.728 0.490 0.302 1e-30
P36537528 UDP-glucuronosyltransfera no N/A 0.728 0.492 0.295 2e-30
O75310529 UDP-glucuronosyltransfera no N/A 0.719 0.485 0.296 3e-30
Q9GLD9529 UDP-glucuronosyltransfera no N/A 0.703 0.474 0.309 5e-30
P36513530 UDP-glucuronosyltransfera no N/A 0.728 0.490 0.306 6e-30
Q9TSL6529 UDP-glucuronosyltransfera N/A N/A 0.703 0.474 0.309 7e-30
>sp|P06133|UD2B4_HUMAN UDP-glucuronosyltransferase 2B4 OS=Homo sapiens GN=UGT2B4 PE=1 SV=2 Back     alignment and function desciption
 Score =  137 bits (345), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 84/273 (30%), Positives = 143/273 (52%), Gaps = 12/273 (4%)

Query: 20  PAYVPVIWTANTDSMTFWQRVTNTVQAMAY-YWLHMRTLDKEQAILNQNLDEKYRKRSLR 78
           P+YVPV+ +  +D MTF +RV N +  + + +W  +  + K     ++ L    R  +L 
Sbjct: 191 PSYVPVVMSELSDQMTFIERVKNMIYVLYFEFWFQIFDMKKWDQFYSEVLG---RPTTLS 247

Query: 79  EIYFDSAKDSFMFSFDSRITGYARPMQRKLVEVGPLHLVDPKPLDESLQKWMDGAPE-GV 137
           E     AK       +     +  P+   +  VG LH    KPL + +++++  + E GV
Sbjct: 248 ETM---AKADIWLIRNYWDFQFPHPLLPNVEFVGGLHCKPAKPLPKEMEEFVQSSGENGV 304

Query: 138 IYFSLGTNMKGTSMGDFRRKAFLKAFARLPQYRVLWKWENDVMEGLGENIRLQKWMPQQD 197
           + FSLG+ +  TS  + R      A A++PQ +VLW+++ +  + LG N RL KW+PQ D
Sbjct: 305 VVFSLGSMVSNTS--EERANVIASALAKIPQ-KVLWRFDGNKPDTLGLNTRLYKWIPQND 361

Query: 198 ILAHPKVKLFIMQGGLQSLQEAFHYGVKLICIPMFADQDLNCQRVGKIKTGIVLEYEDLN 257
           +L HPK + FI  GG   + EA ++G+ ++ +P+FADQ  N   +      + L++  ++
Sbjct: 362 LLGHPKTRAFITHGGANGIYEAIYHGIPMVGVPLFADQPDNIAHMKAKGAAVSLDFHTMS 421

Query: 258 EEIIFNALKLVLEDPQVFKSGWMSLQKWMDGAP 290
              + NALK V+ DP ++K   M L +     P
Sbjct: 422 STDLLNALKTVINDP-LYKENAMKLSRIHHDQP 453
UDPGTs are of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds. This isozyme is active on polyhydroxylated estrogens (such as estriol, 4-hydroxyestrone and 2-hydroxyestriol) and xenobiotics (such as 4-methylumbelliferone, 1-naphthol, 4-nitrophenol, 2-aminophenol, 4-hydroxybiphenyl and menthol). It is capable of 6 alpha-hydroxyglucuronidation of hyodeoxycholic acid.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 7
>sp|P16662|UD2B7_HUMAN UDP-glucuronosyltransferase 2B7 OS=Homo sapiens GN=UGT2B7 PE=1 SV=1 Back     alignment and function description
>sp|O02663|UD2B9_MACFA UDP-glucuronosyltransferase 2B9 OS=Macaca fascicularis GN=UGT2B9 PE=2 SV=1 Back     alignment and function description
>sp|O97951|UDB18_MACFA UDP-glucuronosyltransferase 2B18 OS=Macaca fascicularis GN=UGT2B18 PE=1 SV=1 Back     alignment and function description
>sp|O77649|UDB20_MACFA UDP-glucuronosyltransferase 2B20 OS=Macaca fascicularis GN=UGT2B20 PE=1 SV=1 Back     alignment and function description
>sp|P36537|UDB10_HUMAN UDP-glucuronosyltransferase 2B10 OS=Homo sapiens GN=UGT2B10 PE=1 SV=1 Back     alignment and function description
>sp|O75310|UDB11_HUMAN UDP-glucuronosyltransferase 2B11 OS=Homo sapiens GN=UGT2B11 PE=2 SV=1 Back     alignment and function description
>sp|Q9GLD9|UDB33_MACMU UDP-glucuronosyltransferase 2B33 OS=Macaca mulatta GN=UGT2B33 PE=1 SV=1 Back     alignment and function description
>sp|P36513|UDB14_RABIT UDP-glucuronosyltransferase 2B14 OS=Oryctolagus cuniculus GN=UGT2B14 PE=2 SV=1 Back     alignment and function description
>sp|Q9TSL6|UDB23_MACFA UDP-glucuronosyltransferase 2B23 OS=Macaca fascicularis GN=UGT2B23 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query357
443419062 517 glucosyl glucuronosyl transferases [Locu 0.722 0.499 0.402 5e-52
270006529 504 hypothetical protein TcasGA2_TC030780 [T 0.725 0.513 0.385 1e-48
242013333 522 UDP-glucuronosyltransferase 1-8 precurso 0.691 0.473 0.385 2e-43
189236219 515 PREDICTED: similar to glucosyl/glucurono 0.717 0.497 0.369 4e-43
157134143 526 glucosyl/glucuronosyl transferases [Aede 0.731 0.496 0.356 2e-42
270013462 983 hypothetical protein TcasGA2_TC012061 [T 0.700 0.254 0.369 3e-42
91090214 519 PREDICTED: similar to glucosyl/glucurono 0.700 0.481 0.369 4e-42
91089901 501 PREDICTED: similar to AGAP007029-PA [Tri 0.784 0.558 0.361 5e-42
312373542 533 hypothetical protein AND_17306 [Anophele 0.719 0.482 0.345 8e-42
270013658 979 hypothetical protein TcasGA2_TC012285 [T 0.784 0.286 0.361 8e-42
>gi|443419062|gb|AGC84403.1| glucosyl glucuronosyl transferases [Locusta migratoria] Back     alignment and taxonomy information
 Score =  211 bits (536), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 107/266 (40%), Positives = 168/266 (63%), Gaps = 8/266 (3%)

Query: 8   SIISWPFNNPENPAYVPVIWTANTDSMTFWQRVTNTVQAMAYYWLHMRTL-DKEQAILNQ 66
           S + + F +P NPAY+P +W   +D M FWQR+ NT     Y++L +  +   E   + +
Sbjct: 164 SSVYYNFGSPMNPAYMPDMWLGYSDRMNFWQRLYNT-----YFYLRLMYMWYYEVLPMQE 218

Query: 67  NLDEKYRKRSLREIYFDSAKDSFMFSFDSRITGYARPMQRKLVEVGPLHL-VDPKPLDES 125
            L  K+    +   Y      S + + +  +  Y RP    ++E+  +H+  +PKPL + 
Sbjct: 219 ELMRKHFGPDVPSAYEADRNVSLLITANHFVLEYPRPHLPNIIEITGIHVATEPKPLPKD 278

Query: 126 LQKWMDGAPEGVIYFSLGTNMKGTSMGDFRRKAFLKAFARLPQYRVLWKWENDVMEGLGE 185
           ++K++D A EGVIYFSLG+N++  +M  ++R+AF++AF +LPQ RVLWKWE+D +    +
Sbjct: 279 IKKFLDEAEEGVIYFSLGSNVRSNAMPAWKRQAFIEAFRQLPQ-RVLWKWESDSLPDQPD 337

Query: 186 NIRLQKWMPQQDILAHPKVKLFIMQGGLQSLQEAFHYGVKLICIPMFADQDLNCQRVGKI 245
           N+ ++KW+PQQD+LAHPKV+LFIMQGGLQSL EA ++GV L+ IP F+DQ  N  ++ + 
Sbjct: 338 NVMVRKWLPQQDVLAHPKVRLFIMQGGLQSLNEAAYHGVPLLVIPFFSDQAHNAAKIQQS 397

Query: 246 KTGIVLEYEDLNEEIIFNALKLVLED 271
             G+ LEY DL  + +   L+ +L D
Sbjct: 398 GIGVWLEYSDLTRDALLRDLRTLLHD 423

Source: Locusta migratoria

Species: Locusta migratoria

Genus: Locusta

Family: Acrididae

Order: Orthoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270006529|gb|EFA02977.1| hypothetical protein TcasGA2_TC030780 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242013333|ref|XP_002427365.1| UDP-glucuronosyltransferase 1-8 precursor, putative [Pediculus humanus corporis] gi|212511724|gb|EEB14627.1| UDP-glucuronosyltransferase 1-8 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|189236219|ref|XP_971626.2| PREDICTED: similar to glucosyl/glucuronosyl transferases [Tribolium castaneum] Back     alignment and taxonomy information
>gi|157134143|ref|XP_001663167.1| glucosyl/glucuronosyl transferases [Aedes aegypti] gi|108881419|gb|EAT45644.1| AAEL003099-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|270013462|gb|EFA09910.1| hypothetical protein TcasGA2_TC012061 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91090214|ref|XP_967924.1| PREDICTED: similar to glucosyl/glucuronosyl transferases [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91089901|ref|XP_972392.1| PREDICTED: similar to AGAP007029-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|312373542|gb|EFR21258.1| hypothetical protein AND_17306 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|270013658|gb|EFA10106.1| hypothetical protein TcasGA2_TC012285 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query357
FB|FBgn0040256517 Ugt86Dd "Ugt86Dd" [Drosophila 0.742 0.512 0.352 5.9e-41
FB|FBgn0038886537 CG6475 [Drosophila melanogaste 0.798 0.530 0.325 1.6e-40
FB|FBgn0040253487 Ugt86Dg "Ugt86Dg" [Drosophila 0.694 0.509 0.366 5.5e-38
FB|FBgn0026314516 Ugt35b "UDP-glycosyltransferas 0.742 0.513 0.334 5.5e-38
FB|FBgn0027073532 CG4302 [Drosophila melanogaste 0.725 0.486 0.327 5.7e-36
FB|FBgn0026315537 Ugt35a "UDP-glycosyltransferas 0.686 0.456 0.346 9.2e-36
FB|FBgn0032684530 CG10178 [Drosophila melanogast 0.719 0.484 0.338 1.2e-35
FB|FBgn0040257521 Ugt86Dc "Ugt86Dc" [Drosophila 0.697 0.477 0.319 1.5e-35
FB|FBgn0040255527 Ugt86De "Ugt86De" [Drosophila 0.624 0.423 0.379 2.4e-35
FB|FBgn0027070517 CG17322 [Drosophila melanogast 0.717 0.495 0.320 3.6e-34
FB|FBgn0040256 Ugt86Dd "Ugt86Dd" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 435 (158.2 bits), Expect = 5.9e-41, P = 5.9e-41
 Identities = 98/278 (35%), Positives = 159/278 (57%)

Query:    21 AYVPVIWTANTDSMTFWQRVTNTVQAMAYYWLHMRTLDKEQAILNQNLDEKY---RKRSL 77
             +Y P++ +  TD MTF +R+ N  + +    +H   +        +N+ +KY    K++L
Sbjct:   174 SYNPLVTSPRTDRMTFLERLENHYEVIVED-IHRHFVHLPHM---RNVYKKYFPNAKKTL 229

Query:    78 REIYFDSAKDSFMFSFDSRITGYARPMQRKLVEVGPLHLVD-PKPLDESLQKWMDGAPEG 136
              E+  DS   S +         Y RP    ++EVG +H+   PKPL E ++++++G+P G
Sbjct:   230 EEV-MDSF--SLILLGQHFSLSYPRPYLPNMIEVGGMHISHKPKPLPEDIKQFIEGSPHG 286

Query:   137 VIYFSLGTNMKGTSMGDFRRKAFLKAFARLPQYRVLWKWENDVMEGLGENIRLQKWMPQQ 196
             VIYFS+G+N+K   +    R   LK FA+L Q RVLWK+E+D M G   N+ ++KW PQ 
Sbjct:   287 VIYFSMGSNVKSKDLPQETRDTLLKTFAKLKQ-RVLWKFEDDDMPGKPANVLIKKWYPQP 345

Query:   197 DILAHPKVKLFIMQGGLQSLQEAFHYGVKLICIPMFADQDLNCQRVGKIKTGIVLEYEDL 256
             DILAHP VKLFI  GGL S  E+ ++G  ++ +P F DQ +N QR  ++  G+ L+  +L
Sbjct:   346 DILAHPNVKLFISHGGLLSSTESVYFGKPILGLPCFYDQHMNVQRAQRVGFGLGLDLNNL 405

Query:   257 NEEIIFNALKLVLEDPQVFKSGWMSLQKWMDGAPEGVI 294
              +E +  A++ +L DP   K+     +++ D  P+  +
Sbjct:   406 KQEDLEKAIQTLLTDPSYAKASLAISERYRD-QPQSAV 442
GO:0015020 "glucuronosyltransferase activity" evidence=ISS
GO:0008152 "metabolic process" evidence=IEA
FB|FBgn0038886 CG6475 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0040253 Ugt86Dg "Ugt86Dg" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0026314 Ugt35b "UDP-glycosyltransferase 35b" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0027073 CG4302 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0026315 Ugt35a "UDP-glycosyltransferase 35a" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0032684 CG10178 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0040257 Ugt86Dc "Ugt86Dc" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0040255 Ugt86De "Ugt86De" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0027070 CG17322 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.4.10.691

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query357
PHA03392507 PHA03392, egt, ecdysteroid UDP-glucosyltransferase 2e-36
pfam00201500 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosy 4e-33
COG1819406 COG1819, COG1819, Glycosyl transferases, related t 5e-16
TIGR01426392 TIGR01426, MGT, glycosyltransferase, MGT family 1e-14
cd03784401 cd03784, GT1_Gtf_like, This family includes the Gt 3e-13
PLN02207468 PLN02207, PLN02207, UDP-glycosyltransferase 3e-11
PHA03392 507 PHA03392, egt, ecdysteroid UDP-glucosyltransferase 7e-10
PLN02562448 PLN02562, PLN02562, UDP-glycosyltransferase 4e-09
pfam00201 500 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosy 1e-07
PLN00164480 PLN00164, PLN00164, glucosyltransferase; Provision 4e-07
PLN02173449 PLN02173, PLN02173, UDP-glucosyl transferase famil 4e-07
PLN02410451 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl 4e-07
PLN02167475 PLN02167, PLN02167, UDP-glycosyltransferase family 5e-07
PLN02534491 PLN02534, PLN02534, UDP-glycosyltransferase 1e-06
PLN02555480 PLN02555, PLN02555, limonoid glucosyltransferase 5e-06
PLN00414446 PLN00414, PLN00414, glycosyltransferase family pro 1e-05
PLN02448459 PLN02448, PLN02448, UDP-glycosyltransferase family 2e-05
PLN02992481 PLN02992, PLN02992, coniferyl-alcohol glucosyltran 3e-05
PLN03004451 PLN03004, PLN03004, UDP-glycosyltransferase 5e-05
PLN02764453 PLN02764, PLN02764, glycosyltransferase family pro 5e-05
PLN02554481 PLN02554, PLN02554, UDP-glycosyltransferase family 8e-05
PLN02863477 PLN02863, PLN02863, UDP-glucoronosyl/UDP-glucosyl 3e-04
PLN02152455 PLN02152, PLN02152, indole-3-acetate beta-glucosyl 7e-04
PLN02210456 PLN02210, PLN02210, UDP-glucosyl transferase 0.001
PLN03015470 PLN03015, PLN03015, UDP-glucosyl transferase 0.002
PLN03007482 PLN03007, PLN03007, UDP-glucosyltransferase family 0.002
PLN02208442 PLN02208, PLN02208, glycosyltransferase family pro 0.002
PLN02670472 PLN02670, PLN02670, transferase, transferring glyc 0.004
>gnl|CDD|223071 PHA03392, egt, ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information 
 Score =  137 bits (347), Expect = 2e-36
 Identities = 56/164 (34%), Positives = 93/164 (56%), Gaps = 4/164 (2%)

Query: 112 GPLHLVD--PKPLDESLQKWMDGAPEGVIYFSLGTNMKGTSMGDFRRKAFLKAFARLPQY 169
           G LHL    P+PLD+ L+++++ +  GV+Y S G+++    M +   +  L+ F +LP Y
Sbjct: 271 GGLHLHKKPPQPLDDYLEEFLNNSTNGVVYVSFGSSIDTNDMDNEFLQMLLRTFKKLP-Y 329

Query: 170 RVLWKWENDVMEG-LGENIRLQKWMPQQDILAHPKVKLFIMQGGLQSLQEAFHYGVKLIC 228
            VLWK++ +V    L  N+  QKW PQ+ +L H  VK F+ QGG+QS  EA    V ++ 
Sbjct: 330 NVLWKYDGEVEAINLPANVLTQKWFPQRAVLKHKNVKAFVTQGGVQSTDEAIDALVPMVG 389

Query: 229 IPMFADQDLNCQRVGKIKTGIVLEYEDLNEEIIFNALKLVLEDP 272
           +PM  DQ  N  +  ++  G  L+   ++   +  A+  V+E+P
Sbjct: 390 LPMMGDQFYNTNKYVELGIGRALDTVTVSAAQLVLAIVDVIENP 433

Length = 507
>gnl|CDD|201077 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|224732 COG1819, COG1819, Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|233407 TIGR01426, MGT, glycosyltransferase, MGT family Back     alignment and domain information
>gnl|CDD|99960 cd03784, GT1_Gtf_like, This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>gnl|CDD|177857 PLN02207, PLN02207, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|223071 PHA03392, egt, ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|215305 PLN02562, PLN02562, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|201077 pfam00201, UDPGT, UDP-glucoronosyl and UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|215084 PLN00164, PLN00164, glucosyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|177830 PLN02173, PLN02173, UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|178032 PLN02410, PLN02410, UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|215112 PLN02167, PLN02167, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|215293 PLN02534, PLN02534, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|178170 PLN02555, PLN02555, limonoid glucosyltransferase Back     alignment and domain information
>gnl|CDD|177807 PLN00414, PLN00414, glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|215247 PLN02448, PLN02448, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|178572 PLN02992, PLN02992, coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>gnl|CDD|178581 PLN03004, PLN03004, UDP-glycosyltransferase Back     alignment and domain information
>gnl|CDD|178364 PLN02764, PLN02764, glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|215304 PLN02554, PLN02554, UDP-glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|215465 PLN02863, PLN02863, UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>gnl|CDD|177813 PLN02152, PLN02152, indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>gnl|CDD|215127 PLN02210, PLN02210, UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|178589 PLN03015, PLN03015, UDP-glucosyl transferase Back     alignment and domain information
>gnl|CDD|178584 PLN03007, PLN03007, UDP-glucosyltransferase family protein Back     alignment and domain information
>gnl|CDD|177858 PLN02208, PLN02208, glycosyltransferase family protein Back     alignment and domain information
>gnl|CDD|178275 PLN02670, PLN02670, transferase, transferring glycosyl groups Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 357
PHA03392507 egt ecdysteroid UDP-glucosyltransferase; Provision 100.0
PF00201500 UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera 100.0
PLN02207468 UDP-glycosyltransferase 100.0
KOG1192|consensus496 100.0
PLN02562448 UDP-glycosyltransferase 100.0
PLN02208442 glycosyltransferase family protein 100.0
PLN02554481 UDP-glycosyltransferase family protein 100.0
PLN02410451 UDP-glucoronosyl/UDP-glucosyl transferase family p 100.0
PLN03004451 UDP-glycosyltransferase 100.0
PLN02992481 coniferyl-alcohol glucosyltransferase 100.0
PLN02670472 transferase, transferring glycosyl groups 100.0
PLN02167475 UDP-glycosyltransferase family protein 100.0
PLN02555480 limonoid glucosyltransferase 100.0
PLN03015470 UDP-glucosyl transferase 100.0
PLN02210456 UDP-glucosyl transferase 100.0
PLN02152455 indole-3-acetate beta-glucosyltransferase 100.0
PLN03007482 UDP-glucosyltransferase family protein 100.0
PLN00164480 glucosyltransferase; Provisional 100.0
PLN02863477 UDP-glucoronosyl/UDP-glucosyl transferase family p 100.0
PLN02764453 glycosyltransferase family protein 100.0
PLN02173449 UDP-glucosyl transferase family protein 100.0
PLN02448459 UDP-glycosyltransferase family protein 100.0
PLN02534491 UDP-glycosyltransferase 100.0
PLN00414446 glycosyltransferase family protein 100.0
COG1819406 Glycosyl transferases, related to UDP-glucuronosyl 99.95
TIGR01426392 MGT glycosyltransferase, MGT family. This model de 99.95
cd03784401 GT1_Gtf_like This family includes the Gtfs, a grou 99.94
PRK12446352 undecaprenyldiphospho-muramoylpentapeptide beta-N- 99.6
PF13528318 Glyco_trans_1_3: Glycosyl transferase family 1 99.56
TIGR00661321 MJ1255 conserved hypothetical protein. This model 99.54
PF04101167 Glyco_tran_28_C: Glycosyltransferase family 28 C-t 99.54
COG0707357 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosami 99.47
PRK00726357 murG undecaprenyldiphospho-muramoylpentapeptide be 99.3
cd03785350 GT1_MurG MurG is an N-acetylglucosaminyltransferas 99.19
PF00201 500 UDPGT: UDP-glucoronosyl and UDP-glucosyl transfera 99.14
COG4671400 Predicted glycosyl transferase [General function p 99.03
PHA03392 507 egt ecdysteroid UDP-glucosyltransferase; Provision 99.02
PRK13609380 diacylglycerol glucosyltransferase; Provisional 98.99
PRK13608391 diacylglycerol glucosyltransferase; Provisional 98.96
TIGR01133348 murG undecaprenyldiphospho-muramoylpentapeptide be 98.83
PLN02605382 monogalactosyldiacylglycerol synthase 98.71
TIGR03590279 PseG pseudaminic acid biosynthesis-associated prot 98.71
KOG1192|consensus 496 98.62
KOG3349|consensus170 98.56
PLN03004 451 UDP-glycosyltransferase 98.4
TIGR00215385 lpxB lipid-A-disaccharide synthase. Lipid-A precur 98.37
TIGR03492396 conserved hypothetical protein. This protein famil 98.32
PLN02207 468 UDP-glycosyltransferase 98.28
PLN02152 455 indole-3-acetate beta-glucosyltransferase 98.25
PLN02670 472 transferase, transferring glycosyl groups 98.21
PLN02562 448 UDP-glycosyltransferase 98.19
PLN02992 481 coniferyl-alcohol glucosyltransferase 98.19
PRK00025380 lpxB lipid-A-disaccharide synthase; Reviewed 98.11
cd03814364 GT1_like_2 This family is most closely related to 98.09
PLN02554 481 UDP-glycosyltransferase family protein 98.05
PLN02410 451 UDP-glucoronosyl/UDP-glucosyl transferase family p 98.01
PLN02208 442 glycosyltransferase family protein 97.98
PLN03015 470 UDP-glucosyl transferase 97.97
PLN02555 480 limonoid glucosyltransferase 97.92
cd03795357 GT1_like_4 This family is most closely related to 97.89
COG5017161 Uncharacterized conserved protein [Function unknow 97.82
PLN03007 482 UDP-glucosyltransferase family protein 97.8
COG3980318 spsG Spore coat polysaccharide biosynthesis protei 97.75
PLN02534 491 UDP-glycosyltransferase 97.73
PF00534172 Glycos_transf_1: Glycosyl transferases group 1; In 97.65
cd03817374 GT1_UGDG_like This family is most closely related 97.62
cd03823359 GT1_ExpE7_like This family is most closely related 97.62
cd03801374 GT1_YqgM_like This family is most closely related 97.61
cd03820348 GT1_amsD_like This family is most closely related 97.6
PLN00164 480 glucosyltransferase; Provisional 97.58
cd03786363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th 97.57
PLN02173 449 UDP-glucosyl transferase family protein 97.56
PLN02167 475 UDP-glycosyltransferase family protein 97.56
cd03798377 GT1_wlbH_like This family is most closely related 97.55
PLN02448 459 UDP-glycosyltransferase family protein 97.52
cd04946407 GT1_AmsK_like This family is most closely related 97.51
cd03800398 GT1_Sucrose_synthase This family is most closely r 97.47
PLN02871465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 97.46
PRK15484380 lipopolysaccharide 1,2-N-acetylglucosaminetransfer 97.44
cd03822366 GT1_ecORF704_like This family is most closely rela 97.43
PRK05749425 3-deoxy-D-manno-octulosonic-acid transferase; Revi 97.41
cd05844367 GT1_like_7 Glycosyltransferases catalyze the trans 97.41
cd03794394 GT1_wbuB_like This family is most closely related 97.41
TIGR00236365 wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras 97.34
cd04962371 GT1_like_5 This family is most closely related to 97.31
PF13844468 Glyco_transf_41: Glycosyl transferase family 41; P 97.29
cd03804351 GT1_wbaZ_like This family is most closely related 97.26
PLN02863 477 UDP-glucoronosyl/UDP-glucosyl transferase family p 97.26
cd03821375 GT1_Bme6_like This family is most closely related 97.2
cd03808359 GT1_cap1E_like This family is most closely related 97.2
PLN02210 456 UDP-glucosyl transferase 97.17
PF02350346 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; 97.1
cd03811353 GT1_WabH_like This family is most closely related 97.08
cd03799355 GT1_amsK_like This is a family of GT1 glycosyltran 97.07
PRK15427406 colanic acid biosynthesis glycosyltransferase WcaL 97.04
cd04949372 GT1_gtfA_like This family is most closely related 97.01
TIGR03449405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino 96.94
cd03809365 GT1_mtfB_like This family is most closely related 96.94
PRK14089347 ipid-A-disaccharide synthase; Provisional 96.9
cd04951360 GT1_WbdM_like This family is most closely related 96.88
cd03807365 GT1_WbnK_like This family is most closely related 96.87
cd03812358 GT1_CapH_like This family is most closely related 96.8
cd03816415 GT1_ALG1_like This family is most closely related 96.66
cd03805392 GT1_ALG2_like This family is most closely related 96.66
COG1519419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase 96.65
TIGR03088374 stp2 sugar transferase, PEP-CTERM/EpsH1 system ass 96.54
cd03825365 GT1_wcfI_like This family is most closely related 96.5
PRK09922359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D 96.42
PRK10307412 putative glycosyl transferase; Provisional 96.39
TIGR02149388 glgA_Coryne glycogen synthase, Corynebacterium fam 96.31
cd03813475 GT1_like_3 This family is most closely related to 96.25
cd03818396 GT1_ExpC_like This family is most closely related 96.25
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 96.21
PF13692135 Glyco_trans_1_4: Glycosyl transferases group 1; PD 96.11
cd03819355 GT1_WavL_like This family is most closely related 95.99
TIGR02918500 accessory Sec system glycosylation protein GtfA. M 95.96
PLN02764 453 glycosyltransferase family protein 95.96
cd03792372 GT1_Trehalose_phosphorylase Trehalose phosphorylas 95.94
COG3914620 Spy Predicted O-linked N-acetylglucosamine transfe 95.94
cd04950373 GT1_like_1 Glycosyltransferases catalyze the trans 95.88
PF02684373 LpxB: Lipid-A-disaccharide synthetase; InterPro: I 95.72
TIGR03087397 stp1 sugar transferase, PEP-CTERM/EpsH1 system ass 95.54
TIGR03568365 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, 95.53
TIGR02472439 sucr_P_syn_N sucrose-phosphate synthase, putative, 95.51
PLN02275371 transferase, transferring glycosyl groups 95.49
PRK09814333 beta-1,6-galactofuranosyltransferase; Provisional 95.42
cd04955363 GT1_like_6 This family is most closely related to 95.39
cd03796398 GT1_PIG-A_like This family is most closely related 95.2
PRK01021608 lpxB lipid-A-disaccharide synthase; Reviewed 94.83
PF04007335 DUF354: Protein of unknown function (DUF354); Inte 94.72
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 94.24
KOG4626|consensus966 94.2
PHA01633335 putative glycosyl transferase group 1 94.04
PLN00414 446 glycosyltransferase family protein 93.96
cd03784401 GT1_Gtf_like This family includes the Gtfs, a grou 93.59
TIGR01426 392 MGT glycosyltransferase, MGT family. This model de 93.37
PF0672297 DUF1205: Protein of unknown function (DUF1205); In 93.05
PHA01630331 putative group 1 glycosyl transferase 93.02
COG1819 406 Glycosyl transferases, related to UDP-glucuronosyl 92.97
cd03806419 GT1_ALG11_like This family is most closely related 92.86
cd03802335 GT1_AviGT4_like This family is most closely relate 92.71
PRK15490578 Vi polysaccharide biosynthesis protein TviE; Provi 92.27
PF06258311 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterP 91.97
cd03791476 GT1_Glycogen_synthase_DULL1_like This family is mo 91.44
TIGR02095473 glgA glycogen/starch synthases, ADP-glucose type. 91.35
PRK14098489 glycogen synthase; Provisional 91.29
TIGR03713519 acc_sec_asp1 accessory Sec system protein Asp1. Th 90.83
cd01635229 Glycosyltransferase_GTB_type Glycosyltransferases 90.61
PRK10125405 putative glycosyl transferase; Provisional 90.56
PLN02501794 digalactosyldiacylglycerol synthase 90.5
COG0381383 WecB UDP-N-acetylglucosamine 2-epimerase [Cell env 89.94
PRK10017426 colanic acid biosynthesis protein; Provisional 89.55
PLN02846462 digalactosyldiacylglycerol synthase 89.48
COG3660329 Predicted nucleoside-diphosphate-sugar epimerase [ 87.68
PF1352492 Glyco_trans_1_2: Glycosyl transferases group 1 87.07
TIGR02193319 heptsyl_trn_I lipopolysaccharide heptosyltransfera 86.3
PLN00142815 sucrose synthase 86.02
PLN02949463 transferase, transferring glycosyl groups 84.87
PRK00654466 glgA glycogen synthase; Provisional 84.86
TIGR02470784 sucr_synth sucrose synthase. This model represents 83.87
TIGR02919438 accessory Sec system glycosyltransferase GtfB. Mem 82.36
TIGR00661321 MJ1255 conserved hypothetical protein. This model 81.57
PF05159269 Capsule_synth: Capsule polysaccharide biosynthesis 81.21
>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.6e-55  Score=431.00  Aligned_cols=282  Identities=25%  Similarity=0.464  Sum_probs=256.9

Q ss_pred             CCCCCcccccccccc-cCCCCccccccccCCCCCCCHHHHHHHHH-HHHHHHHHHHHhhHHHHHHHHHhcCCcCCCCCHH
Q psy2178           1 MATAQYFSIISWPFN-NPENPAYVPVIWTANTDSMTFWQRVTNTV-QAMAYYWLHMRTLDKEQAILNQNLDEKYRKRSLR   78 (357)
Q Consensus         1 ~~~~~~~~~~~~~~g-~p~~~~~~P~~~~~~~~~~~~~~R~~n~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   78 (357)
                      +++++.++...+.+| +|.||+|+|..++++++.|+|++|+.|.+ +.........+. +.++++++++++.  ..+++.
T Consensus       164 ~ss~~~~~~~~~~~gg~p~~~syvP~~~~~~~~~Msf~~R~~N~~~~~~~~~~~~~~~-~~~~~l~~~~f~~--~~~~~~  240 (507)
T PHA03392        164 ISSGYGLAENFETMGAVSRHPVYYPNLWRSKFGNLNVWETINEIYTELRLYNEFSLLA-DEQNKLLKQQFGP--DTPTIR  240 (507)
T ss_pred             EcCCCCchhHHHhhccCCCCCeeeCCcccCCCCCCCHHHHHHHHHHHHHHHHHHHHhh-HHHHHHHHHHcCC--CCCCHH
Confidence            356777888888889 99999999999999999999999999998 555444444444 8899999999875  568899


Q ss_pred             HHhcCCCCeeEEEEcCCCccccCCCCCCCeEEeCccccCC--CCCCchHHHHHhccCCCceEEEecCCccccCCCcHHHH
Q psy2178          79 EIYFDSAKDSFMFSFDSRITGYARPMQRKLVEVGPLHLVD--PKPLDESLQKWMDGAPEGVIYFSLGTNMKGTSMGDFRR  156 (357)
Q Consensus        79 ~l~~~~~~~~~~l~~s~~~l~~~~~~~p~v~~vG~l~~~~--~~~l~~~~~~~l~~~~~~vv~vs~GS~~~~~~~~~~~~  156 (357)
                      ++.+   +++++|+|+++.++++||++|++++|||+++++  .+++|+++.+|++++++|+|||||||.....+++.+.+
T Consensus       241 ~l~~---~~~l~lvns~~~~d~~rp~~p~v~~vGgi~~~~~~~~~l~~~l~~fl~~~~~g~V~vS~GS~~~~~~~~~~~~  317 (507)
T PHA03392        241 ELRN---RVQLLFVNVHPVFDNNRPVPPSVQYLGGLHLHKKPPQPLDDYLEEFLNNSTNGVVYVSFGSSIDTNDMDNEFL  317 (507)
T ss_pred             HHHh---CCcEEEEecCccccCCCCCCCCeeeecccccCCCCCCCCCHHHHHHHhcCCCcEEEEECCCCCcCCCCCHHHH
Confidence            9999   899999999999999999999999999999853  46889999999999877899999999986556889999


Q ss_pred             HHHHHHHHhCCCceEEEEEcCCccC-CCCCcEEEeecCChhhhhcCccceEEEeeCchhhHHHHHhcCceEEeecCCCCh
Q psy2178         157 KAFLKAFARLPQYRVLWKWENDVME-GLGENIRLQKWMPQQDILAHPKVKLFIMQGGLQSLQEAFHYGVKLICIPMFADQ  235 (357)
Q Consensus       157 ~~i~~al~~~~~~~viw~~~~~~~~-~~~~nv~~~~~~pq~~lL~h~~~~~~ithgG~~s~~eal~~GvP~i~~P~~~dQ  235 (357)
                      +.+++++++++. +|||+++++..+ ..|+|+++.+|+||.++|+||++++||||||.||+.||+++|||+|++|+++||
T Consensus       318 ~~~l~a~~~l~~-~viw~~~~~~~~~~~p~Nv~i~~w~Pq~~lL~hp~v~~fItHGG~~s~~Eal~~GvP~v~iP~~~DQ  396 (507)
T PHA03392        318 QMLLRTFKKLPY-NVLWKYDGEVEAINLPANVLTQKWFPQRAVLKHKNVKAFVTQGGVQSTDEAIDALVPMVGLPMMGDQ  396 (507)
T ss_pred             HHHHHHHHhCCC-eEEEEECCCcCcccCCCceEEecCCCHHHHhcCCCCCEEEecCCcccHHHHHHcCCCEEECCCCccH
Confidence            999999999998 999999875554 678999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhceeeeeeccCCCHHHHHHHHHHHhcCcchhhccccchhhhccCC
Q psy2178         236 DLNCQRVGKIKTGIVLEYEDLNEEIIFNALKLVLEDPQVFKSGWMSLQKWMDGA  289 (357)
Q Consensus       236 ~~na~~v~~~G~g~~l~~~~~~~~~l~~~i~~~l~~~~~~~~a~~l~~~~~~~~  289 (357)
                      +.||++++++|+|+.++..+++.++|.++|+++++|++|+++|+++++.++++.
T Consensus       397 ~~Na~rv~~~G~G~~l~~~~~t~~~l~~ai~~vl~~~~y~~~a~~ls~~~~~~p  450 (507)
T PHA03392        397 FYNTNKYVELGIGRALDTVTVSAAQLVLAIVDVIENPKYRKNLKELRHLIRHQP  450 (507)
T ss_pred             HHHHHHHHHcCcEEEeccCCcCHHHHHHHHHHHhCCHHHHHHHHHHHHHHHhCC
Confidence            999999999999999998899999999999999999999999999999999875

>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule Back     alignment and domain information
>PLN02207 UDP-glycosyltransferase Back     alignment and domain information
>KOG1192|consensus Back     alignment and domain information
>PLN02562 UDP-glycosyltransferase Back     alignment and domain information
>PLN02208 glycosyltransferase family protein Back     alignment and domain information
>PLN02554 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN03004 UDP-glycosyltransferase Back     alignment and domain information
>PLN02992 coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>PLN02670 transferase, transferring glycosyl groups Back     alignment and domain information
>PLN02167 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02555 limonoid glucosyltransferase Back     alignment and domain information
>PLN03015 UDP-glucosyl transferase Back     alignment and domain information
>PLN02210 UDP-glucosyl transferase Back     alignment and domain information
>PLN02152 indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>PLN03007 UDP-glucosyltransferase family protein Back     alignment and domain information
>PLN00164 glucosyltransferase; Provisional Back     alignment and domain information
>PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02764 glycosyltransferase family protein Back     alignment and domain information
>PLN02173 UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02448 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02534 UDP-glycosyltransferase Back     alignment and domain information
>PLN00414 glycosyltransferase family protein Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>PRK12446 undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase; Reviewed Back     alignment and domain information
>PF13528 Glyco_trans_1_3: Glycosyl transferase family 1 Back     alignment and domain information
>TIGR00661 MJ1255 conserved hypothetical protein Back     alignment and domain information
>PF04101 Glyco_tran_28_C: Glycosyltransferase family 28 C-terminal domain; InterPro: IPR007235 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>COG0707 MurG UDP-N-acetylglucosamine:LPS N-acetylglucosamine transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>PF00201 UDPGT: UDP-glucoronosyl and UDP-glucosyl transferase; InterPro: IPR002213 UDP glycosyltransferases (UGT) are a superfamily of enzymes that catalyzes the addition of the glycosyl group from a UTP-sugar to a small hydrophobic molecule Back     alignment and domain information
>COG4671 Predicted glycosyl transferase [General function prediction only] Back     alignment and domain information
>PHA03392 egt ecdysteroid UDP-glucosyltransferase; Provisional Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>PLN02605 monogalactosyldiacylglycerol synthase Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>KOG1192|consensus Back     alignment and domain information
>KOG3349|consensus Back     alignment and domain information
>PLN03004 UDP-glycosyltransferase Back     alignment and domain information
>TIGR00215 lpxB lipid-A-disaccharide synthase Back     alignment and domain information
>TIGR03492 conserved hypothetical protein Back     alignment and domain information
>PLN02207 UDP-glycosyltransferase Back     alignment and domain information
>PLN02152 indole-3-acetate beta-glucosyltransferase Back     alignment and domain information
>PLN02670 transferase, transferring glycosyl groups Back     alignment and domain information
>PLN02562 UDP-glycosyltransferase Back     alignment and domain information
>PLN02992 coniferyl-alcohol glucosyltransferase Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02554 UDP-glycosyltransferase family protein Back     alignment and domain information
>PLN02410 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02208 glycosyltransferase family protein Back     alignment and domain information
>PLN03015 UDP-glucosyl transferase Back     alignment and domain information
>PLN02555 limonoid glucosyltransferase Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG5017 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN03007 UDP-glucosyltransferase family protein Back     alignment and domain information
>COG3980 spsG Spore coat polysaccharide biosynthesis protein, predicted glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02534 UDP-glycosyltransferase Back     alignment and domain information
>PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN00164 glucosyltransferase; Provisional Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>PLN02173 UDP-glucosyl transferase family protein Back     alignment and domain information
>PLN02167 UDP-glycosyltransferase family protein Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02448 UDP-glycosyltransferase family protein Back     alignment and domain information
>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A Back     alignment and domain information
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02863 UDP-glucoronosyl/UDP-glucosyl transferase family protein Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02210 UDP-glucosyl transferase Back     alignment and domain information
>PF02350 Epimerase_2: UDP-N-acetylglucosamine 2-epimerase; InterPro: IPR003331 UDP-N-acetylglucosamine 2-epimerase 5 Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional Back     alignment and domain information
>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK14089 ipid-A-disaccharide synthase; Provisional Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>PRK10307 putative glycosyl transferase; Provisional Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family Back     alignment and domain information
>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02918 accessory Sec system glycosylation protein GtfA Back     alignment and domain information
>PLN02764 glycosyltransferase family protein Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PF02684 LpxB: Lipid-A-disaccharide synthetase; InterPro: IPR003835 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>TIGR03568 NeuC_NnaA UDP-N-acetyl-D-glucosamine 2-epimerase, UDP-hydrolysing Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain Back     alignment and domain information
>PLN02275 transferase, transferring glycosyl groups Back     alignment and domain information
>PRK09814 beta-1,6-galactofuranosyltransferase; Provisional Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK01021 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>PF04007 DUF354: Protein of unknown function (DUF354); InterPro: IPR007152 Members of this family are around 350 amino acids in length Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>PHA01633 putative glycosyl transferase group 1 Back     alignment and domain information
>PLN00414 glycosyltransferase family protein Back     alignment and domain information
>cd03784 GT1_Gtf_like This family includes the Gtfs, a group of homologous glycosyltransferases involved in the final stages of the biosynthesis of antibiotics vancomycin and related chloroeremomycin Back     alignment and domain information
>TIGR01426 MGT glycosyltransferase, MGT family Back     alignment and domain information
>PF06722 DUF1205: Protein of unknown function (DUF1205); InterPro: IPR010610 This entry represents a conserved region of unknown function within bacterial glycosyl transferases Back     alignment and domain information
>PHA01630 putative group 1 glycosyl transferase Back     alignment and domain information
>COG1819 Glycosyl transferases, related to UDP-glucuronosyltransferase [Carbohydrate transport and metabolism / Signal transduction mechanisms] Back     alignment and domain information
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PF06258 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterPro: IPR009367 This family consists of several hypothetical eukaryotic and prokaryotic proteins Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type Back     alignment and domain information
>PRK14098 glycogen synthase; Provisional Back     alignment and domain information
>TIGR03713 acc_sec_asp1 accessory Sec system protein Asp1 Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PRK10125 putative glycosyl transferase; Provisional Back     alignment and domain information
>PLN02501 digalactosyldiacylglycerol synthase Back     alignment and domain information
>COG0381 WecB UDP-N-acetylglucosamine 2-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10017 colanic acid biosynthesis protein; Provisional Back     alignment and domain information
>PLN02846 digalactosyldiacylglycerol synthase Back     alignment and domain information
>COG3660 Predicted nucleoside-diphosphate-sugar epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13524 Glyco_trans_1_2: Glycosyl transferases group 1 Back     alignment and domain information
>TIGR02193 heptsyl_trn_I lipopolysaccharide heptosyltransferase I Back     alignment and domain information
>PLN00142 sucrose synthase Back     alignment and domain information
>PLN02949 transferase, transferring glycosyl groups Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase Back     alignment and domain information
>TIGR02919 accessory Sec system glycosyltransferase GtfB Back     alignment and domain information
>TIGR00661 MJ1255 conserved hypothetical protein Back     alignment and domain information
>PF05159 Capsule_synth: Capsule polysaccharide biosynthesis protein; InterPro: IPR007833 This family includes export proteins involved in capsule polysaccharide biosynthesis, such as KpsS P42218 from SWISSPROT and LipB P57038 from SWISSPROT Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query357
2o6l_A170 Crystal Structure Of The Udp-Glucuronic Acid Bindin 2e-23
2o6l_A170 Crystal Structure Of The Udp-Glucuronic Acid Bindin 2e-07
2c1x_A456 Structure And Activity Of A Flavonoid 3-O Glucosylt 3e-11
2iya_A424 The Crystal Structure Of Macrolide Glycosyltransfer 3e-10
3hbf_A454 Structure Of Ugt78g1 Complexed With Myricetin And U 5e-07
2yjn_A441 Structure Of The Glycosyltransferase Eryciii From T 2e-06
2iyf_A430 The Crystal Structure Of Macrolide Glycosyltransfer 3e-06
2pq6_A482 Crystal Structure Of Medicago Truncatula Ugt85h2- I 5e-06
2acw_A465 Crystal Structure Of Medicago Truncatula Ugt71g1 Co 8e-06
2acv_A463 Crystal Structure Of Medicago Truncatula Ugt71g1 Le 8e-06
3ia7_A402 Crystal Structure Of Calg4, The Calicheamicin Glyco 1e-05
3otg_A412 Crystal Structure Of Calg1, Calicheamicin Glycostyl 2e-04
2vce_A480 Characterization And Engineering Of The Bifunctiona 6e-04
>pdb|2O6L|A Chain A, Crystal Structure Of The Udp-Glucuronic Acid Binding Domain Of The Human Drug Metabolizing Udp-Glucuronosyltransferase 2b7 Length = 170 Back     alignment and structure 
Iteration: 1

 Score =  106 bits (265), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 87/155 (56%), Gaps = 4/155 (2%)
Query: 120 KPLDESLQKWMDGAPE-GVIYFSLGTNMKGTSMGDFRRKAFLKAFARLPQYRVLWKWEND 178
           KPL +  + ++  + E GV+ FSLG+ +   +  + R      A A++PQ +VLW+++ +
Sbjct: 5   KPLPKEXEDFVQSSGENGVVVFSLGSXVSNXT--EERANVIASALAQIPQ-KVLWRFDGN 61
Query: 179 VMEGLGENIRLQKWMPQQDILAHPKVKLFIMQGGLQSLQEAFHYGVKLICIPMFADQDLN 238
             + LG N RL KW+PQ D+L HPK + FI  GG   + EA ++G+  + IP+FADQ  N
Sbjct: 62  KPDTLGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPXVGIPLFADQPDN 121
Query: 239 CQRVGKIKTGIVLEYEDLNEEIIFNALKLVLEDPQ 273
                     + +++   +   + NALK V+ DP 
Sbjct: 122 IAHXKARGAAVRVDFNTXSSTDLLNALKRVINDPS 156
>pdb|2O6L|A Chain A, Crystal Structure Of The Udp-Glucuronic Acid Binding Domain Of The Human Drug Metabolizing Udp-Glucuronosyltransferase 2b7 Length = 170 Back     alignment and structure
>pdb|2C1X|A Chain A, Structure And Activity Of A Flavonoid 3-O Glucosyltransferase Reveals The Basis For Plant Natural Product Modification Length = 456 Back     alignment and structure
>pdb|2IYA|A Chain A, The Crystal Structure Of Macrolide Glycosyltransferases: A Blueprint For Antibiotic Engineering Length = 424 Back     alignment and structure
>pdb|3HBF|A Chain A, Structure Of Ugt78g1 Complexed With Myricetin And Udp Length = 454 Back     alignment and structure
>pdb|2YJN|A Chain A, Structure Of The Glycosyltransferase Eryciii From The Erythromycin Biosynthetic Pathway, In Complex With Its Activating Partner, Erycii Length = 441 Back     alignment and structure
>pdb|2IYF|A Chain A, The Crystal Structure Of Macrolide Glycosyltransferases: A Blueprint For Antibiotic Engineering Length = 430 Back     alignment and structure
>pdb|2PQ6|A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase Length = 482 Back     alignment and structure
>pdb|2ACW|A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose Length = 465 Back     alignment and structure
>pdb|2ACV|A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Length = 463 Back     alignment and structure
>pdb|3IA7|A Chain A, Crystal Structure Of Calg4, The Calicheamicin Glycosyltransferase Length = 402 Back     alignment and structure
>pdb|3OTG|A Chain A, Crystal Structure Of Calg1, Calicheamicin Glycostyltransferase, Tdp Bound Form Length = 412 Back     alignment and structure
>pdb|2VCE|A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants Length = 480 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query357
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 8e-70
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 1e-29
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 6e-39
2iyf_A 430 OLED, oleandomycin glycosyltransferase; antibiotic 4e-11
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 3e-32
2iya_A 424 OLEI, oleandomycin glycosyltransferase; carbohydra 8e-08
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 2e-28
3ia7_A 402 CALG4; glycosysltransferase, calicheamicin, enediy 1e-06
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 4e-27
3rsc_A 415 CALG2; TDP, enediyne, structural genomics, PSI-2, 9e-06
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 1e-24
3otg_A 412 CALG1; calicheamicin, TDP, structural genomics, PS 2e-04
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 6e-24
2yjn_A 441 ERYCIII, glycosyltransferase; transferase, cytochr 4e-05
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; van 4e-21
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 1e-20
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 4e-20
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 7e-19
1rrv_A416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 1e-18
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 3e-18
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 2e-16
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 7e-13
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 6e-12
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 2e-10
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 2e-08
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransfer 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Length = 170 Back     alignment and structure
 Score =  215 bits (549), Expect = 8e-70
 Identities = 54/155 (34%), Positives = 92/155 (59%), Gaps = 4/155 (2%)

Query: 119 PKPLDESLQKWMDGAPE-GVIYFSLGTNMKGTSMGDFRRKAFLKAFARLPQYRVLWKWEN 177
            KPL + ++ ++  + E GV+ FSLG+ +   +M + R      A A++PQ +VLW+++ 
Sbjct: 4   AKPLPKEMEDFVQSSGENGVVVFSLGSMVS--NMTEERANVIASALAQIPQ-KVLWRFDG 60

Query: 178 DVMEGLGENIRLQKWMPQQDILAHPKVKLFIMQGGLQSLQEAFHYGVKLICIPMFADQDL 237
           +  + LG N RL KW+PQ D+L HPK + FI  GG   + EA ++G+ ++ IP+FADQ  
Sbjct: 61  NKPDTLGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPD 120

Query: 238 NCQRVGKIKTGIVLEYEDLNEEIIFNALKLVLEDP 272
           N   +      + +++  ++   + NALK V+ DP
Sbjct: 121 NIAHMKARGAAVRVDFNTMSSTDLLNALKRVINDP 155
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Length = 170 Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Length = 430 Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Length = 430 Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Length = 424 Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Length = 424 Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Length = 402 Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Length = 402 Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Length = 415 Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Length = 415 Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Length = 412 Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Length = 412 Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 441 Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 441 Back     alignment and structure
>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} PDB: 3h4i_A* 1pn3_A* 1pnv_A* Length = 404 Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Length = 415 Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Length = 398 Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Length = 384 Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Length = 416 Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Length = 391 Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Length = 398 Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Length = 456 Back     alignment and structure
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} PDB: 3hbj_A* Length = 454 Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Length = 463 Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Length = 482 Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Length = 480 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query357
3hbf_A454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 100.0
2c1x_A456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 100.0
2pq6_A482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 100.0
2vch_A480 Hydroquinone glucosyltransferase; glycosyltransfer 100.0
2acv_A463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 100.0
1iir_A415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 99.98
1rrv_A416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 99.98
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 99.96
3h4t_A404 Glycosyltransferase GTFA, glycosyltransferase; van 99.96
2iya_A424 OLEI, oleandomycin glycosyltransferase; carbohydra 99.95
4amg_A400 Snogd; transferase, polyketide biosynthesis, GT1 f 99.93
3rsc_A415 CALG2; TDP, enediyne, structural genomics, PSI-2, 99.91
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 99.91
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 99.9
3ia7_A402 CALG4; glycosysltransferase, calicheamicin, enediy 99.89
2yjn_A441 ERYCIII, glycosyltransferase; transferase, cytochr 99.89
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 99.84
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 99.81
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 99.8
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 99.77
3s2u_A365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 99.6
2jzc_A224 UDP-N-acetylglucosamine transferase subunit ALG13; 99.56
1f0k_A364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 99.17
3hbm_A282 UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter je 99.11
2f9f_A177 First mannosyl transferase (WBAZ-1); alpha-beta pr 98.45
1vgv_A384 UDP-N-acetylglucosamine 2-epimerase; structural ge 98.14
1v4v_A376 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t 98.09
3ot5_A403 UDP-N-acetylglucosamine 2-epimerase; structural ge 97.96
3dzc_A396 UDP-N-acetylglucosamine 2-epimerase; structural ge 97.87
3beo_A375 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a 97.77
4hwg_A385 UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc 97.65
3okp_A394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino 97.55
2iw1_A374 Lipopolysaccharide core biosynthesis protein RFAG; 97.53
3hbf_A 454 Flavonoid 3-O-glucosyltransferase; glycosyltransfe 97.48
2x6q_A416 Trehalose-synthase TRET; biosynthetic protein; 2.2 97.45
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 97.44
2gek_A406 Phosphatidylinositol mannosyltransferase (PIMA); G 97.43
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 97.35
3c48_A438 Predicted glycosyltransferases; retaining glycosyl 97.35
2jjm_A394 Glycosyl transferase, group 1 family protein; anth 97.34
2bfw_A200 GLGA glycogen synthase; glycosyltransferase family 97.29
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 97.21
3q3e_A631 HMW1C-like glycosyltransferase; N-glycosylation; 2 97.21
2vch_A 480 Hydroquinone glucosyltransferase; glycosyltransfer 97.2
3qhp_A166 Type 1 capsular polysaccharide biosynthesis prote 97.08
2c1x_A 456 UDP-glucose flavonoid 3-O glycosyltransferase; WIN 97.05
2acv_A 463 Triterpene UDP-glucosyl transferase UGT71G1; glyco 97.05
2pq6_A 482 UDP-glucuronosyl/UDP-glucosyltransferase; glycosyl 97.05
3fro_A439 GLGA glycogen synthase; glycosyltransferase family 96.94
2r60_A499 Glycosyl transferase, group 1; rossmann-fold; 1.80 96.88
2xci_A374 KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci 96.86
3oy2_A413 Glycosyltransferase B736L; rossmann fold, GDP-mann 96.8
4amg_A400 Snogd; transferase, polyketide biosynthesis, GT1 f 96.77
2iuy_A342 Avigt4, glycosyltransferase; antibiotics, family G 96.73
3rhz_A339 GTF3, nucleotide sugar synthetase-like protein; gl 96.64
4fzr_A398 SSFS6; structural genomics, PSI-biology, protein s 96.57
2hy7_A406 Glucuronosyltransferase GUMK; glycosyltransferases 96.17
2x0d_A413 WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge 95.95
1iir_A 415 Glycosyltransferase GTFB; rossmann fold; 1.80A {Am 95.63
3h4t_A 404 Glycosyltransferase GTFA, glycosyltransferase; van 95.5
1rzu_A485 Glycogen synthase 1; glycosyl-transferase, GT-B fo 95.4
1rrv_A 416 Glycosyltransferase GTFD; GT-B, glycosyltransferas 95.27
2qzs_A485 Glycogen synthase; glycosyl-transferase, GT-B fold 95.18
3otg_A 412 CALG1; calicheamicin, TDP, structural genomics, PS 95.09
2iya_A 424 OLEI, oleandomycin glycosyltransferase; carbohydra 94.36
3s28_A816 Sucrose synthase 1; glycosyltransferase, sucrose m 94.0
2p6p_A 384 Glycosyl transferase; X-RAY-diffraction,urdamycina 93.68
2yjn_A 441 ERYCIII, glycosyltransferase; transferase, cytochr 93.22
2iyf_A 430 OLED, oleandomycin glycosyltransferase; antibiotic 92.85
3tsa_A 391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 92.79
3oti_A398 CALG3; calicheamicin, TDP, structural genomics, PS 91.96
3rsc_A 415 CALG2; TDP, enediyne, structural genomics, PSI-2, 90.41
2gt1_A326 Lipopolysaccharide heptosyltransferase-1; GT-B fol 87.6
3ia7_A 402 CALG4; glycosysltransferase, calicheamicin, enediy 87.32
3tov_A349 Glycosyl transferase family 9; structural genomics 85.13
3vue_A536 GBSS-I, granule-bound starch synthase 1, chloropla 83.32
1psw_A348 ADP-heptose LPS heptosyltransferase II; structural 82.0
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A* Back     alignment and structure
Probab=100.00  E-value=3.4e-40  Score=320.40  Aligned_cols=218  Identities=22%  Similarity=0.354  Sum_probs=192.6

Q ss_pred             CeeEEEEcCCCccccC-----CCCCCCeEEeCccccCCCC---CCchHHHHHhccC-CCceEEEecCCccccCCCcHHHH
Q psy2178          86 KDSFMFSFDSRITGYA-----RPMQRKLVEVGPLHLVDPK---PLDESLQKWMDGA-PEGVIYFSLGTNMKGTSMGDFRR  156 (357)
Q Consensus        86 ~~~~~l~~s~~~l~~~-----~~~~p~v~~vG~l~~~~~~---~l~~~~~~~l~~~-~~~vv~vs~GS~~~~~~~~~~~~  156 (357)
                      +++.+++||+++||++     ++..|++++|||++.....   ..+++|.+||+.+ ++++|||+|||...   ++.+++
T Consensus       215 ~~~~vl~ns~~eLE~~~~~~~~~~~~~v~~vGPl~~~~~~~~~~~~~~~~~wLd~~~~~~vVyvsfGS~~~---~~~~~~  291 (454)
T 3hbf_A          215 RANAVAINSFATIHPLIENELNSKFKLLLNVGPFNLTTPQRKVSDEHGCLEWLDQHENSSVVYISFGSVVT---PPPHEL  291 (454)
T ss_dssp             GSSCEEESSCGGGCHHHHHHHHTTSSCEEECCCHHHHSCCSCCCCTTCHHHHHHTSCTTCEEEEECCSSCC---CCHHHH
T ss_pred             cCCEEEECChhHhCHHHHHHHHhcCCCEEEECCcccccccccccchHHHHHHHhcCCCCceEEEecCCCCc---CCHHHH
Confidence            5789999999999986     6777899999999864321   2356799999986 68999999999986   678889


Q ss_pred             HHHHHHHHhCCCceEEEEEcCCcc---C-----CCCCcEEEeecCChhhhhcCccceEEEeeCchhhHHHHHhcCceEEe
Q psy2178         157 KAFLKAFARLPQYRVLWKWENDVM---E-----GLGENIRLQKWMPQQDILAHPKVKLFIMQGGLQSLQEAFHYGVKLIC  228 (357)
Q Consensus       157 ~~i~~al~~~~~~~viw~~~~~~~---~-----~~~~nv~~~~~~pq~~lL~h~~~~~~ithgG~~s~~eal~~GvP~i~  228 (357)
                      .+++++|++.+. +|||+++++..   +     ..++|+++++|+||.++|+|+++++||||||+||++|++++|||+|+
T Consensus       292 ~el~~~l~~~~~-~flw~~~~~~~~~lp~~~~~~~~~~~~vv~w~Pq~~vL~h~~v~~fvtH~G~~S~~Eal~~GvP~i~  370 (454)
T 3hbf_A          292 TALAESLEECGF-PFIWSFRGDPKEKLPKGFLERTKTKGKIVAWAPQVEILKHSSVGVFLTHSGWNSVLECIVGGVPMIS  370 (454)
T ss_dssp             HHHHHHHHHHCC-CEEEECCSCHHHHSCTTHHHHTTTTEEEESSCCHHHHHHSTTEEEEEECCCHHHHHHHHHHTCCEEE
T ss_pred             HHHHHHHHhCCC-eEEEEeCCcchhcCCHhHHhhcCCceEEEeeCCHHHHHhhcCcCeEEecCCcchHHHHHHcCCCEec
Confidence            999999999998 99999987532   1     23679999999999999999999999999999999999999999999


Q ss_pred             ecCCCChHHHHHHHHH-hceeeeeeccCCCHHHHHHHHHHHhcCc---chhhccccchhhhccCCCcceEEEEeeccccc
Q psy2178         229 IPMFADQDLNCQRVGK-IKTGIVLEYEDLNEEIIFNALKLVLEDP---QVFKSGWMSLQKWMDGAPEGVIYFSLGTNMKG  304 (357)
Q Consensus       229 ~P~~~dQ~~na~~v~~-~G~g~~l~~~~~~~~~l~~~i~~~l~~~---~~~~~a~~l~~~~~~~~~~~vi~~slgs~~~g  304 (357)
                      +|+++||+.||+++++ +|+|+.++...+++++|.++|+++|+++   +||++|+++++++++...+|           |
T Consensus       371 ~P~~~DQ~~Na~~v~~~~g~Gv~l~~~~~~~~~l~~av~~ll~~~~~~~~r~~a~~l~~~~~~a~~~g-----------G  439 (454)
T 3hbf_A          371 RPFFGDQGLNTILTESVLEIGVGVDNGVLTKESIKKALELTMSSEKGGIMRQKIVKLKESAFKAVEQN-----------G  439 (454)
T ss_dssp             CCCSTTHHHHHHHHHTTSCSEEECGGGSCCHHHHHHHHHHHHSSHHHHHHHHHHHHHHHHHHHHTSTT-----------S
T ss_pred             CcccccHHHHHHHHHHhhCeeEEecCCCCCHHHHHHHHHHHHCCChHHHHHHHHHHHHHHHHHhhccC-----------C
Confidence            9999999999999999 5999999877899999999999999886   89999999999999887654           8


Q ss_pred             CcCchHHHHHHHHHHc
Q psy2178         305 TSMGDFRRKAFLKAFA  320 (357)
Q Consensus       305 ~s~~~~~~~~f~~~~~  320 (357)
                      ||..++.  .|++.+.
T Consensus       440 sS~~~l~--~~v~~i~  453 (454)
T 3hbf_A          440 TSAMDFT--TLIQIVT  453 (454)
T ss_dssp             HHHHHHH--HHHHHHT
T ss_pred             CHHHHHH--HHHHHHh
Confidence            8888886  8988765
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Back     alignment and structure
>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} SCOP: c.87.1.5 PDB: 3h4i_A* 1pn3_A* 1pnv_A* Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>2jzc_A UDP-N-acetylglucosamine transferase subunit ALG13; rossmann-like fold, endoplasmic reticulum, glycosyltransferase, structural genomics; NMR {Saccharomyces cerevisiae} PDB: 2ks6_A Back     alignment and structure
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Back     alignment and structure
>3hbm_A UDP-sugar hydrolase; PSEG; 1.80A {Campylobacter jejuni subsp} PDB: 3hbn_A* Back     alignment and structure
>2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 Back     alignment and structure
>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* Back     alignment and structure
>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 Back     alignment and structure
>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes} Back     alignment and structure
>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae} Back     alignment and structure
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A Back     alignment and structure
>4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii} Back     alignment and structure
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Back     alignment and structure
>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Back     alignment and structure
>3hbf_A Flavonoid 3-O-glucosyltransferase; glycosyltransferase, GT-B fold, GT1, phenylpropanoid metabolism; HET: UDP MYC; 2.10A {Medicago truncatula} SCOP: c.87.1.0 PDB: 3hbj_A* Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Back     alignment and structure
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Back     alignment and structure
>2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A Back     alignment and structure
>2vch_A Hydroquinone glucosyltransferase; glycosyltransferase, N-glucosyltransferase, UDP-glucose- dependent, plant glycosyltransferase; HET: UDP; 1.45A {Arabidopsis thaliana} SCOP: c.87.1.10 PDB: 2vce_A* 2vg8_A* Back     alignment and structure
>3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} Back     alignment and structure
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A* Back     alignment and structure
>2acv_A Triterpene UDP-glucosyl transferase UGT71G1; glycosyltransferase; HET: UDP; 2.00A {Medicago truncatula} SCOP: c.87.1.10 PDB: 2acw_A* Back     alignment and structure
>2pq6_A UDP-glucuronosyl/UDP-glucosyltransferase; glycosylation, isoflavonoid, uridine diphosphate glycosyltransferase; 2.10A {Medicago truncatula} SCOP: c.87.1.10 Back     alignment and structure
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Back     alignment and structure
>2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* Back     alignment and structure
>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* Back     alignment and structure
>4amg_A Snogd; transferase, polyketide biosynthesis, GT1 family, nogalamyci; HET: MLY; 2.59A {Streptomyces nogalater} PDB: 4an4_A* 4amb_A* Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Back     alignment and structure
>3rhz_A GTF3, nucleotide sugar synthetase-like protein; glycosyltransferase, transferase; HET: UDP; 1.90A {Streptococcus parasanguinis} PDB: 3qkw_A* Back     alignment and structure
>4fzr_A SSFS6; structural genomics, PSI-biology, protein structure initiati enzyme discovery for natural product biosynthesis, natPro; 2.40A {Streptomyces SP} PDB: 4g2t_A* Back     alignment and structure
>2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A* Back     alignment and structure
>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* Back     alignment and structure
>1iir_A Glycosyltransferase GTFB; rossmann fold; 1.80A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>3h4t_A Glycosyltransferase GTFA, glycosyltransferase; vancomycin, teicoplanin, ORF1, natural products, antibiotic; HET: UDP; 1.15A {Amycolatopsis orientalis} SCOP: c.87.1.5 PDB: 3h4i_A* 1pn3_A* 1pnv_A* Back     alignment and structure
>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A Back     alignment and structure
>1rrv_A Glycosyltransferase GTFD; GT-B, glycosyltransferase, rossmann fold, glycopeptide, VACO antibiotic, transferase-antibiotic complex; HET: OMZ GHP OMY 3FG TYD BGC; 2.00A {Amycolatopsis orientalis} SCOP: c.87.1.5 Back     alignment and structure
>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Back     alignment and structure
>2iya_A OLEI, oleandomycin glycosyltransferase; carbohydrate, glycosylation, enzyme, macrolide; HET: UDP ZIO; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Back     alignment and structure
>2yjn_A ERYCIII, glycosyltransferase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Back     alignment and structure
>3oti_A CALG3; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD C0T; 1.60A {Micromonospora echinospora} PDB: 3d0q_A* 3d0r_A* Back     alignment and structure
>3rsc_A CALG2; TDP, enediyne, structural genomics, PSI-2, protein structure initiative, center for eukaryotic structural genomics; HET: TYD C0T; 2.19A {Micromonospora echinospora} PDB: 3iaa_A* Back     alignment and structure
>2gt1_A Lipopolysaccharide heptosyltransferase-1; GT-B fold; 1.90A {Escherichia coli UTI89} PDB: 2h1f_A* 2h1h_A* Back     alignment and structure
>3ia7_A CALG4; glycosysltransferase, calicheamicin, enediyne, transf; 1.91A {Micromonospora echinospora} Back     alignment and structure
>3tov_A Glycosyl transferase family 9; structural genomics, PSI-BIOL protein structure initiative, midwest center for structural genomics, MCSG; 2.98A {Veillonella parvula} Back     alignment and structure
>3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A* Back     alignment and structure
>1psw_A ADP-heptose LPS heptosyltransferase II; structural genomics, NYSGXRC, LPS biosynthetic pathway, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.87.1.7 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 357
d2c1xa1450 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-gluc 2e-25
d1rrva_401 c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Am 5e-25
d2pq6a1473 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransfe 8e-24
d1iira_401 c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycol 3e-23
d2acva1461 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transf 7e-21
d1pn3a_391 c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA 3e-20
d2vcha1471 c.87.1.10 (A:6-476) Hydroquinone glucosyltransfera 2e-18
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Length = 450 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: UDPGT-like
domain: UDP glucose:flavonoid 3-o-glucosyltransferase
species: Grape (Vitis vinifera) [TaxId: 29760]

 Score =  104 bits (258), Expect = 2e-25
 Identities = 45/276 (16%), Positives = 87/276 (31%), Gaps = 16/276 (5%)

Query: 6   YFSIISWPFNNPENPAYVPVIWTANTDSMTFWQRVTNTVQAMAYYWLHMRTLDKEQAILN 65
                    +       V  I     + + F   ++          +    L+   + + 
Sbjct: 139 NSLSTHVYIDEIREKIGVSGIQGREDELLNFIPGMSKVRFRDLQEGIVFGNLNSLFSRML 198

Query: 66  QNLDEKYRKRSLREIYFDSAKDSFMFSFDSRITGYARPMQRKLVEVGPLHLVDPKPLDES 125
             + +   K +   I             D  +T   +   +  + +GP +L+ P P+  +
Sbjct: 199 HRMGQVLPKATAVFINS-------FEELDDSLTNDLKSKLKTYLNIGPFNLITPPPVVPN 251

Query: 126 LQKWMDGAPEGVIYFSLGTNMKGTSMGDFRRKAFLKAFARLPQYRVLWKWENDVMEGLGE 185
               +    E      +  +    +         L       +   +W   +     L E
Sbjct: 252 TTGCLQWLKERKPTSVVYISFGTVTTPPPAEVVALSEALEASRVPFIWSLRDKARVHLPE 311

Query: 186 --------NIRLQKWMPQQDILAHPKVKLFIMQGGLQSLQEAFHYGVKLICIPMFADQDL 237
                      +  W PQ ++LAH  V  F+   G  SL E+   GV LIC P F DQ L
Sbjct: 312 GFLEKTRGYGMVVPWAPQAEVLAHEAVGAFVTHCGWNSLWESVAGGVPLICRPFFGDQRL 371

Query: 238 NCQRV-GKIKTGIVLEYEDLNEEIIFNALKLVLEDP 272
           N + V   ++ G+ +E     +  + +    +L   
Sbjct: 372 NGRMVEDVLEIGVRIEGGVFTKSGLMSCFDQILSQE 407
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Length = 473 Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Length = 401 Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Length = 461 Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Length = 391 Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 471 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query357
d2c1xa1450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 100.0
d2vcha1471 Hydroquinone glucosyltransferase {Thale cress (Ara 99.97
d2pq6a1473 (Iso)flavonoid glycosyltransferase {Medicago trunc 99.97
d1iira_401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 99.97
d1rrva_401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 99.97
d2acva1461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 99.97
d1pn3a_391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 99.95
d1f0ka_351 Peptidoglycan biosynthesis glycosyltransferase Mur 99.61
d2f9fa1166 First mannosyl transferase WbaZ {Archaeoglobus ful 97.65
d2iw1a1370 Lipopolysaccharide core biosynthesis protein RfaG 97.47
d2pq6a1 473 (Iso)flavonoid glycosyltransferase {Medicago trunc 97.25
d2c1xa1 450 UDP glucose:flavonoid 3-o-glucosyltransferase {Gra 97.13
d2bisa1437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 96.52
d2bfwa1196 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 96.09
d2vcha1 471 Hydroquinone glucosyltransferase {Thale cress (Ara 95.97
d1rrva_401 TDP-vancosaminyltransferase GftD {Amycolatopsis or 95.74
d1o6ca_377 UDP-N-acetylglucosamine 2-epimerase {Bacillus subt 94.62
d1iira_401 UDP-glucosyltransferase GtfB {Amycolatopsis orient 94.52
d1rzua_477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 93.37
d2acva1 461 Triterpene UDP-glucosyl transferase UGT71G1 {Medic 93.27
d1v4va_373 UDP-N-acetylglucosamine 2-epimerase {Thermus therm 92.87
d1pn3a_ 391 TDP-epi-vancosaminyltransferase GtfA {Amycolatopsi 89.12
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: UDPGT-like
domain: UDP glucose:flavonoid 3-o-glucosyltransferase
species: Grape (Vitis vinifera) [TaxId: 29760]

Probab=100.00  E-value=1.5e-33  Score=270.68  Aligned_cols=222  Identities=22%  Similarity=0.352  Sum_probs=179.7

Q ss_pred             CeeEEEEcCCCccc-----cCCCCCCCeEEeCccccCCC---CCCchHHHHHhccC-CCceEEEecCCccccCCCcHHHH
Q psy2178          86 KDSFMFSFDSRITG-----YARPMQRKLVEVGPLHLVDP---KPLDESLQKWMDGA-PEGVIYFSLGTNMKGTSMGDFRR  156 (357)
Q Consensus        86 ~~~~~l~~s~~~l~-----~~~~~~p~v~~vG~l~~~~~---~~l~~~~~~~l~~~-~~~vv~vs~GS~~~~~~~~~~~~  156 (357)
                      ..+....++...+.     .+++..|++.++|++.....   .+.++++..|+... .+++||+++||...   ...+++
T Consensus       207 ~~~~~~~~~~~~l~~~~~~~~~~~~p~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~s~gs~~~---~~~~~~  283 (450)
T d2c1xa1         207 KATAVFINSFEELDDSLTNDLKSKLKTYLNIGPFNLITPPPVVPNTTGCLQWLKERKPTSVVYISFGTVTT---PPPAEV  283 (450)
T ss_dssp             GSSCEEESSCGGGCHHHHHHHHHHSSCEEECCCHHHHC---------CHHHHHHTSCTTCEEEEECCSSCC---CCHHHH
T ss_pred             cccccccccHHhhhhhhhhhccccCCceeecCCccccCCCCCCcchhhhccccccCCccceeeeccccccc---CCHHHH
Confidence            34556677766654     45667888999999876542   23356688899886 57899999999986   678999


Q ss_pred             HHHHHHHHhCCCceEEEEEcCCccC--------CCCCcEEEeecCChhhhhcCccceEEEeeCchhhHHHHHhcCceEEe
Q psy2178         157 KAFLKAFARLPQYRVLWKWENDVME--------GLGENIRLQKWMPQQDILAHPKVKLFIMQGGLQSLQEAFHYGVKLIC  228 (357)
Q Consensus       157 ~~i~~al~~~~~~~viw~~~~~~~~--------~~~~nv~~~~~~pq~~lL~h~~~~~~ithgG~~s~~eal~~GvP~i~  228 (357)
                      ++++.++++.+. +|+|++......        ..+.|+.+.+|+||.++|.||++++||||||.||+.||+++|||+|+
T Consensus       284 ~~~~~~~~~~~~-~vl~~~~~~~~~~l~~~~~~~~~~nv~~~~~~pq~~lL~hp~~~~fItHGG~~s~~eal~~GvP~v~  362 (450)
T d2c1xa1         284 VALSEALEASRV-PFIWSLRDKARVHLPEGFLEKTRGYGMVVPWAPQAEVLAHEAVGAFVTHCGWNSLWESVAGGVPLIC  362 (450)
T ss_dssp             HHHHHHHHHHTC-CEEEECCGGGGGGSCTTHHHHHTTTEEEESCCCHHHHHTSTTEEEEEECCCHHHHHHHHHHTCCEEE
T ss_pred             HHHHHHHHhcCC-eEEEEECCCccccCChhhhhhccccccccccCChHhhhccCceeEEEccCCccHHHHHHHcCCCEEe
Confidence            999999999998 999998653321        24679999999999999999999999999999999999999999999


Q ss_pred             ecCCCChHHHHHHHHH-hceeeeeeccCCCHHHHHHHHHHHhcCcchhh---ccccchhhhccCCCcceEEEEeeccccc
Q psy2178         229 IPMFADQDLNCQRVGK-IKTGIVLEYEDLNEEIIFNALKLVLEDPQVFK---SGWMSLQKWMDGAPEGVIYFSLGTNMKG  304 (357)
Q Consensus       229 ~P~~~dQ~~na~~v~~-~G~g~~l~~~~~~~~~l~~~i~~~l~~~~~~~---~a~~l~~~~~~~~~~~vi~~slgs~~~g  304 (357)
                      +|+++||+.||+|+++ .|+|+.++..++++++|.++|+++|+|++|++   |+++|++..++..++           +|
T Consensus       363 ~P~~~DQ~~na~rv~~~~G~G~~l~~~~~t~~~l~~ai~~vL~d~~y~~~~~r~~~l~~~~~~a~~~-----------~g  431 (450)
T d2c1xa1         363 RPFFGDQRLNGRMVEDVLEIGVRIEGGVFTKSGLMSCFDQILSQEKGKKLRENLRALRETADRAVGP-----------KG  431 (450)
T ss_dssp             CCCSTTHHHHHHHHHHTSCCEEECGGGSCCHHHHHHHHHHHHHSHHHHHHHHHHHHHHHHHHHHTST-----------TC
T ss_pred             cccccchHHHHHHHHHHcCcEEEecCCCcCHHHHHHHHHHHhcCcHHHHHHHHHHHHHHHHHHhccC-----------CC
Confidence            9999999999999987 69999999999999999999999999998875   555555444433333           37


Q ss_pred             CcCchHHHHHHHHHHccCCC
Q psy2178         305 TSMGDFRRKAFLKAFARLPQ  324 (357)
Q Consensus       305 ~s~~~~~~~~f~~~~~~lp~  324 (357)
                      ||..+..  .+++.+.|.++
T Consensus       432 ss~~~~~--~~~e~v~r~~~  449 (450)
T d2c1xa1         432 SSTENFI--TLVDLVSKPKD  449 (450)
T ss_dssp             HHHHHHH--HHHHHHTSCCC
T ss_pred             CHHHHHH--HHHHHHhhhcC
Confidence            7777765  78999988774
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1f0ka_ c.87.1.2 (A:) Peptidoglycan biosynthesis glycosyltransferase MurG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pq6a1 c.87.1.10 (A:8-480) (Iso)flavonoid glycosyltransferase {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d2c1xa1 c.87.1.10 (A:7-456) UDP glucose:flavonoid 3-o-glucosyltransferase {Grape (Vitis vinifera) [TaxId: 29760]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2vcha1 c.87.1.10 (A:6-476) Hydroquinone glucosyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rrva_ c.87.1.5 (A:) TDP-vancosaminyltransferase GftD {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1o6ca_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1iira_ c.87.1.5 (A:) UDP-glucosyltransferase GtfB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2acva1 c.87.1.10 (A:3-463) Triterpene UDP-glucosyl transferase UGT71G1 {Medicago truncatula [TaxId: 3880]} Back     information, alignment and structure
>d1v4va_ c.87.1.3 (A:) UDP-N-acetylglucosamine 2-epimerase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pn3a_ c.87.1.5 (A:) TDP-epi-vancosaminyltransferase GtfA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure