Psyllid ID: psy2185


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130------
MSEYNNLKRKSRDMETETEDELLMLTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHRFYLQQKVQSDFCSSKVTRRFA
ccccccHHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccHHcHHHHccccccccHHHHHHHcccHHHHHHHHHcccccccHHcccc
cHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccc
mseynnlkrksrdmETETEDELLMLTKDNETALhcaaqyghtpvvsqllehscdptirnsrhETALDLAAQYGRLETVDTLVRTHPGLIQAYNAraqstlfpasplhlasrnghrfylqqkvqsdfcsskvtrrfa
mseynnlkrksrdmeteTEDELLMLTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHRFYLQqkvqsdfcsskvtrrfa
MSEYNNLKRKSRdmetetedellmltKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHRFYLQQKVQSDFCSSKVTRRFA
************************LTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHRFYLQQKV**************
******LKRKSRDMETETEDELLMLTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHRFYLQQKVQSDFCSSKV*R***
******************EDELLMLTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHRFYLQQKVQS************
MS**NNLKRKSRDMETETEDELLMLTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHRFYLQQKVQSDF**********
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEYNNLKRKSRDMETETEDELLMLTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLASRNGHRFYLQQKVQSDFCSSKVTRRFA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query136 2.2.26 [Sep-21-2011]
Q92625 1134 Ankyrin repeat and SAM do yes N/A 0.625 0.074 0.565 2e-22
P59672 1150 Ankyrin repeat and SAM do yes N/A 0.625 0.073 0.565 3e-22
P0C6S7 1260 Ankyrin repeat and steril no N/A 0.625 0.067 0.565 8e-22
Q7Z6G8 1248 Ankyrin repeat and steril no N/A 0.625 0.068 0.565 9e-22
Q8BIZ1 1259 Ankyrin repeat and steril no N/A 0.625 0.067 0.565 9e-22
A5PMU4 1280 Ankyrin repeat and steril yes N/A 0.676 0.071 0.515 1e-19
Q8WXE0 1202 Caskin-2 OS=Homo sapiens no N/A 0.772 0.087 0.351 1e-11
Q8VHK1 1201 Caskin-2 OS=Mus musculus no N/A 0.720 0.081 0.366 1e-11
Q6DD51 1205 Caskin-2 OS=Xenopus laevi N/A N/A 0.772 0.087 0.351 1e-10
Q8VHK2 1430 Caskin-1 OS=Rattus norveg no N/A 0.647 0.061 0.391 1e-08
>sp|Q92625|ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens GN=ANKS1A PE=1 SV=4 Back     alignment and function desciption
 Score =  103 bits (258), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 52/92 (56%), Positives = 62/92 (67%), Gaps = 7/92 (7%)

Query: 28  DNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPG 87
           DNETALHCAAQYGHT VV  LLE   DPT+RN++ ET LDLAA YGRLE V  L+  HP 
Sbjct: 148 DNETALHCAAQYGHTEVVKVLLEELTDPTMRNNKFETPLDLAALYGRLEVVKMLLNAHPN 207

Query: 88  LIQAYNARAQSTLFPASPLHLASRNGHRFYLQ 119
           L+     +        +PLHLA+RNGH+  +Q
Sbjct: 208 LLSCNTKK-------HTPLHLAARNGHKAVVQ 232




Regulator of different signaling pathways. Regulates EPHA8 receptor tyrosine kinase signaling to control cell migration and neurite retraction.
Homo sapiens (taxid: 9606)
>sp|P59672|ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus GN=Anks1a PE=1 SV=3 Back     alignment and function description
>sp|P0C6S7|ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus GN=Anks1b PE=1 SV=1 Back     alignment and function description
>sp|Q7Z6G8|ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens GN=ANKS1B PE=1 SV=2 Back     alignment and function description
>sp|Q8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus GN=Anks1b PE=1 SV=3 Back     alignment and function description
>sp|A5PMU4|ANS1B_DANRE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Danio rerio GN=anks1b PE=3 SV=1 Back     alignment and function description
>sp|Q8WXE0|CSKI2_HUMAN Caskin-2 OS=Homo sapiens GN=CASKIN2 PE=1 SV=2 Back     alignment and function description
>sp|Q8VHK1|CSKI2_MOUSE Caskin-2 OS=Mus musculus GN=Caskin2 PE=1 SV=3 Back     alignment and function description
>sp|Q6DD51|CSKI2_XENLA Caskin-2 OS=Xenopus laevis GN=caskin2 PE=2 SV=1 Back     alignment and function description
>sp|Q8VHK2|CSKI1_RAT Caskin-1 OS=Rattus norvegicus GN=Caskin1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query136
307189167 808 Ankyrin repeat and sterile alpha motif d 0.705 0.118 0.697 2e-33
332022176 769 Ankyrin repeat and sterile alpha motif d 0.705 0.124 0.697 2e-33
242006161 845 hspc200, putative [Pediculus humanus cor 0.705 0.113 0.711 4e-33
307211178 812 Ankyrin repeat and sterile alpha motif d 0.705 0.118 0.697 7e-33
189236470 1299 PREDICTED: similar to CG4393 CG4393-PA [ 0.75 0.078 0.650 4e-32
270005360 1301 hypothetical protein TcasGA2_TC007410 [T 0.75 0.078 0.650 5e-32
345496365 797 PREDICTED: hypothetical protein LOC10011 0.654 0.111 0.717 2e-31
328785617 1480 PREDICTED: ankyrin repeat and SAM domain 0.705 0.064 0.677 2e-31
340715058 1476 PREDICTED: hypothetical protein LOC10064 0.705 0.065 0.677 2e-31
350414680 1476 PREDICTED: hypothetical protein LOC10074 0.705 0.065 0.677 2e-31
>gi|307189167|gb|EFN73615.1| Ankyrin repeat and sterile alpha motif domain-containing protein 1B [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 67/96 (69%), Positives = 81/96 (84%)

Query: 24  MLTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVR 83
           + TKDNETALHCAAQYGHT VV+QLL++ CDP+IRNSR E+ALDLAAQYGRLETV+ LVR
Sbjct: 113 LATKDNETALHCAAQYGHTEVVAQLLQYGCDPSIRNSRGESALDLAAQYGRLETVELLVR 172

Query: 84  THPGLIQAYNARAQSTLFPASPLHLASRNGHRFYLQ 119
           THP LI++    + S +FP +PLHLASRNGHR  ++
Sbjct: 173 THPELIESLRNSSSSLIFPHTPLHLASRNGHRAVVE 208




Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332022176|gb|EGI62493.1| Ankyrin repeat and sterile alpha motif domain-containing protein 1B [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|242006161|ref|XP_002423923.1| hspc200, putative [Pediculus humanus corporis] gi|212507186|gb|EEB11185.1| hspc200, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307211178|gb|EFN87391.1| Ankyrin repeat and sterile alpha motif domain-containing protein 1B [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|189236470|ref|XP_974604.2| PREDICTED: similar to CG4393 CG4393-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270005360|gb|EFA01808.1| hypothetical protein TcasGA2_TC007410 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|345496365|ref|XP_001602889.2| PREDICTED: hypothetical protein LOC100119039 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|328785617|ref|XP_392417.4| PREDICTED: ankyrin repeat and SAM domain-containing protein 1A-like [Apis mellifera] Back     alignment and taxonomy information
>gi|340715058|ref|XP_003396037.1| PREDICTED: hypothetical protein LOC100649175 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350414680|ref|XP_003490386.1| PREDICTED: hypothetical protein LOC100749056 [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query136
UNIPROTKB|F1MPD8259 LOC516896 "Uncharacterized pro 0.625 0.328 0.565 3.9e-21
UNIPROTKB|F1MHL2 1138 ANKS1A "Uncharacterized protei 0.735 0.087 0.523 4.9e-21
UNIPROTKB|F1RZ13 1153 ANKS1A "Uncharacterized protei 0.933 0.110 0.440 6.4e-21
UNIPROTKB|F1SQT7209 F1SQT7 "Uncharacterized protei 0.595 0.387 0.579 8e-21
UNIPROTKB|Q92625 1134 ANKS1A "Ankyrin repeat and SAM 0.625 0.074 0.576 1.7e-20
RGD|1309183 1125 Anks1a "ankyrin repeat and ste 0.625 0.075 0.576 2.7e-20
UNIPROTKB|E1C898 1155 ANKS1A "Uncharacterized protei 0.595 0.070 0.590 3.6e-20
UNIPROTKB|Q7Z6G8 1248 ANKS1B "Ankyrin repeat and ste 0.625 0.068 0.565 1.1e-19
MGI|MGI:1924781 1259 Anks1b "ankyrin repeat and ste 0.625 0.067 0.565 1.1e-19
RGD|1565556 1260 Anks1b "ankyrin repeat and ste 0.625 0.067 0.565 1.1e-19
UNIPROTKB|F1MPD8 LOC516896 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 248 (92.4 bits), Expect = 3.9e-21, P = 3.9e-21
 Identities = 52/92 (56%), Positives = 63/92 (68%)

Query:    28 DNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPG 87
             +NETALHCAAQYGH+ VV+ LLE   DPTIRNS+ ET LDLAA YGRL  V  ++  HP 
Sbjct:    88 ENETALHCAAQYGHSEVVAVLLEELTDPTIRNSKLETPLDLAALYGRLRVVKMIISAHPN 147

Query:    88 LIQAYNARAQSTLFPASPLHLASRNGHRFYLQ 119
             L+   N R  +      PLHLA+RNGH+  +Q
Sbjct:   148 LMSC-NTRKHT------PLHLAARNGHKAVVQ 172




GO:0046875 "ephrin receptor binding" evidence=IEA
UNIPROTKB|F1MHL2 ANKS1A "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RZ13 ANKS1A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1SQT7 F1SQT7 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q92625 ANKS1A "Ankyrin repeat and SAM domain-containing protein 1A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1309183 Anks1a "ankyrin repeat and sterile alpha motif domain containing 1A" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E1C898 ANKS1A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Z6G8 ANKS1B "Ankyrin repeat and sterile alpha motif domain-containing protein 1B" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1924781 Anks1b "ankyrin repeat and sterile alpha motif domain containing 1B" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1565556 Anks1b "ankyrin repeat and sterile alpha motif domain containing 1B" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P59672ANS1A_MOUSENo assigned EC number0.56520.6250.0739yesN/A
Q92625ANS1A_HUMANNo assigned EC number0.56520.6250.0749yesN/A
A5PMU4ANS1B_DANRENo assigned EC number0.51510.67640.0718yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-17
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 7e-16
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-14
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-13
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-11
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 7e-10
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-09
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-08
pfam0002333 pfam00023, Ank, Ankyrin repeat 4e-07
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-06
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 8e-06
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 4e-05
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 1e-04
smart0024830 smart00248, ANK, ankyrin repeats 0.001
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 0.002
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 0.002
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 0.003
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 73.2 bits (180), Expect = 1e-17
 Identities = 33/88 (37%), Positives = 45/88 (51%), Gaps = 7/88 (7%)

Query: 27  KDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHP 86
           +D  T LH AA  GH  VV  LLE+  D   +++   T L LAA+ G LE V  L+    
Sbjct: 5   EDGRTPLHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLLE-KG 63

Query: 87  GLIQAYNARAQSTLFPASPLHLASRNGH 114
             + A +          +PLHLA+RNG+
Sbjct: 64  ADVNARDKDGN------TPLHLAARNGN 85


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 136
KOG4412|consensus226 99.96
KOG4412|consensus226 99.96
PHA02743166 Viral ankyrin protein; Provisional 99.94
PHA02791284 ankyrin-like protein; Provisional 99.94
KOG0509|consensus 600 99.93
PHA02875 413 ankyrin repeat protein; Provisional 99.93
PHA02791 284 ankyrin-like protein; Provisional 99.93
KOG0509|consensus 600 99.92
PHA02878 477 ankyrin repeat protein; Provisional 99.92
PHA02859209 ankyrin repeat protein; Provisional 99.92
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.92
PHA02874 434 ankyrin repeat protein; Provisional 99.92
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.92
KOG0512|consensus228 99.91
KOG0502|consensus296 99.91
PHA02875 413 ankyrin repeat protein; Provisional 99.91
PHA02859209 ankyrin repeat protein; Provisional 99.91
PHA02798 489 ankyrin-like protein; Provisional 99.91
PHA02946 446 ankyin-like protein; Provisional 99.91
PHA03100 480 ankyrin repeat protein; Provisional 99.91
PHA03095 471 ankyrin-like protein; Provisional 99.91
PHA02874 434 ankyrin repeat protein; Provisional 99.91
PHA03100 480 ankyrin repeat protein; Provisional 99.91
PHA02878 477 ankyrin repeat protein; Provisional 99.9
KOG0195|consensus 448 99.9
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.9
PHA02741169 hypothetical protein; Provisional 99.9
PHA02798 489 ankyrin-like protein; Provisional 99.9
PHA02741169 hypothetical protein; Provisional 99.9
PHA02876 682 ankyrin repeat protein; Provisional 99.9
PHA02736154 Viral ankyrin protein; Provisional 99.9
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.89
KOG0508|consensus 615 99.89
PHA03095 471 ankyrin-like protein; Provisional 99.89
PHA02989 494 ankyrin repeat protein; Provisional 99.89
PHA02743166 Viral ankyrin protein; Provisional 99.88
PHA02989 494 ankyrin repeat protein; Provisional 99.88
PHA02884 300 ankyrin repeat protein; Provisional 99.87
KOG0510|consensus 929 99.87
KOG0508|consensus 615 99.87
PHA02884 300 ankyrin repeat protein; Provisional 99.87
KOG4177|consensus 1143 99.87
PHA02876 682 ankyrin repeat protein; Provisional 99.87
PHA02795 437 ankyrin-like protein; Provisional 99.86
PHA02795 437 ankyrin-like protein; Provisional 99.86
PHA02946 446 ankyin-like protein; Provisional 99.86
KOG0510|consensus 929 99.85
KOG0514|consensus452 99.85
PHA02917 661 ankyrin-like protein; Provisional 99.85
PHA02730 672 ankyrin-like protein; Provisional 99.85
KOG4177|consensus 1143 99.83
PHA02736154 Viral ankyrin protein; Provisional 99.82
PHA02917 661 ankyrin-like protein; Provisional 99.82
KOG0512|consensus228 99.81
KOG4214|consensus117 99.81
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.8
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.8
PHA02730 672 ankyrin-like protein; Provisional 99.8
KOG0507|consensus 854 99.79
KOG0505|consensus 527 99.79
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.76
KOG4214|consensus117 99.76
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.76
KOG0505|consensus 527 99.76
PHA02792 631 ankyrin-like protein; Provisional 99.76
KOG0507|consensus 854 99.75
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.75
KOG0502|consensus296 99.75
PHA02792 631 ankyrin-like protein; Provisional 99.74
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.72
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.71
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.7
KOG0514|consensus452 99.69
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.69
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.69
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.69
KOG0195|consensus 448 99.68
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.67
KOG1710|consensus 396 99.67
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.66
KOG0515|consensus752 99.64
KOG0515|consensus 752 99.62
KOG3676|consensus 782 99.59
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.58
KOG3676|consensus 782 99.46
KOG1710|consensus 396 99.44
KOG4369|consensus 2131 99.43
PF1360630 Ank_3: Ankyrin repeat 99.41
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 99.4
KOG0818|consensus 669 99.32
KOG4369|consensus 2131 99.27
KOG0783|consensus 1267 99.26
KOG0506|consensus622 99.25
PF1360630 Ank_3: Ankyrin repeat 99.17
KOG0522|consensus 560 99.17
KOG0705|consensus749 99.15
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 99.14
KOG0782|consensus1004 99.08
KOG0522|consensus 560 99.04
KOG0506|consensus622 99.03
KOG0783|consensus 1267 99.01
KOG0782|consensus1004 99.0
KOG3609|consensus 822 98.98
KOG2384|consensus 223 98.9
KOG0818|consensus 669 98.87
KOG0705|consensus749 98.81
KOG0521|consensus785 98.79
KOG0511|consensus 516 98.71
KOG0520|consensus 975 98.6
KOG2384|consensus 223 98.55
KOG0520|consensus 975 98.46
KOG0511|consensus 516 98.39
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 98.21
KOG0521|consensus785 98.21
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.79
KOG2505|consensus591 97.71
KOG2505|consensus591 97.61
KOG3609|consensus 822 97.02
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.21
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 95.24
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 93.84
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 93.7
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 92.58
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 87.6
>KOG4412|consensus Back     alignment and domain information
Probab=99.96  E-value=1.1e-29  Score=151.16  Aligned_cols=119  Identities=21%  Similarity=0.155  Sum_probs=72.9

Q ss_pred             HHHHHhhhhhhhhhhhccCCchHHHHHHHcCCHHHHHHHHhc-CCCCCcccCCCCCHHHHHHHcCCHHHHHHHHHhCCCh
Q psy2185          10 KSRDMETETEDELLMLTKDNETALHCAAQYGHTPVVSQLLEH-SCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGL   88 (136)
Q Consensus        10 ~~~~ll~~~~~~~~~~~~~g~t~l~~a~~~g~~~~~~~ll~~-~~~~~~~~~~g~t~l~~a~~~~~~~~~~~Ll~~~~~~   88 (136)
                      ++..++.+.+..+|-+|..||||||+||..|+.++|+.|+.. +++++..+..|.|+||||+..|+.+++++|++.|+.+
T Consensus        53 iv~fLlsq~nv~~ddkDdaGWtPlhia~s~g~~evVk~Ll~r~~advna~tn~G~T~LHyAagK~r~eIaqlLle~ga~i  132 (226)
T KOG4412|consen   53 IVYFLLSQPNVKPDDKDDAGWTPLHIAASNGNDEVVKELLNRSGADVNATTNGGQTCLHYAAGKGRLEIAQLLLEKGALI  132 (226)
T ss_pred             HHHHHHhcCCCCCCCccccCCchhhhhhhcCcHHHHHHHhcCCCCCcceecCCCcceehhhhcCChhhHHHHHHhcCCCC
Confidence            333444455555666666666666666666666666666655 6666666666666666666666666666666666555


Q ss_pred             hHhhhhhccCCCCCCCHHHHHHHcCcHHHHHHHHhCCCCcchhhccC
Q psy2185          89 IQAYNARAQSTLFPASPLHLASRNGHRFYLQQKVQSDFCSSKVTRRF  135 (136)
Q Consensus        89 ~~~~~~~~~~~~~~~t~l~~A~~~g~~~~~~~Ll~~g~~~~~~~~~g  135 (136)
                             ..+|..|.||||.|+..|..+++++|+..|+.+|..|+.|
T Consensus       133 -------~~kD~~~qtplHRAAavGklkvie~Li~~~a~~n~qDk~G  172 (226)
T KOG4412|consen  133 -------RIKDKQGQTPLHRAAAVGKLKVIEYLISQGAPLNTQDKYG  172 (226)
T ss_pred             -------cccccccCchhHHHHhccchhhHHHHHhcCCCCCcccccC
Confidence                   5556666666666666666666666666666666655554



>KOG4412|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 9e-10
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 2e-08
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-08
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 3e-08
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-08
2xeh_A157 Structural Determinants For Improved Thermal Stabil 5e-08
2xee_A157 Structural Determinants For Improved Thermal Stabil 6e-08
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 6e-08
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 8e-08
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 9e-08
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 1e-07
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-07
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-07
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 7e-07
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 8e-07
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 1e-06
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 1e-06
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-06
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 2e-06
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 2e-06
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-06
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 4e-06
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 8e-06
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 1e-05
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 2e-05
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 2e-05
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 3e-05
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 3e-05
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 4e-05
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 4e-05
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 5e-05
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 6e-05
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 2e-04
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 2e-04
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 2e-04
3ljn_A 364 Ankyrin Repeat Protein From Leishmania Major Length 8e-04
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure

Iteration: 1

Score = 58.9 bits (141), Expect = 9e-10, Method: Compositional matrix adjust. Identities = 35/92 (38%), Positives = 49/92 (53%), Gaps = 7/92 (7%) Query: 28 DNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPG 87 D +T LH AA+ GH VV LL DP ++S +T L LAA+ G E V L Sbjct: 36 DGKTPLHLAAENGHKEVVKLLLSQGADPNAKDSDGKTPLHLAAENGHKEVVKLL------ 89 Query: 88 LIQAYNARAQSTLFPASPLHLASRNGHRFYLQ 119 L Q + A+ + +PLHLA+ NGH+ ++ Sbjct: 90 LSQGADPNAKDS-DGKTPLHLAAENGHKEVVK 120
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3LJN|A Chain A, Ankyrin Repeat Protein From Leishmania Major Length = 364 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query136
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-18
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-14
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-13
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-12
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-07
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 9e-07
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-04
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 5e-18
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 9e-16
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-14
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-14
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 6e-14
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-13
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-05
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 6e-18
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-17
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 1e-15
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-14
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-12
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 3e-12
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-11
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 3e-08
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-17
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 9e-15
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-14
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-04
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-17
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-16
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-15
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-14
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-12
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-07
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-07
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-17
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-13
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-13
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-13
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-11
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-08
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-17
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-16
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-13
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-12
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 9e-11
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-08
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 5e-17
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-13
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-08
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-17
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-16
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-16
3v31_A167 Ankyrin repeat family A protein 2; structural geno 6e-14
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-06
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-17
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-17
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-14
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-14
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 4e-11
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-04
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-17
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-17
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-16
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-16
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-16
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-16
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-16
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-15
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-15
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-04
3v30_A172 DNA-binding protein rfxank; structural genomics co 9e-17
3v30_A172 DNA-binding protein rfxank; structural genomics co 2e-15
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-14
3v30_A172 DNA-binding protein rfxank; structural genomics co 8e-14
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-06
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-16
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 5e-15
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-13
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-13
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-12
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-09
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-16
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-16
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 1e-15
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-15
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 6e-14
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 3e-13
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-04
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-16
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-15
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-15
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-13
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-12
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-12
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 7e-12
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 1e-07
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-04
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-16
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-14
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-14
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-14
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-14
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-13
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-04
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-16
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-15
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-10
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 4e-16
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 1e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-12
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 2e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-10
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 3e-09
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-16
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-15
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 6e-14
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-10
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-07
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-16
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-15
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-14
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 7e-12
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 7e-08
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-06
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-16
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 6e-13
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-13
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-12
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-11
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-11
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-10
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 9e-04
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-16
3hra_A201 Ankyrin repeat family protein; structural protein; 7e-15
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-11
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-10
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-10
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-05
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-16
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-15
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-15
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-12
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-04
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-16
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 3e-15
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 8e-16
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-15
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-15
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 5e-14
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-15
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-13
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-13
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-05
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-15
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-15
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 2e-14
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-14
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-13
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-15
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-12
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-08
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 1e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-06
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-15
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 8e-14
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-05
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-15
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-15
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-13
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-06
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-15
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-14
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-14
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-13
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 9e-13
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-12
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-12
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-05
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-15
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-14
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-14
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-13
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 4e-13
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-04
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 6e-15
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-14
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 4e-14
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-12
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-05
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 9e-15
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-13
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-13
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 9e-13
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-04
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 1e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-14
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-14
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-14
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-14
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-13
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-10
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-05
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-14
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-12
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 3e-10
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-14
1awc_B153 Protein (GA binding protein beta 1); complex (tran 7e-14
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-13
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-12
2rfa_A 232 Transient receptor potential cation channel subfa 2e-14
2rfa_A232 Transient receptor potential cation channel subfa 1e-13
2rfa_A232 Transient receptor potential cation channel subfa 1e-13
2rfa_A232 Transient receptor potential cation channel subfa 3e-09
2rfa_A232 Transient receptor potential cation channel subfa 6e-09
2rfa_A232 Transient receptor potential cation channel subfa 9e-05
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 4e-14
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-13
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-11
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-10
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-05
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-14
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-13
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 8e-13
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 9e-13
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 9e-08
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 2e-04
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-13
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-10
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 4e-09
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 6e-09
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-04
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-13
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 4e-12
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-11
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-04
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-13
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-11
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 1e-10
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-07
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 4e-13
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 1e-12
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-11
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 9e-05
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 7e-04
2etb_A256 Transient receptor potential cation channel subfam 2e-12
2etb_A256 Transient receptor potential cation channel subfam 3e-11
2etb_A256 Transient receptor potential cation channel subfam 4e-11
2etb_A256 Transient receptor potential cation channel subfam 2e-10
2etb_A 256 Transient receptor potential cation channel subfam 9e-07
2etb_A256 Transient receptor potential cation channel subfam 1e-04
2pnn_A273 Transient receptor potential cation channel subfa 5e-12
2pnn_A273 Transient receptor potential cation channel subfa 4e-11
2pnn_A273 Transient receptor potential cation channel subfa 6e-11
2pnn_A273 Transient receptor potential cation channel subfa 3e-09
2pnn_A273 Transient receptor potential cation channel subfa 2e-07
2pnn_A 273 Transient receptor potential cation channel subfa 6e-06
1sw6_A327 Regulatory protein SWI6; transcription regulation, 4e-11
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-10
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-04
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-10
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-09
3jxi_A260 Vanilloid receptor-related osmotically activated p 6e-06
3jxi_A 260 Vanilloid receptor-related osmotically activated p 6e-05
3jxi_A260 Vanilloid receptor-related osmotically activated p 5e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 4e-10
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 6e-08
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 6e-10
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-08
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-07
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-06
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
 Score = 78.0 bits (193), Expect = 2e-18
 Identities = 22/89 (24%), Positives = 32/89 (35%), Gaps = 6/89 (6%)

Query: 26  TKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTH 85
             +NE  LH AA    T +V  LL    D +  + +  TAL  A   G ++TV   V+  
Sbjct: 59  LLENEFPLHQAATLEDTKIVKILLFSGLDDSQFDDKGNTALYYAVDSGNMQTVKLFVK-K 117

Query: 86  PGLIQAYNARAQSTLFPASPLHLASRNGH 114
              +  Y      T       + A     
Sbjct: 118 NWRLMFYGKTGWKT-----SFYHAVMLND 141


>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query136
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.98
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.97
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.96
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.96
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.96
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
2rfa_A232 Transient receptor potential cation channel subfa 99.96
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.95
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.95
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.95
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.95
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.95
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.95
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.95
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.95
3hra_A201 Ankyrin repeat family protein; structural protein; 99.95
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.95
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.95
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.94
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.94
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 99.94
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.94
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 99.94
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.94
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.94
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.94
3hra_A201 Ankyrin repeat family protein; structural protein; 99.94
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.94
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.94
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.94
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 99.94
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.94
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.94
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.94
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.94
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.94
2pnn_A273 Transient receptor potential cation channel subfa 99.94
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.94
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.94
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.94
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.94
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.94
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.94
2rfa_A232 Transient receptor potential cation channel subfa 99.93
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.93
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.93
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.93
2etb_A256 Transient receptor potential cation channel subfam 99.93
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.93
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.93
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.93
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.93
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.93
2etb_A256 Transient receptor potential cation channel subfam 99.93
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.93
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.93
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.93
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.93
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 99.93
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.93
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.93
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.93
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.93
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.93
2pnn_A273 Transient receptor potential cation channel subfa 99.93
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.93
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.93
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.92
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.92
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.92
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.92
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.92
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.92
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.92
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.92
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.92
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.92
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.91
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.91
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.91
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.9
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.88
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.87
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.87
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.86
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.84
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.82
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.81
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 99.8
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.79
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.72
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=100.00  E-value=2.2e-32  Score=166.38  Aligned_cols=124  Identities=26%  Similarity=0.317  Sum_probs=97.6

Q ss_pred             hhHHHHHHHHHhhhhhhhhhhhccCCchHHHHHHHcCCHHHHHHHHhcCCCCCcccCCCCCHHHHHHHcCCHHHHHHHHH
Q psy2185           4 YNNLKRKSRDMETETEDELLMLTKDNETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVR   83 (136)
Q Consensus         4 ~~~~~~~~~~ll~~~~~~~~~~~~~g~t~l~~a~~~g~~~~~~~ll~~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~Ll~   83 (136)
                      ..+-.+.++.+ .+.|+++|.+|..|.||||+|+..++.++++++++.|++++.++..|+||||+|+..|+.+++++|++
T Consensus        13 ~~G~~~~v~~L-l~~Gadvn~~d~~g~t~l~~a~~~~~~~~~~~ll~~gad~~~~d~~g~TpLh~A~~~g~~~~v~~Ll~   91 (169)
T 4gpm_A           13 ENGNKDRVKDL-IENGADVNASDSDGRTPLHHAAENGHKEVVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLIS   91 (169)
T ss_dssp             HTTCHHHHHHH-HHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHH
T ss_pred             HcCCHHHHHHH-HHCCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHhcccchhhhccCCCCHHHHHHHcCCHHHHHHHHH
Confidence            33444455444 46678888888888888888888888888888888888888888888888888888888888888888


Q ss_pred             hCCChhHhhhhhccCCCCCCCHHHHHHHcCcHHHHHHHHhCCCCcchhhccC
Q psy2185          84 THPGLIQAYNARAQSTLFPASPLHLASRNGHRFYLQQKVQSDFCSSKVTRRF  135 (136)
Q Consensus        84 ~~~~~~~~~~~~~~~~~~~~t~l~~A~~~g~~~~~~~Ll~~g~~~~~~~~~g  135 (136)
                      .|+++       +.++..|+||||+|+..|+.+++++|+++|++++.+|..|
T Consensus        92 ~gadv-------n~~d~~G~TpLh~A~~~g~~~~v~~Ll~~gad~~~~d~~G  136 (169)
T 4gpm_A           92 KGADV-------NAKDSDGRTPLHHAAENGHKEVVKLLISKGADVNTSDSDG  136 (169)
T ss_dssp             TTCCT-------TCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTS
T ss_pred             CcCCC-------CCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCCccccCCCC
Confidence            88877       6677778888888888888888888888888888877766



>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 136
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 7e-16
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-14
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-11
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-08
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-05
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-05
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-13
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 6e-06
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-05
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 3e-04
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 6e-11
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-09
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-09
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-06
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 0.002
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 8e-11
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 3e-09
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-04
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 9e-04
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 9e-11
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 9e-09
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-04
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-10
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-07
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-04
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 3e-10
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-08
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-08
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-09
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 9e-09
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-07
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-06
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 7e-05
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.001
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 0.001
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 3e-08
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 7e-04
d1ot8a_ 209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 8e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 0.004
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-05
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-07
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 4e-04
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-07
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-06
d1uoha_ 223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.002
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 6e-06
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.001
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 9e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.003
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 2e-04
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 6e-04
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 70.4 bits (171), Expect = 7e-16
 Identities = 29/84 (34%), Positives = 42/84 (50%), Gaps = 7/84 (8%)

Query: 31  TALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQ 90
           T LH A+  GH P+V  LL+    P + N + ET L +AA+ G  E    L++ +   + 
Sbjct: 2   TPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQ-NKAKVN 60

Query: 91  AYNARAQSTLFPASPLHLASRNGH 114
           A     Q      +PLH A+R GH
Sbjct: 61  AKAKDDQ------TPLHCAARIGH 78


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query136
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.96
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.95
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.94
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.94
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.94
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.93
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.93
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.93
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.93
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.93
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.92
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.92
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.92
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.92
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.92
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.91
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.91
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.91
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.9
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.9
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.9
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.9
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.89
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.89
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.88
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.87
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.87
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.86
d1s70b_ 291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.85
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.84
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.82
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.81
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.76
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.75
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.7
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Myotrophin
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.96  E-value=1.2e-29  Score=144.70  Aligned_cols=99  Identities=16%  Similarity=0.136  Sum_probs=95.5

Q ss_pred             chHHHHHHHcCCHHHHHHHHhcCCCCCcccCCCCCHHHHHHHcCCHHHHHHHHHhCCChhHhhhhhccCCCCCCCHHHHH
Q psy2185          30 ETALHCAAQYGHTPVVSQLLEHSCDPTIRNSRHETALDLAAQYGRLETVDTLVRTHPGLIQAYNARAQSTLFPASPLHLA  109 (136)
Q Consensus        30 ~t~l~~a~~~g~~~~~~~ll~~~~~~~~~~~~g~t~l~~a~~~~~~~~~~~Ll~~~~~~~~~~~~~~~~~~~~~t~l~~A  109 (136)
                      .|||++|+..|+.+++++|++.|++++.++..|+||||+|+..++.+++++|++.|+++       ..++..|+||||+|
T Consensus         3 ~tpL~~A~~~g~~~~v~~Ll~~g~d~n~~~~~g~t~lh~A~~~~~~~~~~~ll~~g~di-------n~~d~~g~tpLh~A   75 (118)
T d1myoa_           3 DKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADI-------NAPDKHHITPLLSA   75 (118)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHTTTCCCCCCSSSSCCTTHHHHHHSTTTHHHHHHHSSCTT-------TCCSSSCSCHHHHH
T ss_pred             ChHHHHHHHCCCHHHHHHHHHhhhcccccccccccccccccccccccccccccccccee-------eecccccccchhhh
Confidence            58999999999999999999999999999999999999999999999999999999998       77888999999999


Q ss_pred             HHcCcHHHHHHHHhCCCCcchhhccC
Q psy2185         110 SRNGHRFYLQQKVQSDFCSSKVTRRF  135 (136)
Q Consensus       110 ~~~g~~~~~~~Ll~~g~~~~~~~~~g  135 (136)
                      +..|+.+++++|+++|+|++.+|+.|
T Consensus        76 ~~~~~~~~v~~Ll~~Gad~~~~d~~G  101 (118)
T d1myoa_          76 VYEGHVSCVKLLLSKGADKTVKGPDG  101 (118)
T ss_dssp             HTTTCCHHHHHHHTTCCCSSSSSSST
T ss_pred             hhcCchhhhhhhhcccccceeeCCCC
Confidence            99999999999999999999999887



>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure