Psyllid ID: psy2190

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970------
MNADRKNSVVELSDKAKWRPFNGSCMEECPPGKQLIPRDTLQPQSASNEVSGNSKFDQTKEKVCTDIDIRNYVSSFDVLKDCTVVEGFVQINLIDNSTAQDFENITFPKLREITEYLSFYHVSGLKSIGKLFPNLAIIRGNTLIWDYTFSVFSMFNLQEIGLHRLTHIMKGTVVILRNPDWKRITKKGSVVINDIKSKEACLQEGEPGARSGPEKCEFYWSNNDCQLIKEIEECHPLCAGGCTGKRAEDCFVCIGFIHDGHCLDQCPPNLQGQVATLQRILYGGIRYSYMNRRCLTREECLNNKRVTTKNFPQNMRMSYSDKAKWRPFNGSCMEECPPGYNTTADETSCVPCPDCPKVCKGVHVKSIEVARSTKGCTVINGSLGIQIQTGDSEVVHQELEKGLGMITNITGHLKISHSLPIQSLSFLKSLQSIHGEREIIRGDTSESSVYSNYSLIVWDNPNLQELWGWSNLPDGQRPKFEIKKGKILFHDNPKLCLDKIYELINVTNITYDSDFDVLKESNGDEFICGFSNLALVVLNKTDVSIRFQLNENEKVPDNQRYVLFYMKADNGMYTDFDTVGSCSASGWKFKDINSKNKTVEVMNLEPATEYAFFVKIYNSQRIVRSNISLQTTLPTKPSIPYQFEVVRVNSSSVTLRWGEPKHPHGILEKYVIKAYYQDYDKDYLDTRNYCVDKLRDLSDSTYAASHLMRFAKTTRKPLKECCGKFPCDFDHESFQYMTSQMQLIQQCDNYIFKYLQYNDLHKAYGGDLPSLGNISSRLPDREENDVLYPETSYTMVGLGHFRSIVFTISACRKEQKDKFLPYDPEEGRCSEETLVMSRTEVDHLADTIPADSLNFEMINASALRIRWHPPSRPNGIIVAYNIEYKRESGGNSENMCRTRKDIDRDSGLYLYDYPAGSYLFRLRVVSLGGEGPWTSWKPCVIESAETPMSVYVIVVVTGLVILFCMLAVILFLILGF
ccccccccEEEccccccEEEEccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccEEEEcEEEEEEEccccccccccccccccEEEEEEEEEEEEcccEEccccccccEEEEccEEEcccEEEEEEcccccEEccccccccccccEEEEcccccccccccccEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccEEcccccccccccccEEEEEEEcccEEEEcccEEccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccEEEEcccEEEEEEcccccccHHHHHHccccEEEEEEEEEEEcccccccccccccccccccccEEEEcccccccccccEEEEEEcccccccccccccccccccccEEEEccEEEEEccccccccEEEEEEEEcEEEEcccccccccccccccccccccccEEEEEcccEEEEEEEccccccccccEEEEEEEEccccccEEEcccccccccccEEEEccccccEEEEEccccccEEEEEEEEEccccccccccEEEEccccccccccEEEEEEEcccEEEEEEccccccccEEEEEEEEEEEEcccccccEEccEEcccccccccccccccEEEEEEEEccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccccccccccccccccccEEEEcccccccEEEEEEEEEEccccccccccccccccccccEEEEEEEccccccccccccccEEEEccccEEEEEEccccccccEEEEEEEEEEEcccccccEEEEEcccccccccEEEccccccEEEEEEEEEEccccccccccEEEEEccccccccEEEEEEEEEEEEEEEEccEEEEEEEcc
ccHHHHHHcccccccccEEEcccccccccccccEEcccccEEEcccccccccccccccccccccccccccccHHHHHHHcccEEEEEEEEEEEEcccccHHHHHcccccEEEEccEEEEEEcccHccHHHHHHccEEEEcccHcccEEEEEEEcccHHHHccccHHHEccccEEEEccccHHHHccccccEEEccccccHccccccccccccccccEEEccccccccccccccccHHHccccccccccccEEEEEEcccccccccccccccccccEEEEccccccEEEEcccEEEcHHHHHHHcccccccccccccccccccccEEccccccccccccccEEccccccccccccccccccccccccHHHHHHHcccEEEEEEEEEEEEccccccHHHHHHHHHccEEEEccEEEEEEcccHHcHHHHHHccEEccccEEEccccccEcccccEEEEEEEcccHHHHccccccccccccEEEEcccEEEEEcccHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEEEEcccEEEEEEccccccHHHHEEEEEEEEEccccccEEEccccccccccEEEEEcccccccEEEcccccccEEEEEEEEEEccccccccEEEEEEccccccccccEEEEEccccEEEEEEcccccccccEEEEEEEEEEccccHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccEcccccccccccccccccccccccccccccccccccEEEEEcccccEEEEEEEEEEcccccccccccccccccccHHHHHHHcccccccccccccccEEEEEccccEEEEEEccccccccEEEEEEEEEEEccccccEEEEEEHHHHHHcccEEEEccccccEEEEEEEEEccccccccccEEEEEccccccccHHEEEEEHHHHHHHHHHHHHHHHHHHc
mnadrknsVVELsdkakwrpfngscmeecppgkqliprdtlqpqsasnevsgnskfdqtkekvctdidirnyvssfdvlkdctvVEGFVQINlidnstaqdfenitfpkLREITEYLSFYHVsglksigklfpnlaiirgntLIWDYTFSVFSMFNLQEIGLHRLTHIMKGTVVIlrnpdwkritkkgSVVINDIKSKEaclqegepgarsgpekcefywsnnDCQLIKEIEechplcaggctgkraedcfvcigfihdghcldqcppnlqgQVATLQRILYGGIRysymnrrcltreeclnnkrvttknfpqnmrmsysdkakwrpfngscmeecppgynttadetscvpcpdcpkvckgvhvKSIEVArstkgctvingslgiqiqtgdSEVVHQELEKGLGMITNITGhlkishslpiqslSFLKSLQSihgereiirgdtsessvysnyslivwdnpnlqelwgwsnlpdgqrpkfeikkgkilfhdnpklcLDKIYELINvtnitydsdfdvlkesngdeficgFSNLALVVLNKTDVSirfqlnenekvpdnqRYVLFYMKadngmytdfdtvgscsasgwkfkdinsknktvevmnlepatEYAFFVKIYNSqrivrsnislqttlptkpsipyqfEVVRVNSssvtlrwgepkhphgiLEKYVIKAYYQDydkdyldtrnyCVDKLRDLSDSTYAASHLMRFAKTtrkplkeccgkfpcdfdheSFQYMTSQMQLIQQCDNYIFKYLQYNdlhkayggdlpslgnissrlpdreendvlypetsytmvgLGHFRSIVFTISACRKeqkdkflpydpeegrcseeTLVMSRTEvdhladtipadslnFEMINASALrirwhppsrpngiIVAYNIEYkresggnsenmcrtrkdidrdsglylydypagsyLFRLRVVslggegpwtswkpcviesaetpmSVYVIVVVTGLVILFCMLAVILFLILGF
mnadrknsvvelsdkakwrpfngSCMEECPPGKQLIPRDTLQPQSASnevsgnskfdqtkekVCTDIDIRNYVSSFDVLKDCTVVEGFVQINlidnstaqdfeNITFPKLREITEYLSFYHVSGLKSIGKLFPNLAIIRGNTLIWDYTFSVFSMFNLQEIGLHRLTHIMKGTVvilrnpdwkritkkgsvvindikskeaclqegepgarsgpekcEFYWSNNDCQLIKEIEECHPLCAGGCTGKRAEDCFVCIGFIHDGHCLDQCPPNLQGQVATLQRILYGGIRYSYMNRrcltreeclnnkrvttknfpqnmrmsysdkaKWRPFNGSCMEECPPGYNTTADETSCVPCPDCPKVCKGVHVKSIEVARSTKGCTVINGSlgiqiqtgdSEVVHQELEKGLGMITNITGHLKISHSLPIQSLSFLKSLQSIHGEreiirgdtsesSVYSNYSLIVWDNPNLQELWGWSNLPDGQRPKFEIKKGKILFHDNPKLCLDKIYELINVTNITYDSDFDVLKESNGDEFICGFSNLALVVLNKTDVSIRFqlnenekvpdnqRYVLFYMKADNGMYTDFDTVGSCSASGWKFKDINSKNKTVEVMNLEPATEYAFFVKIYNSQRIVRSNislqttlptkpsipyqFEVVRVNSSsvtlrwgepkhphgilEKYVIKAYYQDYDKDYLDTRNYCVDKLRDLSDSTYAASHLMRFAKTTRKPLKECCGKFPCDFDHESFQYMTSQMQLIQQCDNYIFKYLQYNDLHKAYGGDLPSLGNISSRLPDREENDVLYPETSYTMVGLGHFRSIVFTISACRKEQkdkflpydpeegrCSEETLVMSRTEVDHLADTIPADSLNFEMINASALrirwhppsrpNGIIVAYNIEYKresggnsenmcrtrKDIDRDSGLYLYDYPAGSYLFRLRVVSLGGEGPWTSWKPCVIESAETPMSVYVIVVVTGLVILFCMLAVILFLILGF
MNADRKNSVVELSDKAKWRPFNGSCMEECPPGKQLIPRDTLQPQSASNEVSGNSKFDQTKEKVCTDIDIRNYVSSFDVLKDCTVVEGFVQINLIDNSTAQDFENITFPKLREITEYLSFYHVSGLKSIGKLFPNLAIIRGNTLIWDYTFSVFSMFNLQEIGLHRLTHIMKGTVVILRNPDWKRITKKGSVVINDIKSKEACLQEGEPGARSGPEKCEFYWSNNDCQLIKEIEECHPLCAGGCTGKRAEDCFVCIGFIHDGHCLDQCPPNLQGQVATLQRILYGGIRYSYMNRRCLTREECLNNKRVTTKNFPQNMRMSYSDKAKWRPFNGSCMEECPPGYNTTADETScvpcpdcpkvckGVHVKSIEVARSTKGCTVINGSLGIQIQTGDSEVVHQELEKGLGMITNITGHLKISHSLPIQSLSFLKSLQSIHGEREIIRGDTSESSVYSNYSLIVWDNPNLQELWGWSNLPDGQRPKFEIKKGKILFHDNPKLCLDKIYELINVTNITYDSDFDVLKESNGDEFICGFSNLALVVLNKTDVSIRFQLNENEKVPDNQRYVLFYMKADNGMYTDFDTVGSCSASGWKFKDINSKNKTVEVMNLEPATEYAFFVKIYNSQRIVRSNISLQTTLPTKPSIPYQFEVVRVNSSSVTLRWGEPKHPHGILEKYVIKAYYQDYDKDYLDTRNYCVDKLRDLSDSTYAASHLMRFAKTTRKPLKECCGKFPCDFDHESFQYMTSQMQLIQQCDNYIFKYLQYNDLHKAYGGDLPSLGNISSRLPDREENDVLYPETSYTMVGLGHFRSIVFTISACRKEQKDKFLPYDPEEGRCSEETLVMSRTEVDHLADTIPADSLNFEMINASALRIRWHPPSRPNGIIVAYNIEYKRESGGNSENMCRTRKDIDRDSGLYLYDYPAGSYLFRLRVVSLGGEGPWTSWKPCVIESAETPMSvyvivvvtglvilFCMLAVILFLILGF
*************************************************************KVCTDIDIRNYVSSFDVLKDCTVVEGFVQINLIDNSTAQDFENITFPKLREITEYLSFYHVSGLKSIGKLFPNLAIIRGNTLIWDYTFSVFSMFNLQEIGLHRLTHIMKGTVVILRNPDWKRITKKGSVVINDIKSKEAC*************KCEFYWSNNDCQLIKEIEECHPLCAGGCTGKRAEDCFVCIGFIHDGHCLDQCPPNLQGQVATLQRILYGGIRYSYMNRRCLTREECLNNKRVTTKNF***********AKWRPFNGSCMEECPPGYNTTADETSCVPCPDCPKVCKGVHVKSIEVARSTKGCTVINGSLGIQIQTGDSEVVHQELEKGLGMITNITGHLKISHSLPIQSLSFLKSLQSIHGEREIIRGDTSESSVYSNYSLIVWDNPNLQELWGWSNLPDGQRPKFEIKKGKILFHDNPKLCLDKIYELINVTNITYDSDFDVLKESNGDEFICGFSNLALVVLNKTDVSIRFQLNENEKVPDNQRYVLFYMKADNGMYTDFDTVGSCSASGWKFKDINSKNKTVEVMNLEPATEYAFFVKIYNSQRIVRSNISLQTTLPTKPSIPYQFEVVRVNSSSVTLRWGEPKHPHGILEKYVIKAYYQDYDKDYLDTRNYCVDKLRDLSDSTYAASHLMRFAKTTRKPLKECCGKFPCDFDHESFQYMTSQMQLIQQCDNYIFKYLQYNDLHKAYGGDLPSLGNI**********DVLYPETSYTMVGLGHFRSIVFTISACRKEQKDKFLP************LVMSRTEVDHLADTIPADSLNFEMINASALRIRWHPPSRPNGIIVAYNIEYK***************DIDRDSGLYLYDYPAGSYLFRLRVVSLGGEGPWTSWKPCVIESAETPMSVYVIVVVTGLVILFCMLAVILFLILG*
*****KNSVVELSDKAKWRPFNGSCMEECPPGKQLIPRDTLQPQSAS*********DQTKEKVCTDIDIRNYVSSFDVLKDCTVVEGFVQINLIDNSTAQDFENITFPKLREITEYLSFYHVSGLKSIGKLFPNLAIIRGNTLIWDYTFSVFSMFNLQEIGLHRLTHIMKGTVVILRNPDWKRITKKGSVVINDIKSKEACLQEGEPGARSGPEKCEFYWSNNDCQLIKEIEECHPLCAGGCTGKRAEDCFVCIGFIHDGHCLDQCPPNLQGQVATLQRILYGGIRYSYMNRRCLTREECLNNKRVTTKNFPQNMRMSYSDKAKWRPFNGSCMEECPPGYNTTADETSCVPCPDCPKVCKGVHVKSIEVARSTKGCTVINGSLGIQIQTGDSEVVHQELEKGLGMITNITGHLKISHSLPIQSLSFLKSLQSIHGEREIIRGDTSESSVYSNYSLIVWDNPNLQELWGWSNLPDGQRPKFEIKKGKILFHDNPKLCLDKIYELINVTNITYDSDFDVLKESNGDEFICGFSNLALVVLNKTDVSIRFQLNENEKVPDNQRYVLFYMKADNGMYTDFDTVGSCSASGWKFKDINSKNKTVEVMNLEPATEYAFFVKI*************QTTLPTKPSIPYQFEVVRVNSSSVTLRWGEPKHPHGILEKYVIKAYYQDYDKDYLDTRNYCVDKLRDLSDSTYAASHLMRFAKTTRKPL***************************QCDNYIFKYLQYNDLHKAYGGDLPSLGNISSRLPDREENDVLYPETSYTMVGLGHFRSIVFTISACRKEQKDKFLPY*****RCSEETLVMS***************LNFEMINASALRIRWHPPSRPNGIIVAYNIEYKRESGG***NMCRTRKDIDRDSGLYLYDYPAGSYLFRLRVVSLGGEGPWTSWKPCVIESAETPMSVYVIVVVTGLVILFCMLAVILFLILGF
**********ELSDKAKWRPFNGSCMEECPPGKQLIPRDT******************TKEKVCTDIDIRNYVSSFDVLKDCTVVEGFVQINLIDNSTAQDFENITFPKLREITEYLSFYHVSGLKSIGKLFPNLAIIRGNTLIWDYTFSVFSMFNLQEIGLHRLTHIMKGTVVILRNPDWKRITKKGSVVINDIKSKEACL**********PEKCEFYWSNNDCQLIKEIEECHPLCAGGCTGKRAEDCFVCIGFIHDGHCLDQCPPNLQGQVATLQRILYGGIRYSYMNRRCLTREECLNNKRVTTKNFPQNMRMSYSDKAKWRPFNGSCMEECPPGYNTTADETSCVPCPDCPKVCKGVHVKSIEVARSTKGCTVINGSLGIQIQTGDSEVVHQELEKGLGMITNITGHLKISHSLPIQSLSFLKSLQSIHGEREIIRGDTSESSVYSNYSLIVWDNPNLQELWGWSNLPDGQRPKFEIKKGKILFHDNPKLCLDKIYELINVTNITYDSDFDVLKESNGDEFICGFSNLALVVLNKTDVSIRFQLNENEKVPDNQRYVLFYMKADNGMYTDFDTVGSCSASGWKFKDINSKNKTVEVMNLEPATEYAFFVKIYNSQRIVRSNISLQTTLPTKPSIPYQFEVVRVNSSSVTLRWGEPKHPHGILEKYVIKAYYQDYDKDYLDTRNYCVDKLRDLSDSTYAASHLMRFAKTTRKPLKECCGKFPCDFDHESFQYMTSQMQLIQQCDNYIFKYLQYNDLHKAYGGDLPSLGNISSRLPDREENDVLYPETSYTMVGLGHFRSIVFTISACRKEQKDKFLPYDPEEGRCSEETLVMSRTEVDHLADTIPADSLNFEMINASALRIRWHPPSRPNGIIVAYNIEYKRESGGNSENMCRTRKDIDRDSGLYLYDYPAGSYLFRLRVVSLGGEGPWTSWKPCVIESAETPMSVYVIVVVTGLVILFCMLAVILFLILGF
MNADRKNSVVELSDKAKWRPFNGSCMEECPPGKQLIPRDTLQPQSASNEVSGNSKFDQTKEKVCTDIDIRNYVSSFDVLKDCTVVEGFVQINLIDNSTAQDFENITFPKLREITEYLSFYHVSGLKSIGKLFPNLAIIRGNTLIWDYTFSVFSMFNLQEIGLHRLTHIMKGTVVILRNPDWKRITKKGSVVINDIKSKEACLQEGEPGARSGPEKCEFYWSNNDCQLIKEIEECHPLCAGGCTGKRAEDCFVCIGFIHDGHCLDQCPPNLQGQVATLQRILYGGIRYSYMNRRCLTREECLNNKRVTTKNFPQNMRMSYSDKAKWRPFNGSCMEECPPGYNTTADETSCVPCPDCPKVCKGVHVKSIEVARSTKGCTVINGSLGIQIQTGDSEVVHQELEKGLGMITNITGHLKISHSLPIQSLSFLKSLQSIHGEREIIRGDTSESSVYSNYSLIVWDNPNLQELWGWSNLPDGQRPKFEIKKGKILFHDNPKLCLDKIYELINVTNITYDSDFDVLKESNGDEFICGFSNLALVVLNKTDVSIRFQLNENEKVPDNQRYVLFYMKADNGMYTDFDTVGSCSASGWKFKDINSKNKTVEVMNLEPATEYAFFVKIYNSQRIVRSNISLQTTLPTKPSIPYQFEVVRVNSSSVTLRWGEPKHPHGILEKYVIKAYYQDYDKDYLDTRNYCVDKL**************************CCGKFPCDFDHESFQYMTSQMQLIQQCDNYIFKYLQYND**************************VLYPETSYTMVGLGHFRSIVFTISACRKEQKDK*******EGRCSEETLVMSRTEVDHLADTIPADSLNFEMINASALRIRWHPPSRPNGIIVAYNIEYKRESGGNSENMCRTRKDIDRDSGLYLYDYPAGSYLFRLRVVSLGGEGPWTSWKPCVIESAETPMSVYVIVVVTGLVILFCMLAVILFLILGF
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNADRKNSVVELSDKAKWRPFNGSCMEECPPGKQLIPRDTLQPQSASNEVSGNSKFDQTKEKVCTDIDIRNYVSSFDVLKDCTVVEGFVQINLIDNSTAQDFENITFPKLREITEYLSFYHVSGLKSIGKLFPNLAIIRGNTLIWDYTFSVFSMFNLQEIGLHRLTHIMKGTVVILRNPDWKRITKKGSVVINDIKSKEACLQEGEPGARSGPEKCEFYWSNNDCQLIKEIEECHPLCAGGCTGKRAEDCFVCIGFIHDGHCLDQCPPNLQGQVATLQRILYGGIRYSYMNRRCLTREECLNNKRVTTKNFPQNMRMSYSDKAKWRPFNGSCMEECPPGYNTTADETSCVPCPDCPKVCKGVHVKSIEVARSTKGCTVINGSLGIQIQTGDSEVVHQELEKGLGMITNITGHLKISHSLPIQSLSFLKSLQSIHGEREIIRGDTSESSVYSNYSLIVWDNPNLQELWGWSNLPDGQRPKFEIKKGKILFHDNPKLCLDKIYELINVTNITYDSDFDVLKESNGDEFICGFSNLALVVLNKTDVSIRFQLNENEKVPDNQRYVLFYMKADNGMYTDFDTVGSCSASGWKFKDINSKNKTVEVMNLEPATEYAFFVKIYNSQRIVRSNISLQTTLPTKPSIPYQFEVVRVNSSSVTLRWGEPKHPHGILEKYVIKAYYQDYDKDYLDTRNYCVDKLRDLSDSTYAASHLMRFAKTTRKPLKECCGKFPCDFDHESFQYMTSQMQLIQQCDNYIFKYLQYNDLHKAYGGDLPSLGNISSRLPDREENDVLYPETSYTMVGLGHFRSIVFTISACRKEQKDKFLPYDPEEGRCSEETLVMSRTEVDHLADTIPADSLNFEMINASALRIRWHPPSRPNGIIVAYNIEYKRESGGNSENMCRTRKDIDRDSGLYLYDYPAGSYLFRLRVVSLGGEGPWTSWKPCVIESAETPMSVYVIVVVTGLVILFCMLAVILFLILGF
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query976 2.2.26 [Sep-21-2011]
Q9PVZ4 1362 Insulin receptor OS=Xenop N/A N/A 0.876 0.627 0.285 1e-102
Q93105 1393 Insulin-like receptor OS= N/A N/A 0.881 0.617 0.298 3e-95
P15208 1372 Insulin receptor OS=Mus m yes N/A 0.858 0.610 0.279 1e-94
P06213 1382 Insulin receptor OS=Homo yes N/A 0.855 0.604 0.280 1e-93
P15127 1383 Insulin receptor OS=Rattu yes N/A 0.884 0.624 0.276 5e-92
Q64716 1300 Insulin receptor-related no N/A 0.857 0.643 0.282 6e-90
O02466 1363 Insulin-like peptide rece N/A N/A 0.595 0.426 0.318 6e-90
Q9WTL4 1300 Insulin receptor-related no N/A 0.857 0.643 0.279 2e-89
P08069 1367 Insulin-like growth facto no N/A 0.855 0.610 0.287 3e-89
P14616 1297 Insulin receptor-related no N/A 0.855 0.643 0.279 7e-88
>sp|Q9PVZ4|INSR_XENLA Insulin receptor OS=Xenopus laevis GN=insr PE=1 SV=1 Back     alignment and function desciption
 Score =  372 bits (955), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 285/998 (28%), Positives = 453/998 (45%), Gaps = 143/998 (14%)

Query: 57  DQTKEKVCTDIDIRNYVSSFDVLKDCTVVEGFVQINLIDNSTAQDFENITFPKLREITEY 116
           DQ+  K+C  +DIRN +S F +L+DCTV+EG +QI L+  S  ++F  + FPKL  IT+Y
Sbjct: 38  DQSDGKICYSMDIRNNISQFSMLEDCTVIEGHLQILLMFTSKPENFRGLRFPKLTTITDY 97

Query: 117 LSFYHVSGLKSIGKLFPNLAIIRGNTLIWDYTFSVFSMFNLQEIGLHRLTHIMKGTVVIL 176
           L  + V GL+S+  LFPNL +IRG  L ++Y   +F M + +EIGL+ L +I +G+V I 
Sbjct: 98  LLLFRVYGLESLKDLFPNLTVIRGTRLFFNYALVIFEMVHXKEIGLYNLMNITRGSVRIE 157

Query: 177 RNPDWKRI-TKKGSVVINDIK---------SKEACLQEGEPGARSGPEKC---------- 216
           +N +   + T   S++++ ++         +KE C  +  PG   G  KC          
Sbjct: 158 KNNELCYLSTIDWSIILDSVEDNYIELNRDNKEEC-GDVCPGTVKGKSKCKHTLVNGALV 216

Query: 217 EFYWSNNDCQ-----------LIKEIEECHPLCAGGCTGKR-AEDCFVCIGFIHDGHCLD 264
           E  W+ + CQ            + + + CHP C G C       +C  C  F ++G C+ 
Sbjct: 217 ERCWTQDHCQKVCPSDCKGSGCLPDGQCCHPECLGSCRKPNDPSECTACRHFQNEGVCVT 276

Query: 265 QCPPNLQGQVATLQRILYGGIRYSYMNRRCLTREECLNNKRVTTKNFPQNMRMSYSDKAK 324
            CP                   Y +   RC+    C             N R   S    
Sbjct: 277 ACPKG----------------SYQFQGWRCIDFNTCQE----------LNSRCQNSRDNS 310

Query: 325 WRPF---NGSCMEECPPGYNTTADETSCVPCPD-CPKVCKGVH----VKSIEVARSTKGC 376
             P+    G CM +CP GY   +   +C PC   CPKVC        + S+  A+  +GC
Sbjct: 311 CPPYVIHKGECMPDCPSGYIANSTTRTCTPCAGPCPKVCTIFQNVKTIDSVTSAQELRGC 370

Query: 377 TVINGSLGIQIQTGDSEVVHQELEKGLGMITNITGHLKISHSLPIQSLSFLKSLQSIHGE 436
           TVINGSL I ++ G++  +  ELE  LG+I  I+G+LKI  S  + SLSF + L+     
Sbjct: 371 TVINGSLIINLRGGNN--IATELEANLGLIEEISGYLKIRRSYALVSLSFFRKLR----- 423

Query: 437 REIIRGDTSESSVYSNYSLIVWDNPNLQELWGWSNLPDGQRPKFEIKKGKILFHDNPKLC 496
             +IRG+  E+  YS Y+L   DNP+L++LW W       +    I  GK+ FH NP+LC
Sbjct: 424 --LIRGEVLEAGNYSFYAL---DNPSLRQLWDW------HKHNLTIIHGKLFFHHNPRLC 472

Query: 497 LDKIYELINVTNITYDSDF-DVLKESNGDEFICGFSNLALVVLNKTD---VSIRFQLNEN 552
           L +I+++  VT      D  D+  ++NGD+  C   NL      KT    V +R+     
Sbjct: 473 LSQIHQMEEVTGTKGRQDKNDIATKTNGDQASCE-DNLLTFNFIKTSHDMVLLRWDAYWP 531

Query: 553 EKVPDNQRYVLFYMKADNGMYTDFDTVGSCSASGWKFKDINSKNKTVE---------VMN 603
               D   +++ Y +A     T+FD   +C ++ W   D+++  ++ +         + +
Sbjct: 532 PDYRDLLGFMVHYKEAPFQNVTEFDGQDACGSNSWTVVDMDAPERSADGKTQSPGCLLRS 591

Query: 604 LEPATEYAFFVKIYNSQRI------VRSNISLQTTLPTKPSIPYQFEVVRVNSSSVTLRW 657
           L+P T+YA FVK   S          +S I    T  T PS+P     V  ++S + L+W
Sbjct: 592 LKPWTQYAVFVKTLVSGSDEGRTYGAKSKIIYIRTNETIPSVPLDPFSVSNSTSQIILKW 651

Query: 658 GEPKHPHGILEKYVIKAYYQDYDKDYLDTRNYCVDKLRDLSDSTYAASHLMRFA---KTT 714
             P  P+G +  Y++    Q  D D  +  +YC   L+  S +    + +       +T 
Sbjct: 652 KPPSEPNGNVTHYLVYWQEQPEDSDLYEV-DYCNKGLKLPSRTWTPPTEIDENGNENQTE 710

Query: 715 RKPLKECCGKFPCDFDHESFQYMTSQMQLIQQCDNYIFKYL-------QYNDLHKAYGGD 767
              + +CC   PC       Q    +    +  +NY+   +       +  DL     G 
Sbjct: 711 HTSVNKCC---PCPKTEFQIQKEQDESAFRKTFENYLHNEVFIPRPVRKRRDLFGVANGT 767

Query: 768 LPS------LGNISS-RLPDREENDV----LYPETSYTMVGLGHFRSIVFTISACRKEQK 816
           LP       L N+SS R PD  E  +    ++ + S  + GL HF      I AC  E  
Sbjct: 768 LPDPVTAPPLFNVSSTRAPDEPEPKIYSQKVWFKESVLISGLKHFTGYRIEIHACNHELS 827

Query: 817 DKFLPYDPEEGRCSEETLVMSRTEVDHLADTIPADSLNFEMINASALRIRWHPPSRPNGI 876
                       CS    V +RT  +  AD +    + +E +  + + ++W  P  PNG+
Sbjct: 828 MG----------CSVAAYVNARTMPEATADKV-VGPITYEYVEPNIIHLKWQEPKDPNGL 876

Query: 877 IVAYNIEYKRESGGNSENMCRTRKDIDRDSGLYLYDYPAGSYLFRLRVVSLGGEGPWTSW 936
           IV Y + Y R  G      C ++K  + D G  L     G+Y  ++R  SL G G WT  
Sbjct: 877 IVLYEVHYSRVGGIEEVITCVSQKQYNTDKGGKLRVLTPGNYSVKIRATSLAGNGSWT-- 934

Query: 937 KPCVIESAETPMSVYVIVVVTGLVILFCMLAVILFLIL 974
           +    +  + P S  V ++   ++ +F +L V+++ ++
Sbjct: 935 EQAYFQVPDHPHSNIVKIITGPIIAVFLLLIVLVYCVV 972
Receptor tyrosine kinase which mediates actions of insulin. May be required for forelimb regeneration.
Xenopus laevis (taxid: 8355)
EC: 2EC: .EC: 7EC: .EC: 1EC: 0EC: .EC: 1
>sp|Q93105|INSR_AEDAE Insulin-like receptor OS=Aedes aegypti GN=InR PE=2 SV=2 Back     alignment and function description
>sp|P15208|INSR_MOUSE Insulin receptor OS=Mus musculus GN=Insr PE=1 SV=2 Back     alignment and function description
>sp|P06213|INSR_HUMAN Insulin receptor OS=Homo sapiens GN=INSR PE=1 SV=4 Back     alignment and function description
>sp|P15127|INSR_RAT Insulin receptor OS=Rattus norvegicus GN=Insr PE=1 SV=1 Back     alignment and function description
>sp|Q64716|INSRR_RAT Insulin receptor-related protein OS=Rattus norvegicus GN=Insrr PE=1 SV=3 Back     alignment and function description
>sp|O02466|ILPR_BRALA Insulin-like peptide receptor OS=Branchiostoma lanceolatum PE=2 SV=1 Back     alignment and function description
>sp|Q9WTL4|INSRR_MOUSE Insulin receptor-related protein OS=Mus musculus GN=Insrr PE=1 SV=2 Back     alignment and function description
>sp|P08069|IGF1R_HUMAN Insulin-like growth factor 1 receptor OS=Homo sapiens GN=IGF1R PE=1 SV=1 Back     alignment and function description
>sp|P14616|INSRR_HUMAN Insulin receptor-related protein OS=Homo sapiens GN=INSRR PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query976
326370574 1702 insulin receptor-2 [Solenopsis invicta] 0.903 0.518 0.321 1e-122
350415393 1726 PREDICTED: insulin-like receptor-like [B 0.899 0.508 0.329 1e-122
350536827 1690 insulin-like receptor-like [Apis mellife 0.879 0.507 0.339 1e-121
340710432 1726 PREDICTED: insulin-like receptor-like [B 0.898 0.508 0.328 1e-121
332019946 1424 Insulin receptor [Acromyrmex echinatior] 0.863 0.591 0.306 1e-117
383852078 1526 PREDICTED: insulin-like receptor-like [M 0.886 0.566 0.321 1e-116
383848987 1415 PREDICTED: insulin-like peptide receptor 0.851 0.587 0.313 1e-115
328711046 1341 PREDICTED: insulin-like peptide receptor 0.884 0.643 0.314 1e-115
307171282 1088 Insulin receptor [Camponotus floridanus] 0.838 0.751 0.315 1e-115
307205426 1434 Insulin receptor [Harpegnathos saltator] 0.892 0.607 0.305 1e-115
>gi|326370574|gb|ADZ56366.1| insulin receptor-2 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  447 bits (1151), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 324/1007 (32%), Positives = 487/1007 (48%), Gaps = 125/1007 (12%)

Query: 50   VSGNSKFDQTKEKVCTDIDIRNYVSSFDVLKDCTVVEGFVQINLIDNSTAQDFENITFPK 109
             + N     ++ KVC  IDIRN V+ F  LK C VVEGFVQI+LID +   D+ N +FP+
Sbjct: 177  AANNIAIGPSRNKVCQSIDIRNNVNEFSKLKGCQVVEGFVQISLIDRAEPLDYANFSFPE 236

Query: 110  LREITEYLSFYHVSGLKSIGKLFPNLAIIRGNTLIWDYTFSVFSMFNLQEIGLHRLTHIM 169
            L EIT++L  Y V+GLK+IG+LFPNLA+IRGN+LI +Y    F M +LQEIGLH LT+I+
Sbjct: 237  LVEITDFLLLYRVNGLKTIGQLFPNLAVIRGNSLIMNYALMAFEMMHLQEIGLHSLTNIL 296

Query: 170  KGTVVILRNP--------DWKRITKKGS--VVINDIKSKEAC--LQEGEPGARSGPEKCE 217
            +G+V   +NP        DW  I K G+    I D K    C       P  ++ P++  
Sbjct: 297  RGSVHFEKNPMLCFVDTIDWDIIAKAGNGEHFIKDNKPSNGCPMCPRKCPTRQTKPDQ-N 355

Query: 218  FYWSNNDCQLI--KEIEE---------CHPLCAGGCTGKRAEDCFVCIGFIHDG-HCLDQ 265
              W+   CQ I  ++ E+         CHP C GGCTG  A DC VC   + +G  C D+
Sbjct: 356  LCWNVQHCQRICDRKCEDRACNSTGQCCHPFCLGGCTGPTANDCSVCRNVVINGKECKDR 415

Query: 266  CPPNLQGQVATLQRILYGGIRYSYMNRRCLTREECLNNKRVTTKNFPQNMRMSYSDKAKW 325
            CP                  +Y +MNRRC+   EC    +   KN  + ++     +  +
Sbjct: 416  CPRG----------------KYKFMNRRCIEEWECRQMPKSMYKNEDEMIK-----QHPY 454

Query: 326  RPFNGSCMEECPPGYNTTADE--TSCVPCP--DCPKVCKGVHVKSIEVARSTKGCTVING 381
            +PFN SC+ ECP GY  + D    SC  C    C + C    V SIE A+  +GCT + G
Sbjct: 455  KPFNDSCVIECPAGYMESEDHGNVSCQKCEGRQCLRECSAAKVMSIETAQKLRGCTHLTG 514

Query: 382  SLGIQIQTGDSEVVHQELEKGLGMITNITGHLKISHSLPIQSLSFLKSLQSIHGEREIIR 441
            SL I+I+ G + V  +ELE  LGMI  I G L+I  S P+ SL+FLK+L+       +IR
Sbjct: 515  SLEIEIRGGKNIV--KELEDNLGMIEEIDGSLRIVRSFPLISLNFLKNLR-------VIR 565

Query: 442  GDTSESSVYSNYSLIVWDNPNLQELWGWSNLPDGQRPKFEIKKGKILFHDNPKLCLDKIY 501
            G+ SES     YSL V DN NLQELW W N         +    ++ FH NPKLCL +I 
Sbjct: 566  GNDSESK----YSLSVLDNQNLQELWDW-NTHKNITILAKTGPARLFFHFNPKLCLHEIE 620

Query: 502  ELINVTNITYDSDFDVLKESNGDEFICGFSNLALVVLNKTDVS--IRFQLNENEKVPDNQ 559
            +L    N+   +D DV   SNGD+  C  + L   V  +T V   I++   ++  +    
Sbjct: 621  KLRLKANLEEFTDHDVASNSNGDKIACNVTELETRVTWRTPVGAIIKWTAFKHHDIRSLL 680

Query: 560  RYVLFYMKADNGMYTDFDTVGSCSASGWKFKDINSKNKTV------------------EV 601
             YV+++++A N   T +D   +C   GW+ +D+++ + T+                   +
Sbjct: 681  GYVVYFIEAPNQNITMYDGRDACGGDGWRVEDVSADSTTLFANQTQNSTHTDLQEHLHIL 740

Query: 602  MNLEPATEYAFFVKIY---NSQRIVRSNISLQTTLPTKPSIPYQFEVVRVNSSSVTLRWG 658
              L+P T+YA++VK Y     +   +S I+  TT P  P  P        +S+ + + W 
Sbjct: 741  TQLKPYTQYAYYVKTYTIATERSGAQSKITYFTTKPDAPGSPRALSTWSNSSNELVISWF 800

Query: 659  EPKHPHGILEKYVIKAYYQDYDKDYLDTRNYCVDKLRDLSDSTYAASHLM---------- 708
             P   +G L  Y I   ++  D+ ++D RNYC + +  L   +                 
Sbjct: 801  PPVKKNGNLTHYRIVGRWEPDDQSFIDQRNYCDEPMPLLETKSPEEVVAEEEKKYFELEK 860

Query: 709  RFAKTTRKPLKECCGKFPCDFDHE-----SFQYMTSQMQLIQQCDNYIFKYLQYNDLHKA 763
             F+KT      +         + E     +F+        I++  +   ++     L  A
Sbjct: 861  EFSKTDSCLCSDRVVTDQSMLEKEVSSSIAFENALHNQVYIKRAQSRRRRHTDSEMLIAA 920

Query: 764  YGGDLPSLGNISS--RLPDREEN------DVLYPETSYTMV--GLGHFRSIVFTISACRK 813
                 P+   + +   + D+ EN      + + P T+ T V   L HF +    + ACR+
Sbjct: 921  QLAKEPTFKKVQNWESISDKMENGSVLVFERIIPSTNLTFVMRNLRHFTAYNIEVQACRE 980

Query: 814  EQKDKFLPYDPEEGRCSEETLVMSRTEVDHLADTIPADSLNF----EMINASALRIRWHP 869
                +    D +   CS +++   RT     AD IP ++       E  + + + + W  
Sbjct: 981  LDASEL--NDTKSKNCSMKSMKTYRTLAMENADNIPPNTFTLTKSGENNSLTIITLSWDE 1038

Query: 870  PSRPNGIIVAYNIEYKRESGGNSEN--MCRTRKDIDRDSGLY-LYDYPAGSYLFRLRVVS 926
            P +PNG+IV Y IEYKR    N +   +C TR+D  +    Y L + PAG+Y  ++R  S
Sbjct: 1039 PPQPNGLIVTYQIEYKRIDIQNIQATVVCITRRDFVKLGNRYTLKELPAGNYSIKVRATS 1098

Query: 927  LGGEGPWTSWKPCVIESAETPMSVYVIVVVTGLVILFCMLAVILFLI 973
            L G G +T  K   IE ++T +S + IV+ +   I+  M  VI+F I
Sbjct: 1099 LAGNGAYTEVKYFSIEESDT-LSEFWIVICS---IIGVMTIVIIFFI 1141

Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|350415393|ref|XP_003490625.1| PREDICTED: insulin-like receptor-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|350536827|ref|NP_001233596.1| insulin-like receptor-like [Apis mellifera] gi|347658908|tpg|DAA34971.1| TPA_exp: insulin receptor 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|340710432|ref|XP_003393794.1| PREDICTED: insulin-like receptor-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|332019946|gb|EGI60406.1| Insulin receptor [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|383852078|ref|XP_003701556.1| PREDICTED: insulin-like receptor-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|383848987|ref|XP_003700128.1| PREDICTED: insulin-like peptide receptor-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328711046|ref|XP_001942660.2| PREDICTED: insulin-like peptide receptor-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|307171282|gb|EFN63207.1| Insulin receptor [Camponotus floridanus] Back     alignment and taxonomy information
>gi|307205426|gb|EFN83767.1| Insulin receptor [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query976
UNIPROTKB|O73798 1358 igf1r "Insulin-like growth fac 0.606 0.435 0.323 5.7e-86
ZFIN|ZDB-GENE-020503-4 1348 insrb "insulin receptor b" [Da 0.869 0.629 0.288 2.7e-83
UNIPROTKB|C9J5X1 1366 IGF1R "Insulin-like growth fac 0.648 0.463 0.310 2.9e-77
UNIPROTKB|P08069 1367 IGF1R "Insulin-like growth fac 0.648 0.463 0.310 2.9e-77
UNIPROTKB|E2RPM8 1373 INSR "Tyrosine-protein kinase 0.618 0.439 0.3 9.7e-76
UNIPROTKB|F1LQ13 1383 Insr "Tyrosine-protein kinase 0.638 0.450 0.294 1.4e-75
UNIPROTKB|P06213 1382 INSR "Insulin receptor" [Homo 0.615 0.434 0.302 1.5e-75
UNIPROTKB|F1LPL6 1369 Insr "Tyrosine-protein kinase 0.615 0.439 0.298 1.8e-75
UNIPROTKB|F1MV64 1382 INSR "Tyrosine-protein kinase 0.618 0.437 0.301 1.4e-74
UNIPROTKB|Q93105 1393 InR "Insulin-like receptor" [A 0.413 0.290 0.305 1.8e-74
UNIPROTKB|O73798 igf1r "Insulin-like growth factor 1 receptor" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
 Score = 718 (257.8 bits), Expect = 5.7e-86, Sum P(2) = 5.7e-86
 Identities = 219/678 (32%), Positives = 324/678 (47%)

Query:    62 KVC-TDIDIRNYVSSFDVLKDCTVVEGFVQINLIDNSTAQDFENITFPKLREITEYLSFY 120
             KVC  ++DIRN VS    L+DC V+EG++QI LI N+ A+DF N+ FP L  IT+YL  +
Sbjct:    26 KVCGPNMDIRNDVSELKQLRDCVVIEGYLQILLISNAKAEDFRNLRFPNLTVITDYLLLF 85

Query:   121 HVSGLKSIGKLFPNLAIIRGNTLIWDYTFSVFSMFNLQEIGLHRLTHIMKGTVVILRNP- 179
              VSGL S+  LFPNL +IRG  L ++Y   +F M +L+EIGL+ L +I +G V I +N  
Sbjct:    86 RVSGLVSLSNLFPNLTVIRGRVLFYNYALVIFEMTDLKEIGLYNLRNITRGAVRIEKNSE 145

Query:   180 -------DWKRITKK--GSVVINDIKSKEACLQEGEPGARSGPEKCEFYWSNND-CQLIK 229
                    DW  +      + ++ +   KE C+    PGAR   + CE    NN+      
Sbjct:   146 LCYVSTVDWSLVLDAVYNNYIVGNKPPKE-CVDLC-PGAREKMQICEKSSINNEFADRCW 203

Query:   230 EIEECHPLCAGGCTGKRA-EDCFVCIGFIHDGHCLDQC--PPNLQGQVATLQRILYGGI- 285
               E C  +C   C GKRA  D   C    H   CL  C  P N    VA      Y G  
Sbjct:   204 SDEHCQKVCPSVC-GKRACSDNNECC---HP-ECLGSCTAPDNDTACVAC-HHYFYEGRC 257

Query:   286 -------RYSYMNRRCLTREECLNNKRVTTKNFPQNMRMSYSDKAKWRPFNGSCMEECPP 338
                     Y +   RC+TRE C              M +       +    G C+ ECP 
Sbjct:   258 VPTCPSNTYKFEGWRCITREVCAK------------MHIWIHSTIPFIIHKGECVYECPS 305

Query:   339 GY--NTTADETSXXXXXX--XXXXXXGVHVKSIEVARSTKGCTVINGSLGIQIQTGDSEV 394
             GY  N +   T                  + S+  A+  +GCTV+ G+L + I+ G +  
Sbjct:   306 GYMLNKSQSMTCSPCEGPCPKICEEKMKTIDSVTSAQMLEGCTVLKGNLQLNIRKGQN-- 363

Query:   395 VHQELEKGLGMITNITGHLKISHSLPIQSLSFLKSLQSIHGEREIIRGDTSESSVYSNYS 454
             +  ELE  LG+I  +TG++KI HS  + SLSFLKSL+ I GE ++            NYS
Sbjct:   364 IAAELENFLGLIETVTGYVKIRHSHALVSLSFLKSLRYILGEEQMP----------GNYS 413

Query:   455 LIVWDNPNLQELWGWSNLPDGQRPKFEIKKGKILFHDNPKLCLDKIYELINVTNIT-YDS 513
               V+DN NLQ+LW WS      +    IK+GKI F  N KLC  +IY +  VT      +
Sbjct:   414 FYVFDNNNLQQLWDWS------KHNLTIKEGKIRFAFNSKLCASEIYRMEEVTGTKGRQA 467

Query:   514 DFDVLKESNGDEFICGFSNLALVVLNKTDVSIRFQLN-ENEKVPDNQ---RYVLFYMKAD 569
             + D+   +NG+   C   +  L   +++ +  R +L  E  + PD +    + ++Y +A 
Sbjct:   468 EEDISLSTNGNMASC--ESHVLNFTSRSKIKNRIKLTWERYRPPDYRDLISFTVYYKEAP 525

Query:   570 NGMYTDFDTVGSCSASGWKFKDIN---SKNKTVEVM--NLEPATEYAFFVK-----IYNS 619
                 T++D   +C ++ W   D++   SK     ++   L+P T+YA +VK     +  +
Sbjct:   526 FRNVTEYDGQDACGSNSWNMVDVDLPASKESDPGILLQGLKPWTQYAIYVKAITLTMLEN 585

Query:   620 QRI--VRSNISLQTTLPTKPSIPYQFEVVRVNSSSVTLRWGEPKHPHGILEKYVIKAYYQ 677
             + I   +S I    T    PSIP        +SS + ++W  P  P+G L  Y+++   Q
Sbjct:   586 RHIHGAKSKIIYMRTDAAVPSIPQDMISASNSSSQLVVKWNPPSLPNGNLSYYIVRWQQQ 645

Query:   678 DYDKDYLDTRNYCV-DKL 694
               D+ +L   NYC  DK+
Sbjct:   646 PQDR-HLYQYNYCFKDKV 662
GO:0001556 "oocyte maturation" evidence=IEP
GO:0004713 "protein tyrosine kinase activity" evidence=ISS;IDA
GO:0005010 "insulin-like growth factor-activated receptor activity" evidence=IDA
GO:0005520 "insulin-like growth factor binding" evidence=ISS;IDA
GO:0005887 "integral to plasma membrane" evidence=IC
GO:0043548 "phosphatidylinositol 3-kinase binding" evidence=ISS
GO:0043560 "insulin receptor substrate binding" evidence=ISS
GO:0046777 "protein autophosphorylation" evidence=IDA
GO:0048009 "insulin-like growth factor receptor signaling pathway" evidence=IDA
GO:0051262 "protein tetramerization" evidence=ISS
ZFIN|ZDB-GENE-020503-4 insrb "insulin receptor b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|C9J5X1 IGF1R "Insulin-like growth factor 1 receptor" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P08069 IGF1R "Insulin-like growth factor 1 receptor" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RPM8 INSR "Tyrosine-protein kinase receptor" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1LQ13 Insr "Tyrosine-protein kinase receptor" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P06213 INSR "Insulin receptor" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1LPL6 Insr "Tyrosine-protein kinase receptor" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MV64 INSR "Tyrosine-protein kinase receptor" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q93105 InR "Insulin-like receptor" [Aedes aegypti (taxid:7159)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query976
pfam00757143 pfam00757, Furin-like, Furin-like cysteine rich re 7e-27
pfam01030112 pfam01030, Recep_L_domain, Receptor L domain 1e-23
pfam01030112 pfam01030, Recep_L_domain, Receptor L domain 4e-21
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 6e-10
cd0006449 cd00064, FU, Furin-like repeats 1e-06
pfam0004184 pfam00041, fn3, Fibronectin type III domain 3e-06
smart0026145 smart00261, FU, Furin-like repeats 9e-06
smart0006083 smart00060, FN3, Fibronectin type 3 domain 3e-05
cd0006393 cd00063, FN3, Fibronectin type 3 domain; One of th 0.001
>gnl|CDD|216103 pfam00757, Furin-like, Furin-like cysteine rich region Back     alignment and domain information 
 Score =  106 bits (267), Expect = 7e-27
 Identities = 49/169 (28%), Positives = 60/169 (35%), Gaps = 49/169 (28%)

Query: 207 PGARSGPEKCEFY---WSNNDCQLI----------KEIEECHPLCAGGCTGKRAEDCFVC 253
           PG       C      W +  CQ +          K  E CH  C GGCTG    DC  C
Sbjct: 9   PGTCEKCHPCCNNGSCWGSGHCQKVCPEQCKGRCTKPGECCHEQCLGGCTGPNDSDCLAC 68

Query: 254 IGFIHDGHCLDQCPPNLQGQVATLQRILYGGIRYSYMNRRCLTREECLNNKRVTTKNFPQ 313
             F  +G C+DQCPP                  Y +   RC+T +EC             
Sbjct: 69  RHFNDEGTCVDQCPPG----------------TYQF-GARCVTAKEC------------- 98

Query: 314 NMRMSYSDKAKWRPFNGSCMEECPPGYNTTADET-SCVPCPD-CPKVCK 360
                          NG C+ ECP GY    + +  C PC   CPKVC+
Sbjct: 99  ----PKPGYNPLVIHNGECVRECPSGYTEVENNSRKCEPCEGLCPKVCE 143

Length = 143
>gnl|CDD|216254 pfam01030, Recep_L_domain, Receptor L domain Back     alignment and domain information
>gnl|CDD|216254 pfam01030, Recep_L_domain, Receptor L domain Back     alignment and domain information
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>gnl|CDD|238021 cd00064, FU, Furin-like repeats Back     alignment and domain information
>gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain Back     alignment and domain information
>gnl|CDD|214589 smart00261, FU, Furin-like repeats Back     alignment and domain information
>gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain Back     alignment and domain information
>gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 976
KOG4258|consensus1025 100.0
KOG1025|consensus 1177 100.0
KOG1025|consensus1177 100.0
KOG4258|consensus1025 100.0
KOG4221|consensus 1381 99.96
KOG3513|consensus 1051 99.95
KOG4221|consensus 1381 99.94
PF00757149 Furin-like: Furin-like cysteine rich region; Inter 99.88
KOG3513|consensus1051 99.84
KOG0196|consensus 996 99.83
PF14843132 GF_recep_IV: Growth factor receptor domain IV; PDB 99.78
PF01030112 Recep_L_domain: Receptor L domain; InterPro: IPR00 99.68
PF01030112 Recep_L_domain: Receptor L domain; InterPro: IPR00 99.65
KOG0196|consensus 996 99.6
KOG4222|consensus 1281 99.54
PF14843132 GF_recep_IV: Growth factor receptor domain IV; PDB 99.12
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 98.89
PF0004185 fn3: Fibronectin type III domain; InterPro: IPR003 98.62
KOG4222|consensus 1281 98.57
KOG4802|consensus516 98.45
cd0006393 FN3 Fibronectin type 3 domain; One of three types 98.29
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 98.16
KOG4802|consensus 516 97.88
PF00757149 Furin-like: Furin-like cysteine rich region; Inter 97.82
cd0006449 FU Furin-like repeats. Cysteine rich region. Exact 97.74
smart0006083 FN3 Fibronectin type 3 domain. One of three types 97.74
cd0006393 FN3 Fibronectin type 3 domain; One of three types 97.62
cd0006449 FU Furin-like repeats. Cysteine rich region. Exact 97.44
KOG3632|consensus 1335 97.09
PF10179300 DUF2369: Uncharacterised conserved protein (DUF236 96.96
smart0026146 FU Furin-like repeats. 96.85
smart0006083 FN3 Fibronectin type 3 domain. One of three types 96.79
smart0026146 FU Furin-like repeats. 96.77
PTZ00214800 high cysteine membrane protein Group 4; Provisiona 96.67
KOG3632|consensus 1335 96.61
PTZ00214800 high cysteine membrane protein Group 4; Provisiona 96.39
KOG4152|consensus830 95.52
KOG4260|consensus350 95.4
KOG4367|consensus 699 95.34
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 95.28
KOG4152|consensus830 94.92
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 94.89
KOG4806|consensus454 94.42
PF09294106 Interfer-bind: Interferon-alpha/beta receptor, fib 94.34
KOG4367|consensus699 92.63
PF01108107 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH 92.58
COG3401343 Fibronectin type 3 domain-containing protein [Gene 91.24
PF0749566 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi 91.06
COG4733 952 Phage-related protein, tail component [Function un 89.7
PF03302397 VSP: Giardia variant-specific surface protein; Int 88.05
COG3401343 Fibronectin type 3 domain-containing protein [Gene 84.49
PF03302397 VSP: Giardia variant-specific surface protein; Int 83.11
>KOG4258|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.2e-141  Score=1188.46  Aligned_cols=837  Identities=33%  Similarity=0.590  Sum_probs=721.7

Q ss_pred             CcccccCcccccccccccccCCcEEEeCceEEEEecCCC-ccCcccCCCCCeEEEccEEEEEeecCCCcccccCCCceEE
Q psy2190          60 KEKVCTDIDIRNYVSSFDVLKDCTVVEGFVQINLIDNST-AQDFENITFPKLREITEYLSFYHVSGLKSIGKLFPNLAII  138 (976)
Q Consensus        60 c~k~C~~~~~~~~~~~~~~~~~Ct~i~G~l~i~~~~~~~-~~~~~~~sf~~i~eItG~l~i~~~~~l~sl~~~f~nL~~I  138 (976)
                      |...|.|+++++...+++++.|||+|+|.|.|+++.... ++++.+++|++|+|||+||+++++.+|.||.++||||+||
T Consensus        30 ~gei~~g~dirnk~~~l~~L~NCTvVeG~l~I~lv~k~~~~~~f~~~sfP~LteITdyLllfrv~GL~sL~dlFPnLtVI  109 (1025)
T KOG4258|consen   30 SGEITPGIDIRNKCKNLHRLENCTVVEGHLMILLVFKTQRGEDFRDYSFPKLTEITDYLLLFRVYGLESLRDLFPNLTVI  109 (1025)
T ss_pred             cCCcCcCcchhhhHHhhhhhcCceEEeeEEEEEEEEeccccccchhccCcchheeeeeEEEEEeechhhHHHhCCceEEE
Confidence            445567999999999999999999999999999986654 5788899999999999999999999999999999999999


Q ss_pred             eccccccceEEEEEecCcceEecccccceeeeeeEEEeeCc--------cchhcccc--CcEEEccCcC-cccccCCCCC
Q psy2190         139 RGNTLIWDYTFSVFSMFNLQEIGLHRLTHIMKGTVVILRNP--------DWKRITKK--GSVVINDIKS-KEACLQEGEP  207 (976)
Q Consensus       139 ~g~~l~~~~~l~i~~n~~l~~lgl~~L~~i~~g~v~i~~N~--------~w~~i~~~--~~~~~~~n~~-~~~C~~~~C~  207 (976)
                      ||+.||.+|||+|++|++|++|||++|..|.+|.|+|..||        +|..|+.+  ++. |..|++ ..+|.+. ||
T Consensus       110 RG~rLF~nYALvI~em~~L~elgL~~L~~I~rG~VRIe~N~~LCyl~TVDW~~L~~s~~~nh-iv~n~~~~~eC~~v-Cp  187 (1025)
T KOG4258|consen  110 RGRRLFLNYALVIFEMPNLRELGLPKLVAIQRGAVRIEKNPKLCYLSTVDWSLLLDSVGNNH-IVLNKKNPEECGDV-CP  187 (1025)
T ss_pred             ccceehhceeEEEEecCchHHhchHHHHhhhcCcEEeccCcceeEEeeecHHHhcCccccce-EEecCCCccccccc-CC
Confidence            99999999999999999999999999999999999999999        99999987  444 344443 3899977 98


Q ss_pred             CC-------CC----CCCCCCCCCCCCcccccCCC---------Cc-ccccccCccCCCCC-CccccccceeecCccccc
Q psy2190         208 GA-------RS----GPEKCEFYWSNNDCQLIKEI---------EE-CHPLCAGGCTGKRA-EDCFVCIGFIHDGHCLDQ  265 (976)
Q Consensus       208 ~~-------~~----~~~~~~~Cw~~~~Cq~~C~~---------~~-C~~~C~~~C~g~~~-~~C~~C~~~~~~~~Cv~~  265 (976)
                      +.       |.    ++.....||+..+||++||.         ++ ||++|+|||..|+. +.|.+|+++++.|.||++
T Consensus       188 g~s~~~~~~~~kt~~~~~~~~rCWt~~~CQK~Cp~~~g~gC~ang~cCH~eClGgC~~~~dptaC~aCr~~y~~G~CV~~  267 (1025)
T KOG4258|consen  188 GTSSEKEFICNKTTINGEVTYRCWTNSHCQKSCPENCGNGCTANGECCHEECLGGCSQPNDPTACVACRGLYDDGVCVEA  267 (1025)
T ss_pred             ccccccccCCcceeeccceeeEecCCCchhccCccccccCcccccccccHhhccCcCCCCChhHhHHhhccccCCceecc
Confidence            72       11    45556679999999999996         56 99999999999987 799999999999999999


Q ss_pred             ccccccCCccceeeeecCceeeeccCccccccccccCCCCCccccCCCCCCcccCCCCcccccCCcccccCCCCcccCCC
Q psy2190         266 CPPNLQGQVATLQRILYGGIRYSYMNRRCLTREECLNNKRVTTKNFPQNMRMSYSDKAKWRPFNGSCMEECPPGYNTTAD  345 (976)
Q Consensus       266 Cp~~~~~~~~~~~~~~~~~~~y~~~~~~C~~~~~C~~~~~~~tC~gp~~~~~~C~~c~~~~~~~~~Cv~~Cp~g~~~~~~  345 (976)
                      ||+++                |.++++||+++++|.++++   |.-+..         .-..++++|+.+||+||..+..
T Consensus       268 Cp~~~----------------Y~~e~~RCvt~~~C~~l~~---~~~~~i---------~G~~~~~~Cv~~CPsGy~~N~~  319 (1025)
T KOG4258|consen  268 CPPDY----------------YLFENWRCVTREECALLHS---LSNSVI---------SGVIHAGQCVAKCPSGYKRNSS  319 (1025)
T ss_pred             CCcch----------------hhhccceeccHHHHHHhcC---cccccc---------cceeccccchhhCCCcceecCc
Confidence            99999                9999999999999997664   111111         1123678999999999998877


Q ss_pred             CCCcccCC-CCCCCCC-c-ceeeccccccccCCCeEEcCceEEEEecCCCchhHHHHHHhhccceeeeeEEEEEeecCcc
Q psy2190         346 ETSCVPCP-DCPKVCK-G-VHVKSIEVARSTKGCTVINGSLGIQIQTGDSEVVHQELEKGLGMITNITGHLKISHSLPIQ  422 (976)
Q Consensus       346 ~~~C~~C~-~C~~~C~-g-~~~~~~~~~~~~~~C~~i~G~l~i~~~~g~~~~~~~~l~~~l~~i~~I~G~L~i~~s~~l~  422 (976)
                      ...|.+|. .|+++|. | .+|+|+.+|+.++||++|+|+|+|.|+.|  .++++||+..|+.|++|+|||+|.+|.+|.
T Consensus       320 ~~~C~~C~g~C~~vC~~~~~tIds~~~Aq~LrgC~iinGsL~I~IR~~--~n~a~eLe~~l~~i~eItGylKVrhS~~Lv  397 (1025)
T KOG4258|consen  320 SSECVKCEGPCPKVCEPGTKTIDSVADAQNLRGCTIINGSLTINIRNG--NNIASELENALGLIEEITGYLKVRHSSALV  397 (1025)
T ss_pred             ccceeccCCCCcceeccCceEecchhhhHHhcCceEEcceEEEEEcCC--CchHHHHHHHhhhhheeeeeEEEEecchhh
Confidence            89999999 9999998 5 57999999999999999999999999998  899999999999999999999999999999


Q ss_pred             ccccccccceecceeeeeeCCcccCCccCceEEEEEeCCCcccccCcCCCCCCCCCceeEecceEEEecCcccchhhhcc
Q psy2190         423 SLSFLKSLQSIHGEREIIRGDTSESSVYSNYSLIVWDNPNLQELWGWSNLPDGQRPKFEIKKGKILFHDNPKLCLDKIYE  502 (976)
Q Consensus       423 ~l~fl~nL~~I~g~~~~~~~~~~~~~~~~~~~l~i~~n~~L~~l~~~~~~~~~~~~~~~i~~g~v~~~~N~~Lc~~~~~~  502 (976)
                      ||+||+|||.|+|+.|          .+++|+|+|+||+||++||+|+       ..++|..|+++||+||+||+.+|.+
T Consensus       398 SL~FlrNLr~IrGd~l----------~~~~Ys~yv~dN~nL~qLwd~~-------~~Lti~~G~lffh~NpkLC~~~I~q  460 (1025)
T KOG4258|consen  398 SLSFLRNLRLIRGDPL----------EEGNYSFYVLDNQNLQQLWDWS-------HQLTIMRGKLFFHFNPKLCLEEIHQ  460 (1025)
T ss_pred             hHHHHhhHHHhccchh----------hcCceEEEEecCcCHHhcCCcc-------ceeEEecceEEEecChHHHHHHHHH
Confidence            9999999999999999          9999999999999999999997       3499999999999999999999999


Q ss_pred             ceeccccccC-CccccccccCCCcccccceeeeE---EEeccceEEEEeeccCCCCCCCc---eeEEEEEEEcCCCCccc
Q psy2190         503 LINVTNITYD-SDFDVLKESNGDEFICGFSNLAL---VVLNKTDVSIRFQLNENEKVPDN---QRYVLFYMKADNGMYTD  575 (976)
Q Consensus       503 ~~~~~~~~~~-~~~~v~~~sNg~~~~C~~~~L~v---~vs~~si~~LsW~~~p~~~~~d~---~gY~v~y~~~~~~n~t~  575 (976)
                      ++.++++.++ .+.|++..+||+++.|+...|++   .++.++|. |+|.  ++++ .|.   +||.++|+++|.+|+|+
T Consensus       461 le~~~~t~~~~~~~dis~~TNGera~Ce~~~l~~~~~~~~~dsi~-lrW~--~~~~-~d~r~llg~~~~yKEaP~qNvT~  536 (1025)
T KOG4258|consen  461 LEEVLGTKGRQSKADISLRTNGERAICEDLVLQFSSTVTSADSIL-LRWE--RYQP-PDMRDLLGFLLHYKEAPFQNVTE  536 (1025)
T ss_pred             HHHhhCCCCCccccccCccCCCceeecccceeeeeeEEeecceeE-EEec--ccCC-cchhhhheeeEeeccCCccccce
Confidence            9999999887 78899999999999999999998   78889999 9999  8888 666   99999999999999999


Q ss_pred             ccCCCccCCCCcEEEecCCC--------CceEEeeCCccCceEEEEEEEEeC-----CCCCCCCeEEEecCCCCCCCCce
Q psy2190         576 FDTVGSCSASGWKFKDINSK--------NKTVEVMNLEPATEYAFFVKIYNS-----QRIVRSNISLQTTLPTKPSIPYQ  642 (976)
Q Consensus       576 ~~~~~~c~~~~W~~~~v~~~--------~~~~~l~~L~P~T~Y~~~V~a~n~-----g~g~~S~~~~~~T~~~~Ps~P~~  642 (976)
                      ++|+++|++++|.+.++..+        ...+.+.+|+|||+|+++|++.+.     ...+.|++.+++|.++.|++|..
T Consensus       537 ~dg~~aCg~~~W~~~~v~~~~~~p~~~~~~~~~l~~LkP~TqYAvfVkT~t~t~~~~~~~A~S~I~YvqT~~~~PspPl~  616 (1025)
T KOG4258|consen  537 EDGRDACGSNSWNVVDVDPPDLIPNDGTHPGFLLDGLKPWTQYAVFVKTLTVTEAHEAYEAKSKIGYVQTLPDIPSPPLD  616 (1025)
T ss_pred             ecCccccccCcceEEeccCCcCCCccccccceehhcCCccceeEEEEeeeehhhhccccccccceEEEEecCCCCCCcch
Confidence            99999999999999988765        346789999999999999999975     34489999999999999999999


Q ss_pred             eEEEEecCcEEEEEecCCCCCCCceeEEEEEEEE-ecCcCcccccccccccc--ccCCCCCcchhccccccccccCCCCc
Q psy2190         643 FEVVRVNSSSVTLRWGEPKHPHGILEKYVIKAYY-QDYDKDYLDTRNYCVDK--LRDLSDSTYAASHLMRFAKTTRKPLK  719 (976)
Q Consensus       643 l~~~~~s~tsi~vsW~pP~~~nG~I~~Y~V~~~~-~~~~~~~~~~~~~c~~~--~~~~~~~~~~~~~~~~~~~~~~~~~~  719 (976)
                      +-..+.+++.|.|+|+||..|||.|++|.|  .| ++.++.++.++|||++.  +|.+.+.. .++.++..      ...
T Consensus       617 ~ls~snsSsqi~l~W~pP~~pNG~lt~Ylv--~wer~~~~~yl~~~nYC~~~~k~p~~~~~p-~~~~ed~d------~~~  687 (1025)
T KOG4258|consen  617 VLSKSNSSSQILLKWKPPSQPNGNLTHYLV--VWERQAEDGYLEQRNYCHKGLKLPIRADLP-SFDSEDMD------PLL  687 (1025)
T ss_pred             hhhccCcchheeEEecCCCCCCCceeEEEE--EEEeccCCchHHHhccccccccccccccCC-CCchhhcc------hhh
Confidence            999999999999999999999999999999  99 88888999999999983  44443332 11111111      011


Q ss_pred             ccC--CCCCCCCC-cc--------chhhhcccchhccccccceEEecc-cCCcccccCCCCCCCCcc-------------
Q psy2190         720 ECC--GKFPCDFD-HE--------SFQYMTSQMQLIQQCDNYIFKYLQ-YNDLHKAYGGDLPSLGNI-------------  774 (976)
Q Consensus       720 ~~~--~~~~c~c~-~~--------~~~~~~~~~~fe~~~~~~v~~~~~-~~~~~~r~v~~~~~~~~~-------------  774 (976)
                      +.+  ..+||.|| .+        ++.+++.   |||++++.+++  + ++.++++++..+.+....             
T Consensus       688 e~e~~~~~Cc~c~~~~~~~~~e~eea~~~~~---FEd~L~n~i~v--pr~~~~krk~l~~~~n~t~~~~~~~~~~p~t~~  762 (1025)
T KOG4258|consen  688 EMEGHTGPCCSCPPTESYPQYEDEEASEQKT---FEDFLHNAIFV--PRRPDRKRKSLDDVENCTRLAPTRKAEEPTTPP  762 (1025)
T ss_pred             hhccCCCCCCCCCcccccCchhhHHHHHHHH---Hhhhccceeee--cccCcccccccccccceeeccccccccCCCCCC
Confidence            111  35688887 22        5566665   99999999999  8 577777777665432211             


Q ss_pred             -cCCCCCCCcce-e-eecccEEEEcCCccccEEEEEEEEEecCccCCCCCCCCCCCCCCccceeEEecccCCCCCCCCCC
Q psy2190         775 -SSRLPDREEND-V-LYPETSYTMVGLGHFRSIVFTISACRKEQKDKFLPYDPEEGRCSEETLVMSRTEVDHLADTIPAD  851 (976)
Q Consensus       775 -~~~~~~~~~~~-v-~~~~~~~~l~gL~p~T~Y~~~V~A~~~~~~~~~~~~~~~~~g~s~~~~~~~~T~~~~~~~~~p~~  851 (976)
                       +.+.+-...+. . .++.+++++.+|+|||.|.+.++||+.+         +...+||..+.+.+||++..++|.+|++
T Consensus       763 ~t~p~ei~e~~p~~~n~n~~~~vi~~Lrh~tlY~i~l~aCnh~---------~~~~~cS~a~~v~~RT~~~~~aD~i~g~  833 (1025)
T KOG4258|consen  763 TTAPTEIEEPKPRLENGNKESYVISGLRHFTLYRIDLQACNHA---------TPKCGCSHAAFVFARTMPTMGADDIPGP  833 (1025)
T ss_pred             CCCCccccccCcccccccchhhhhhccccchhhhhhHhhhccc---------ccccccchhhhhhhccccccccccCCCc
Confidence             11111111111 1 3688899999999999999999999998         5666789999999999999999999999


Q ss_pred             eeEEEe-cCCcEEEEEecCCCCCCCceEEEEEEEEEcCCCCcceeeeeeccccCCCcEEEeecCCceEEEEEEEEeCCCC
Q psy2190         852 SLNFEM-INASALRIRWHPPSRPNGIIVAYNIEYKRESGGNSENMCRTRKDIDRDSGLYLYDYPAGSYLFRLRVVSLGGE  930 (976)
Q Consensus       852 v~~~~~-~~~~sv~l~W~~P~~~NG~I~~Y~I~y~~~~~~~~~~~~v~~~~~~~~~~~~l~~L~pg~Y~~~V~A~t~aG~  930 (976)
                      +.++.. +. +++.|+|.+|..|||.|+.|.|+|++...+ ....|+++..+...+++.|..|.||.|+++|+|.+.||+
T Consensus       834 v~we~~~~~-~~v~l~w~EP~~pNGli~~Y~Vk~r~~~~e-t~v~cvsR~~~~k~~gv~l~~l~~G~y~~~vratSlaGn  911 (1025)
T KOG4258|consen  834 VTWECHIEM-NSVILRWLEPKEPNGLILNYEVKYRRNGDE-THVECVSRMDYAKAGGVYLKRLNPGNYSVRVRATSLAGN  911 (1025)
T ss_pred             eeEecccCc-ceEEEecCCCCCCCccEEEEEEEEeeccCc-chhhhhhhhhhhhcCceEEEecCCCcEEEEEEEEeeccC
Confidence            998887 44 899999999999999999999999987765 667799999999999999999999999999999999999


Q ss_pred             CCCCCcEeEEEecCCCCc--eEEEEehhhHHHHHHHHHheeeeEEE
Q psy2190         931 GPWTSWKPCVIESAETPM--SVYVIVVVTGLVILFCMLAVILFLIL  974 (976)
Q Consensus       931 G~~S~~~~~~~~~~~~~~--~~~iii~~v~~~lll~~l~~~l~~~~  974 (976)
                      |+|++++.|.+.+++...  ...|+.+++.+++|++++++.+|+|+
T Consensus       912 g~~t~~~~~~v~~~~~~~~~~~~ii~~~~~v~~l~~~~~~~~~~~~  957 (1025)
T KOG4258|consen  912 GSWTESVIFYVSDEDGLQAFIHEIIDGPLEVLLLLAVLAGGIYIYI  957 (1025)
T ss_pred             CCCcCCcceEEecCcccchhhHHHHhccHHHHHHHHHHhheeEEEE
Confidence            999999999999886332  34567777777777777777776654

>KOG1025|consensus Back     alignment and domain information
>KOG1025|consensus Back     alignment and domain information
>KOG4258|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>PF00757 Furin-like: Furin-like cysteine rich region; InterPro: IPR006211 The furin-like cysteine rich region has been found in a variety of proteins from eukaryotes that are involved in the mechanism of signal transduction by receptor tyrosine kinases, which involves receptor aggregation [] Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>PF14843 GF_recep_IV: Growth factor receptor domain IV; PDB: 1N8Z_C 1S78_A 3N85_A 2A91_A 3MZW_A 3BE1_A 3U2P_A 2AHX_B 3LTF_A 3I2T_A Back     alignment and domain information
>PF01030 Recep_L_domain: Receptor L domain; InterPro: IPR000494 The type-1 insulin-like growth-factor receptor (IGF-1R) and insulin receptor (IR) are closely related members of the tyrosine-kinase receptor superfamily IPR000719 from INTERPRO Back     alignment and domain information
>PF01030 Recep_L_domain: Receptor L domain; InterPro: IPR000494 The type-1 insulin-like growth-factor receptor (IGF-1R) and insulin receptor (IR) are closely related members of the tyrosine-kinase receptor superfamily IPR000719 from INTERPRO Back     alignment and domain information
>KOG0196|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>PF14843 GF_recep_IV: Growth factor receptor domain IV; PDB: 1N8Z_C 1S78_A 3N85_A 2A91_A 3MZW_A 3BE1_A 3U2P_A 2AHX_B 3LTF_A 3I2T_A Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>KOG4802|consensus Back     alignment and domain information
>PF00757 Furin-like: Furin-like cysteine rich region; InterPro: IPR006211 The furin-like cysteine rich region has been found in a variety of proteins from eukaryotes that are involved in the mechanism of signal transduction by receptor tyrosine kinases, which involves receptor aggregation [] Back     alignment and domain information
>cd00064 FU Furin-like repeats Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin Back     alignment and domain information
>cd00064 FU Furin-like repeats Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi Back     alignment and domain information
>smart00261 FU Furin-like repeats Back     alignment and domain information
>smart00060 FN3 Fibronectin type 3 domain Back     alignment and domain information
>smart00261 FU Furin-like repeats Back     alignment and domain information
>PTZ00214 high cysteine membrane protein Group 4; Provisional Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>PTZ00214 high cysteine membrane protein Group 4; Provisional Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>KOG4806|consensus Back     alignment and domain information
>PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators Back     alignment and domain information
>COG4733 Phage-related protein, tail component [Function unknown] Back     alignment and domain information
>PF03302 VSP: Giardia variant-specific surface protein; InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein) Back     alignment and domain information
>COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] Back     alignment and domain information
>PF03302 VSP: Giardia variant-specific surface protein; InterPro: IPR005127 During infection, the intestinal protozoan parasite Giardia lamblia virus undergoes continuous antigenic variation which is determined by diversification of the parasite's major surface antigen, named VSP (variant surface protein) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query976
2dtg_E897 Insulin Receptor (Ir) Ectodomain In Complex With Fa 1e-90
3loh_E917 Structure Of The Insulin Receptor Ectodomain, Inclu 2e-89
3w14_E609 Insulin Receptor Ectodomain Construct Comprising Do 6e-66
2hr7_A486 Insulin Receptor (Domains 1-3) Length = 486 7e-59
1igr_A478 Type 1 Insulin-Like Growth Factor Receptor (Domains 7e-58
3w11_E310 Insulin Receptor Ectodomain Construct Comprising Do 3e-31
3i2t_A551 Crystal Structure Of The Unliganded Drosophila Epid 4e-17
3ltf_A601 Crystal Structure Of The Drosophila Epidermal Growt 5e-17
3p11_A522 Anti-EgfrHER3 FAB DL11 IN COMPLEX WITH DOMAINS I-Ii 4e-15
1m6b_A621 Structure Of The Her3 (Erbb3) Extracellular Domain 1e-14
3u2p_A497 Crystal Structure Of N-Terminal Three Extracellular 5e-13
2ahx_A617 Crystal Structure Of Erbb4HER4 EXTRACELLULAR DOMAIN 5e-13
3u7u_A615 Crystal Structure Of Extracellular Region Of Human 6e-13
3u9u_E625 Crystal Structure Of Extracellular Domain Of Human 6e-13
1n8y_C608 Crystal Structure Of The Extracellular Region Of Ra 4e-12
2a91_A517 Crystal Structure Of Erbb2 Domains 1-3 Length = 517 5e-12
1n8z_C607 Crystal Structure Of Extracellular Domain Of Human 7e-12
1s78_A624 Insights Into Erbb Signaling From The Structure Of 7e-12
1mox_A501 Crystal Structure Of Human Epidermal Growth Factor 6e-11
1ivo_A622 Crystal Structure Of The Complex Of Human Epidermal 1e-10
3njp_A614 The Extracellular And Transmembrane Domain Interfac 1e-10
3qwq_A648 Crystal Structure Of The Extracellular Domain Of Th 1e-10
1nql_A624 Structure Of The Extracellular Domain Of Human Epid 1e-10
1yy9_A624 Structure Of The Extracellular Domain Of The Epider 1e-10
3b2v_A624 Crystal Structure Of The Extracellular Region Of Th 2e-10
3h3b_A194 Crystal Structure Of The Single-Chain Fv (Scfv) Fra 3e-04
3b2u_A214 Crystal Structure Of Isolated Domain Iii Of The Ext 6e-04
1p9m_A299 Crystal Structure Of The Hexameric Human Il-6/il-6 6e-04
1i1r_A303 Crystal Structure Of A CytokineRECEPTOR COMPLEX Len 7e-04
3p0y_A214 Anti-EgfrHER3 FAB DL11 IN COMPLEX WITH DOMAIN III O 7e-04
>pdb|2DTG|E Chain E, Insulin Receptor (Ir) Ectodomain In Complex With Fab's Length = 897 Back     alignment and structure 
Iteration: 1

 Score =  331 bits (849), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 270/940 (28%), Positives = 429/940 (45%), Gaps = 133/940 (14%)
Query: 62  KVCTDIDIRNYVSSFDVLKDCTVVEGFVQINLIDNSTAQDFENITFPKLREITEYLSFYH 121
           +VC  +DIRN ++    L++C+V+EG +QI L+  +  +DF +++FPKL  IT+YL  + 
Sbjct: 6   EVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFR 65
Query: 122 VSGLKSIGKLFPNLAIIRGNTLIWDYTFSVFSMFNLQEIGLHRLTHIMKGTVVILRNP-- 179
           V GL+S+  LFPNL +IRG+ L ++Y   +F M +L+E+GL+ L +I +G+V I +N   
Sbjct: 66  VYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNEL 125
Query: 180 ------DWKRI---TKKGSVVINDIKSKEACLQEGEPGARSGPEKC----------EFYW 220
                 DW RI    +   +V+N   ++E    +  PG   G   C          E  W
Sbjct: 126 CYLATIDWSRILDSVEDNHIVLNKDDNEEC--GDICPGTAKGKTNCPATVINGQFVERCW 183
Query: 221 SNNDCQLI-----------KEIEECHPLCAGGCTG-KRAEDCFVCIGFIHDGHCLDQCPP 268
           +++ CQ +            E   CH  C G C+       C  C  F  DG C++ CPP
Sbjct: 184 THSHCQKVCPTICKSHGCTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPP 243
Query: 269 NLQGQVATLQRILYGGIRYSYMNRRCLTREECLNNKRVTTKNFPQNMRMSYSDKAKWRPF 328
                             Y + + RC+    C +       +  Q          ++   
Sbjct: 244 PY----------------YHFQDWRCVNFSFCQDLHHKCKNSRRQGCH-------QYVIH 280
Query: 329 NGSCMEECPPGYNTTADETSXXXXXXXXXXXXGVH-------VKSIEVARSTKGCTVING 381
           N  C+ ECP GY  T + ++              H       + S+  A+  +GCTVING
Sbjct: 281 NNKCIPECPSGY--TMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVING 338
Query: 382 SLGIQIQTGDSEVVHQELEKGLGMITNITGHLKISHSLPIQSLSFLKSLQSIHGEREIIR 441
           SL I I+ G++  +  ELE  LG+I  I+G+LKI  S  + SLSF + L+       +IR
Sbjct: 339 SLIINIRGGNN--LAAELEANLGLIEEISGYLKIRRSYALVSLSFFRKLR-------LIR 389
Query: 442 GDTSESSVYSNYSLIVWDNPNLQELWGWSNLPDGQRPKFEIKKGKILFHDNPKLCLDKIY 501
           G+T E   YS Y+L   DN NL++LW WS      +    I +GK+ FH NPKLCL +I+
Sbjct: 390 GETLEIGNYSFYAL---DNQNLRQLWDWS------KHNLTITQGKLFFHYNPKLCLSEIH 440
Query: 502 ELINVTNITYDSDF-DVLKESNGDEFICGFSNLALVVLNKT--DVSIRFQLNENEKVPDN 558
           ++  V+      +  D+  ++NGD+  C    L    +  +   + +R++        D 
Sbjct: 441 KMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSFDKILLRWEPYWPPDFRDL 500
Query: 559 QRYVLFYMKADNGMYTDFDTVGSCSASGWKFKDIN---------SKNKTVEVM-NLEPAT 608
             ++LFY +A     T+FD   +C ++ W   DI+         S+N    +M  L+P T
Sbjct: 501 LGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWT 560
Query: 609 EYAFFVK---IYNSQRI---VRSNISLQTTLPTKPSIPYQFEVVRVNSSSVTLRWGEPKH 662
           +YA FVK    ++ +R     +S+I    T  T PS+P     V  +SS + L+W  P  
Sbjct: 561 QYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSD 620
Query: 663 PHGILEKYVIKAYYQDYDKDYLDTRNYCVDKLRDLSDSTYAASHLMRFAKTTRKPLKECC 722
           P+G +  Y++    Q  D +  +  +YC+  L+ L   T++       ++   +   E  
Sbjct: 621 PNGNITHYLVFWERQAEDSELFEL-DYCLKGLK-LPSRTWSPPFESEDSQKHNQSEYE-- 676
Query: 723 GKFPCDFDHESFQYMTSQMQLIQQCDNYIFKYLQYNDLHKAYGGDLPS--------LGNI 774
                D   E      +  Q++++ +   F+    + LH       PS        +GN 
Sbjct: 677 -----DSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRPSRKRRSLGDVGNA 731
Query: 775 SSRLPDREENDVLYPETSYTMVGLGHFRSIVFTISACRKEQKDKFLPYDPEEGRCSEETL 834
            +    R    V+  E S  + GL HF      + AC ++         PEE RCS    
Sbjct: 732 GNNEEHRPFEKVVNKE-SLVISGLRHFTGYRIELQACNQDT--------PEE-RCSVAAY 781
Query: 835 VMSRTEVDHLADTIPADSLNFEMINASALRIRWHPPSRPNGIIVAYNIEYKRESGGNSEN 894
           V +RT  +  AD I    +  E+   + + + W  P  PNG+IV Y + Y+R  G    +
Sbjct: 782 VSARTMPEAKADDI-VGPVTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRR-YGDEELH 839
Query: 895 MCRTRKDIDRDSGLYLYDYPAGSYLFRLRVVSLGGEGPWT 934
           +C TRK    + G  L     G+Y  R+R  SL G G WT
Sbjct: 840 LCDTRKHFALERGCRLRGLSPGNYSVRIRATSLAGNGSWT 879
>pdb|3LOH|E Chain E, Structure Of The Insulin Receptor Ectodomain, Including Ct P Length = 917 Back     alignment and structure
>pdb|3W14|E Chain E, Insulin Receptor Ectodomain Construct Comprising Domains L1,cr,l2, Fniii-1 And Alphact Peptide In Complex With Bovine Insulin And Fab 83-14 Length = 609 Back     alignment and structure
>pdb|2HR7|A Chain A, Insulin Receptor (Domains 1-3) Length = 486 Back     alignment and structure
>pdb|1IGR|A Chain A, Type 1 Insulin-Like Growth Factor Receptor (Domains 1-3) Length = 478 Back     alignment and structure
>pdb|3W11|E Chain E, Insulin Receptor Ectodomain Construct Comprising Domains L1-cr In Complex With Human Insulin, Alpha-ct Peptide(704-719) And Fab 83-7 Length = 310 Back     alignment and structure
>pdb|3I2T|A Chain A, Crystal Structure Of The Unliganded Drosophila Epidermal Growth Factor Receptor Ectodomain Length = 551 Back     alignment and structure
>pdb|3LTF|A Chain A, Crystal Structure Of The Drosophila Epidermal Growth Factor Receptor Ectodomain In Complex With Spitz Length = 601 Back     alignment and structure
>pdb|3P11|A Chain A, Anti-EgfrHER3 FAB DL11 IN COMPLEX WITH DOMAINS I-Iii Of The Her3 Extracellular Region Length = 522 Back     alignment and structure
>pdb|1M6B|A Chain A, Structure Of The Her3 (Erbb3) Extracellular Domain Length = 621 Back     alignment and structure
>pdb|3U2P|A Chain A, Crystal Structure Of N-Terminal Three Extracellular Domains Of Erbb4HER4 Length = 497 Back     alignment and structure
>pdb|2AHX|A Chain A, Crystal Structure Of Erbb4HER4 EXTRACELLULAR DOMAIN Length = 617 Back     alignment and structure
>pdb|3U7U|A Chain A, Crystal Structure Of Extracellular Region Of Human Epidermal Growth Factor Receptor 4 In Complex With Neuregulin-1 Beta Length = 615 Back     alignment and structure
>pdb|3U9U|E Chain E, Crystal Structure Of Extracellular Domain Of Human Erbb4HER4 IN Complex With The Fab Fragment Of Mab1479 Length = 625 Back     alignment and structure
>pdb|1N8Y|C Chain C, Crystal Structure Of The Extracellular Region Of Rat Her2 Length = 608 Back     alignment and structure
>pdb|2A91|A Chain A, Crystal Structure Of Erbb2 Domains 1-3 Length = 517 Back     alignment and structure
>pdb|1N8Z|C Chain C, Crystal Structure Of Extracellular Domain Of Human Her2 Complexed With Herceptin Fab Length = 607 Back     alignment and structure
>pdb|1S78|A Chain A, Insights Into Erbb Signaling From The Structure Of The Erbb2- Pertuzumab Complex Length = 624 Back     alignment and structure
>pdb|1MOX|A Chain A, Crystal Structure Of Human Epidermal Growth Factor Receptor (Residues 1-501) In Complex With Tgf-Alpha Length = 501 Back     alignment and structure
>pdb|1IVO|A Chain A, Crystal Structure Of The Complex Of Human Epidermal Growth Factor And Receptor Extracellular Domains. Length = 622 Back     alignment and structure
>pdb|3NJP|A Chain A, The Extracellular And Transmembrane Domain Interfaces In Epidermal Growth Factor Receptor Signaling Length = 614 Back     alignment and structure
>pdb|3QWQ|A Chain A, Crystal Structure Of The Extracellular Domain Of The Epidermal Growth Factor Receptor In Complex With An Adnectin Length = 648 Back     alignment and structure
>pdb|1NQL|A Chain A, Structure Of The Extracellular Domain Of Human Epidermal Growth Factor (egf) Receptor In An Inactive (low Ph) Complex With Egf Length = 624 Back     alignment and structure
>pdb|1YY9|A Chain A, Structure Of The Extracellular Domain Of The Epidermal Growth Factor Receptor In Complex With The Fab Fragment Of Cetuximab/erbitux/imc- C225 Length = 624 Back     alignment and structure
>pdb|3B2V|A Chain A, Crystal Structure Of The Extracellular Region Of The Epidermal Growth Factor Receptor In Complex With The Fab Fragment Of Imc-11f8 Length = 624 Back     alignment and structure
>pdb|3H3B|A Chain A, Crystal Structure Of The Single-Chain Fv (Scfv) Fragment Of An Anti- Erbb2 Antibody Cha21 In Complex With Residues 1-192 Of Erbb2 Extracellular Domain Length = 194 Back     alignment and structure
>pdb|3B2U|A Chain A, Crystal Structure Of Isolated Domain Iii Of The Extracellular Region Of The Epidermal Growth Factor Receptor In Complex With The Fab Fragment Of Imc-11f8 Length = 214 Back     alignment and structure
>pdb|1P9M|A Chain A, Crystal Structure Of The Hexameric Human Il-6/il-6 Alpha Receptor/gp130 Complex Length = 299 Back     alignment and structure
>pdb|1I1R|A Chain A, Crystal Structure Of A CytokineRECEPTOR COMPLEX Length = 303 Back     alignment and structure
>pdb|3P0Y|A Chain A, Anti-EgfrHER3 FAB DL11 IN COMPLEX WITH DOMAIN III OF EGFR Extracellular Region Length = 214 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query976
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 1e-151
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 5e-10
2hr7_A486 Insulin receptor; hormone receptor, leucine rich r 1e-87
2hr7_A486 Insulin receptor; hormone receptor, leucine rich r 2e-14
1igr_A478 Insulin-like growth factor receptor 1; hormone rec 2e-83
1igr_A478 Insulin-like growth factor receptor 1; hormone rec 1e-15
1mox_A501 Epidermal growth factor receptor; EGFR, receptor, 2e-57
1mox_A501 Epidermal growth factor receptor; EGFR, receptor, 5e-15
1n8y_C608 Protooncoprotein; tyrosin kinase receptor, cell su 2e-51
1n8y_C608 Protooncoprotein; tyrosin kinase receptor, cell su 5e-26
3i2t_A551 Epidermal growth factor receptor, isoform A; EGFR, 1e-47
3i2t_A551 Epidermal growth factor receptor, isoform A; EGFR, 1e-14
1yy9_A624 Epidermal growth factor receptor; cell surface rec 6e-45
1yy9_A624 Epidermal growth factor receptor; cell surface rec 9e-20
1m6b_A621 C-ER, receptor protein-tyrosine kinase ERBB-3; cel 2e-43
1m6b_A621 C-ER, receptor protein-tyrosine kinase ERBB-3; cel 9e-19
1m6b_A621 C-ER, receptor protein-tyrosine kinase ERBB-3; cel 2e-04
2ahx_A617 P180ERBB4, receptor tyrosine-protein kinase ERBB-4 2e-38
2ahx_A617 P180ERBB4, receptor tyrosine-protein kinase ERBB-4 3e-15
3p0y_A214 Epidermal growth factor receptor; beta-sandwich, a 5e-36
3p0y_A214 Epidermal growth factor receptor; beta-sandwich, a 4e-14
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 2e-18
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 1e-08
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 3e-06
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 2e-17
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 8e-12
3f7q_A 234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 5e-07
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 1e-04
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 5e-13
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 7e-09
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 1e-12
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 2e-09
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 1e-08
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 1e-07
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 2e-07
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 6e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-06
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 5e-12
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 3e-10
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 1e-11
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 2e-09
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 1e-11
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 6e-06
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 1e-04
3l5i_A 290 Interleukin-6 receptor subunit beta; cytokine rece 5e-04
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 2e-11
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 1e-09
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 4e-11
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 3e-10
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 7e-09
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 6e-06
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 2e-04
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 8e-04
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 5e-11
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 7e-10
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 6e-11
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 2e-07
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 6e-11
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 6e-07
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 1e-06
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 9e-11
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 9e-10
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 4e-09
3t1w_A 375 Four-domain fibronectin fragment; human fibronecti 1e-08
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 2e-06
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 7e-06
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 1e-10
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 4e-08
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 2e-10
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 1e-07
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 2e-10
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 2e-09
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 2e-08
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 7e-08
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 9e-07
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 1e-05
1fnf_A 368 Fibronectin; RGD, extracellular matrix, cell adhes 1e-04
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 3e-10
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 5e-04
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 4e-10
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 3e-07
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 4e-10
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 5e-09
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 1e-05
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 2e-05
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 5e-10
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 9e-08
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 7e-10
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 4e-09
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 9e-10
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 2e-08
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 2e-07
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 4e-07
3r8q_A 290 Fibronectin; heparin, FNIII, heparin binding, cell 1e-04
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 1e-09
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 2e-04
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 1e-09
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 1e-05
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 1e-09
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 5e-05
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 3e-04
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 1e-09
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 4e-06
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 1e-09
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 7e-07
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 2e-09
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 1e-04
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 4e-09
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 5e-07
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 2e-05
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 4e-09
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 7e-07
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 3e-05
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 6e-09
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 1e-05
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 8e-09
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 2e-04
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 8e-09
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 1e-08
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 4e-06
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 2e-08
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 1e-04
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 2e-08
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 8e-05
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 2e-08
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 2e-04
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 3e-08
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 3e-04
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 3e-08
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 2e-05
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 4e-08
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 2e-06
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 6e-08
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 8e-08
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 5e-05
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 1e-07
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 9e-04
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 2e-07
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 5e-06
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 7e-04
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 2e-07
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 2e-07
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 6e-06
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 3e-07
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 2e-05
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 8e-05
1x4x_A106 Fibronectin type-III domain containing protein 3A; 3e-07
1x4x_A106 Fibronectin type-III domain containing protein 3A; 3e-05
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 6e-07
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 2e-06
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 7e-07
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 5e-06
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 2e-05
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 4e-04
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 4e-04
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 7e-07
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 2e-05
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 7e-04
3k2m_C101 Monobody HA4; engineered binding protein, antibody 9e-07
3k2m_C101 Monobody HA4; engineered binding protein, antibody 8e-04
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 9e-07
3t04_D103 Monobody 7C12; engineered binding protein, antibod 9e-07
3t04_D103 Monobody 7C12; engineered binding protein, antibod 8e-05
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 1e-06
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 6e-05
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 1e-06
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 1e-06
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 2e-06
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 3e-06
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 2e-04
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 3e-06
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 1e-04
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 4e-06
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 5e-06
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 1e-05
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 2e-05
2crm_A120 Fibronectin type-III domain containing protein 3A; 2e-05
2crm_A120 Fibronectin type-III domain containing protein 3A; 3e-04
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 2e-05
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 3e-05
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 4e-05
1x5x_A109 Fibronectin type-III domain containing protein 3A; 5e-05
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 5e-05
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 6e-05
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 7e-05
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 1e-04
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 1e-04
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 9e-04
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 2e-04
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 2e-04
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 2e-04
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 2e-04
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 8e-04
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 2e-04
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 3e-04
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 3e-04
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 3e-04
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 4e-04
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 5e-04
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 5e-04
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 6e-04
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 6e-04
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 7e-04
2gys_A419 Cytokine receptor common beta chain; dimer of inte 7e-04
2crz_A110 Fibronectin type-III domain containing protein 3A; 9e-04
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
 Score =  469 bits (1206), Expect = e-151
 Identities = 255/952 (26%), Positives = 397/952 (41%), Gaps = 122/952 (12%)

Query: 61  EKVCTDIDIRNYVSSFDVLKDCTVVEGFVQINLIDNSTAQDFENITFPKLREITEYLSFY 120
            +VC  +DIRN ++    L++C+V+EG +QI L+  +  +DF +++FPKL  IT+YL  +
Sbjct: 5   GEVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLF 64

Query: 121 HVSGLKSIGKLFPNLAIIRGNTLIWDYTFSVFSMFNLQEIGLHRLTHIMKGTVVILRNP- 179
            V GL+S+  LFPNL +IRG+ L ++Y   +F M +L+E+GL+ L +I +G+V I +N  
Sbjct: 65  RVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNE 124

Query: 180 -------DWKRITKKGS--VVINDIKSKEACLQEGEPGARSGPEKC----------EFYW 220
                  DW RI        ++ +    E C     PG   G   C          E  W
Sbjct: 125 LCYLATIDWSRILDSVEDNHIVLNKDDNEECGDIC-PGTAKGKTNCPATVINGQFVERCW 183

Query: 221 SNNDCQLI-----------KEIEECHPLCAGGCTG-KRAEDCFVCIGFIHDGHCLDQCPP 268
           +++ CQ +            E   CH  C G C+       C  C  F  DG C++ CPP
Sbjct: 184 THSHCQKVCPTICKSHGCTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPP 243

Query: 269 NLQGQVATLQRILYGGIRYSYMNRRCLTREECLNNKRVTTKNFPQNMRMSYSDKAKWRPF 328
                             Y + + RC+    C +       +  Q          ++   
Sbjct: 244 PY----------------YHFQDWRCVNFSFCQDLHHKCKNSRRQGCH-------QYVIH 280

Query: 329 NGSCMEECPPGYNTTADETSCVPCPD-CPKVCKGVH----VKSIEVARSTKGCTVINGSL 383
           N  C+ ECP GY   +    C PC   CPKVC  +     + S+  A+  +GCTVINGSL
Sbjct: 281 NNKCIPECPSGYTMNSSNLLCTPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVINGSL 340

Query: 384 GIQIQTGDSEVVHQELEKGLGMITNITGHLKISHSLPIQSLSFLKSLQSIHGEREIIRGD 443
            I I+ G++     ELE  LG+I  I+G+LKI  S  + SLSF + L+ I G        
Sbjct: 341 IINIRGGNNLA--AELEANLGLIEEISGYLKIRRSYALVSLSFFRKLRLIRG-------- 390

Query: 444 TSESSVYSNYSLIVWDNPNLQELWGWSNLPDGQRPKFEIKKGKILFHDNPKLCLDKIYEL 503
             E+    NYS    DN NL++LW WS           I +GK+ FH NPKLCL +I+++
Sbjct: 391 --ETLEIGNYSFYALDNQNLRQLWDWSK------HNLTITQGKLFFHYNPKLCLSEIHKM 442

Query: 504 INVTNITY-DSDFDVLKESNGDEFICGFSNLALVVLNKTDVSIRFQLNENEKVPDNQR-- 560
             V+         D+  ++NGD+  C    L    +  +   I   L      P + R  
Sbjct: 443 EEVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSFDKIL--LRWEPYWPPDFRDL 500

Query: 561 --YVLFYMKADNGMYTDFDTVGSCSASGWKFKDINS----------KNKTVEVMNLEPAT 608
             ++LFY +A     T+FD   +C ++ W   DI+            +    +  L+P T
Sbjct: 501 LGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWT 560

Query: 609 EYAFFVKIYNS------QRIVRSNISLQTTLPTKPSIPYQFEVVRVNSSSVTLRWGEPKH 662
           +YA FVK   +          +S+I    T  T PS+P     V  +SS + L+W  P  
Sbjct: 561 QYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPLDPISVSNSSSQIILKWKPPSD 620

Query: 663 PHGILEKYVIKAYYQDYDKDYLDTRNYCVDKLRDLSDSTYAASHLMRFAKTTRKPLKECC 722
           P+G +  Y++    Q  D +  +               +              +      
Sbjct: 621 PNGNITHYLVFWERQAEDSELFELDYCLKGLKLPSRTWSPPFESEDSQKHNQSEYEDSAG 680

Query: 723 GKFPCDFDHESFQYMTSQMQLIQQCDNYIFKYLQYNDLHKAYGGDLPSLGNISSRLPDRE 782
               C            +    +  ++Y+     +N +                   + E
Sbjct: 681 ECCSCPKTDSQILKELEESSFRKTFEDYL-----HNVVFVPRPSRKRRSLGDVGNAGNNE 735

Query: 783 ENDVLY---PETSYTMVGLGHFRSIVFTISACRKEQKDKFLPYDPEEGRCSEETLVMSRT 839
           E+        + S  + GL HF      + AC +         D  E RCS    V +RT
Sbjct: 736 EHRPFEKVVNKESLVISGLRHFTGYRIELQACNQ---------DTPEERCSVAAYVSART 786

Query: 840 EVDHLADTIPADSLNFEMINASALRIRWHPPSRPNGIIVAYNIEYKRESGGNSENMCRTR 899
             +  AD I    +  E+   + + + W  P  PNG+IV Y + Y+R       ++C TR
Sbjct: 787 MPEAKADDIVGP-VTHEIFENNVVHLMWQEPKEPNGLIVLYEVSYRRYGDEE-LHLCDTR 844

Query: 900 KDIDRDSGLYLYDYPAGSYLFRLRVVSLGGEGPWTSWKPCVI-ESAETPMSV 950
           K    + G  L     G+Y  R+R  SL G G WT      + +  + P ++
Sbjct: 845 KHFALERGCRLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYVTDYLDVPSNI 896
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>2hr7_A Insulin receptor; hormone receptor, leucine rich repeat, transferase; HET: NAG BMA MAN FUC P33; 2.32A {Homo sapiens} Length = 486 Back     alignment and structure
>2hr7_A Insulin receptor; hormone receptor, leucine rich repeat, transferase; HET: NAG BMA MAN FUC P33; 2.32A {Homo sapiens} Length = 486 Back     alignment and structure
>1igr_A Insulin-like growth factor receptor 1; hormone receptor, insulin receptor family; HET: NAG FUC BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 Length = 478 Back     alignment and structure
>1igr_A Insulin-like growth factor receptor 1; hormone receptor, insulin receptor family; HET: NAG FUC BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 Length = 478 Back     alignment and structure
>1mox_A Epidermal growth factor receptor; EGFR, receptor, complex, transferase-growth F complex; HET: NAG FUC BMA MAN; 2.50A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 Length = 501 Back     alignment and structure
>1mox_A Epidermal growth factor receptor; EGFR, receptor, complex, transferase-growth F complex; HET: NAG FUC BMA MAN; 2.50A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 Length = 501 Back     alignment and structure
>1n8y_C Protooncoprotein; tyrosin kinase receptor, cell surface receptor, transferase; HET: NAG; 2.40A {Rattus norvegicus} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 1n8z_C* 3be1_A* 1s78_A* 3mzw_A* 3n85_A* 2a91_A* 3h3b_A Length = 608 Back     alignment and structure
>1n8y_C Protooncoprotein; tyrosin kinase receptor, cell surface receptor, transferase; HET: NAG; 2.40A {Rattus norvegicus} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 1n8z_C* 3be1_A* 1s78_A* 3mzw_A* 3n85_A* 2a91_A* 3h3b_A Length = 608 Back     alignment and structure
>3i2t_A Epidermal growth factor receptor, isoform A; EGFR, ectodomain, unliganded, autoinhibited, ATP nucleotide-binding, tyrosine-protein kinase; HET: NDG NAG BMA; 2.70A {Drosophila melanogaster} PDB: 3ltf_A* 3ltg_A Length = 551 Back     alignment and structure
>3i2t_A Epidermal growth factor receptor, isoform A; EGFR, ectodomain, unliganded, autoinhibited, ATP nucleotide-binding, tyrosine-protein kinase; HET: NDG NAG BMA; 2.70A {Drosophila melanogaster} PDB: 3ltf_A* 3ltg_A Length = 551 Back     alignment and structure
>1yy9_A Epidermal growth factor receptor; cell surface receptor, tyrosine kinase, glycoprotein, antigen:antibody complex, FAB fragment, antitumor, drug; HET: NDG NAG BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3qwq_A* 1nql_A* 3b2v_A* 1ivo_A* 3njp_A* Length = 624 Back     alignment and structure
>1yy9_A Epidermal growth factor receptor; cell surface receptor, tyrosine kinase, glycoprotein, antigen:antibody complex, FAB fragment, antitumor, drug; HET: NDG NAG BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3qwq_A* 1nql_A* 3b2v_A* 1ivo_A* 3njp_A* Length = 624 Back     alignment and structure
>1m6b_A C-ER, receptor protein-tyrosine kinase ERBB-3; cell surface receptor, immunity, signaling transferase; HET: NAG NDG; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3p11_A* Length = 621 Back     alignment and structure
>1m6b_A C-ER, receptor protein-tyrosine kinase ERBB-3; cell surface receptor, immunity, signaling transferase; HET: NAG NDG; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3p11_A* Length = 621 Back     alignment and structure
>1m6b_A C-ER, receptor protein-tyrosine kinase ERBB-3; cell surface receptor, immunity, signaling transferase; HET: NAG NDG; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3p11_A* Length = 621 Back     alignment and structure
>2ahx_A P180ERBB4, receptor tyrosine-protein kinase ERBB-4; X-RAY crystallography, neuregulins, heparin-binding, cell CY signaling protein; HET: NAG NDG; 2.40A {Homo sapiens} PDB: 3u2p_A* Length = 617 Back     alignment and structure
>2ahx_A P180ERBB4, receptor tyrosine-protein kinase ERBB-4; X-RAY crystallography, neuregulins, heparin-binding, cell CY signaling protein; HET: NAG NDG; 2.40A {Homo sapiens} PDB: 3u2p_A* Length = 617 Back     alignment and structure
>3p0y_A Epidermal growth factor receptor; beta-sandwich, antigens EGFR, immune system; HET: NAG FUL; 1.80A {Homo sapiens} PDB: 3b2u_A* 3c09_A* Length = 214 Back     alignment and structure
>3p0y_A Epidermal growth factor receptor; beta-sandwich, antigens EGFR, immune system; HET: NAG FUL; 1.80A {Homo sapiens} PDB: 3b2u_A* 3c09_A* Length = 214 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query976
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 100.0
2hr7_A486 Insulin receptor; hormone receptor, leucine rich r 100.0
1igr_A478 Insulin-like growth factor receptor 1; hormone rec 100.0
1mox_A501 Epidermal growth factor receptor; EGFR, receptor, 100.0
1n8y_C608 Protooncoprotein; tyrosin kinase receptor, cell su 100.0
3i2t_A551 Epidermal growth factor receptor, isoform A; EGFR, 100.0
1m6b_A621 C-ER, receptor protein-tyrosine kinase ERBB-3; cel 100.0
1yy9_A624 Epidermal growth factor receptor; cell surface rec 100.0
2ahx_A617 P180ERBB4, receptor tyrosine-protein kinase ERBB-4 100.0
1yy9_A624 Epidermal growth factor receptor; cell surface rec 100.0
1m6b_A621 C-ER, receptor protein-tyrosine kinase ERBB-3; cel 100.0
2ahx_A617 P180ERBB4, receptor tyrosine-protein kinase ERBB-4 100.0
1n8y_C608 Protooncoprotein; tyrosin kinase receptor, cell su 100.0
3i2t_A551 Epidermal growth factor receptor, isoform A; EGFR, 100.0
2dtg_E897 Insulin receptor; IR ectodomain, X-RAY crystallogr 100.0
3p0y_A214 Epidermal growth factor receptor; beta-sandwich, a 100.0
1mox_A501 Epidermal growth factor receptor; EGFR, receptor, 100.0
2hr7_A486 Insulin receptor; hormone receptor, leucine rich r 99.95
1igr_A478 Insulin-like growth factor receptor 1; hormone rec 99.95
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 99.95
1zlg_A680 Anosmin 1; insulin-like growth factor receptor Cys 99.95
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.94
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.94
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 99.94
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 99.94
3t1w_A375 Four-domain fibronectin fragment; human fibronecti 99.92
2v5y_A731 Receptor-type tyrosine-protein phosphatase MU; mem 99.92
2v5y_A 731 Receptor-type tyrosine-protein phosphatase MU; mem 99.91
1fnf_A368 Fibronectin; RGD, extracellular matrix, cell adhes 99.91
3l5h_A589 Interleukin-6 receptor subunit beta; IG-like, FNII 99.91
1zlg_A 680 Anosmin 1; insulin-like growth factor receptor Cys 99.91
3lb6_C380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.89
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.88
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.88
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 99.87
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.87
3p0y_A214 Epidermal growth factor receptor; beta-sandwich, a 99.85
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.85
3se4_A414 Interferon alpha/beta receptor 1; type I interfero 99.85
3l5h_A 589 Interleukin-6 receptor subunit beta; IG-like, FNII 99.84
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.84
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.83
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.83
3p4l_A211 Neogenin; iron homeostasis, hemojuvelin receptor, 99.83
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.83
3f7q_A234 Integrin beta-4, GP150; hemidesmosome, cell adhesi 99.83
2vkw_A209 Neural cell adhesion molecule 1,140 kDa isoform; a 99.79
1cfb_A205 Drosophila neuroglian; neural adhesion molecule; H 99.79
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.79
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.79
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.78
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.77
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.77
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.77
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.77
3lpw_A197 A77-A78 domain from titin; intracellular FNIII-tan 99.77
2gys_A419 Cytokine receptor common beta chain; dimer of inte 99.77
2gee_A203 Hypothetical protein; fibronectin, EIIIB, cancer, 99.76
1qr4_A186 Protein (tenascin); fibronectin type-III, heparin, 99.74
2ha1_A201 Fibronectin; beta sandwich, protein-protein comple 99.73
2ibg_A214 CG9211-PA, GH03927P; IHOG, fibronectin type III, p 99.73
3r8q_A290 Fibronectin; heparin, FNIII, heparin binding, cell 99.72
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.72
1tdq_A283 Tenascin-R; extracellular matrix, lecticans, tenas 99.7
1bqu_A215 Protein (GP130); cytokine receptor, glycoprotein 1 99.7
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 99.69
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.69
3l5i_A290 Interleukin-6 receptor subunit beta; cytokine rece 99.69
1i1r_A303 GP130, interleukin-6 receptor beta chain; cytokine 99.67
3fl7_A536 Ephrin receptor; ATP-binding, kinase, nucleotide-b 99.66
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.65
3s98_A306 Interferon alpha/beta receptor 1; human, type I in 99.57
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.56
1cd9_B215 G-CSF-R, protein (G-CSF receptor); class1 cytokine 99.56
3n06_B210 PRL-R, prolactin receptor; PH dependence, hematopo 99.54
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 99.53
4go6_B232 HCF C-terminal chain 1; tandem fibronectin repeat, 99.52
2d9q_B313 Granulocyte colony-stimulating factor receptor; cy 99.5
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 99.5
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.5
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.49
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.45
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.41
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.39
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 99.39
3lqm_A201 Interleukin-10 receptor subunit beta; IL-10R2, com 99.38
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 99.38
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 99.38
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.38
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 99.36
2ed9_A124 Netrin receptor DCC; tumor suppressor protein DCC, 99.35
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 99.35
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 99.35
2dbj_A124 Proto-oncogene tyrosine-protein kinase MER precurs 99.33
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 99.33
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 99.32
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 99.32
1wfo_A130 Sidekick 2; FN3, cell adhesion, structural genomic 99.32
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 99.3
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 99.3
2edx_A134 Protein tyrosine phosphatase, receptor type, F; LA 99.29
2ee2_A119 Contactin-1; neural cell surface protein F3, glyco 99.29
2e7h_A109 Ephrin type-B receptor 4; FN3 domain, tyrosine- pr 99.29
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 99.29
3bpo_C314 Interleukin-13 receptor alpha-1 chain; IL4, IL13, 99.29
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 99.29
2djs_A108 Ephrin type-B receptor 1; tyrosine-protein kinase 99.28
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 99.28
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 99.28
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 99.27
1wj3_A117 KIAA1496 protein; beta sandwich, PANG, structural 99.27
1n26_A325 IL-6 receptor alpha chain; transmembrane, glycopro 99.26
1x3d_A118 Fibronectin type-III domain containing protein 3A; 99.26
1x5g_A116 Neogenin; RGM binding, fibronectin type III domain 99.26
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 99.26
1x5f_A120 Neogenin; RGM binding, fibronectin type III domain 99.26
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 99.25
3lb6_C 380 IL-13, interleukin-13 receptor subunit alpha-2; cy 99.25
1eer_B227 Epobp, erythropoietin receptor; signal transductio 99.25
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 99.24
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 99.24
2dlh_A121 Receptor-type tyrosine-protein phosphatase delta; 99.24
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 99.24
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.23
1x5l_A111 Ephrin type-A receptor 8; FN3 domain, structural g 99.23
1va9_A122 DOWN syndrome cell adhesion molecule like- protein 99.23
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 99.23
1x5h_A132 Neogenin; RGM binding, fibronectin type III domain 99.22
2ed7_A119 Netrin receptor DCC; tumor suppressor protein DCC, 99.22
2ede_A114 Netrin receptor DCC; tumor suppressor protein DCC, 99.21
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 99.21
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 99.21
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 99.21
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 99.2
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 99.2
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 99.2
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 99.19
1wfn_A119 Sidekick 2; FN3, cell adhesion, structural genomic 99.19
1x4x_A106 Fibronectin type-III domain containing protein 3A; 99.19
1x3d_A118 Fibronectin type-III domain containing protein 3A; 99.19
3t04_D103 Monobody 7C12; engineered binding protein, antibod 99.19
2crm_A120 Fibronectin type-III domain containing protein 3A; 99.18
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 99.18
1uen_A125 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.17
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 99.17
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 99.17
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 99.17
3t04_D103 Monobody 7C12; engineered binding protein, antibod 99.15
1x5i_A126 Neogenin; RGM binding, fibronectin type III domain 99.15
2q7n_A488 Leukemia inhibitory factor receptor; cytokine cell 99.15
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 99.14
1x5a_A107 Ephrin type-A receptor 1; tyrosine-protein kinase 99.14
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 99.14
2haz_A105 N-CAM 1, neural cell adhesion molecule 1; fibronec 99.13
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 99.13
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 99.13
2dm4_A108 Sortilin-related receptor; beta-sandwich, sorting 99.12
2yrz_A118 Integrin beta-4; GP150, CD104 antigen, structural 99.11
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 99.1
2edb_A116 Netrin receptor DCC; tumor suppressor protein DCC, 99.1
2e3v_A122 Neural cell adhesion molecule 1, 140 kDa isoform; 99.09
2crm_A120 Fibronectin type-III domain containing protein 3A; 99.09
1axi_B236 HGHBP, growth hormone receptor; complex (hormone-r 99.09
1x5x_A109 Fibronectin type-III domain containing protein 3A; 99.09
2edd_A123 Netrin receptor DCC; tumor suppressor protein DCC, 99.09
2ed8_A106 Netrin receptor DCC; tumor suppressor protein DCC, 99.09
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 99.09
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 99.07
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 99.07
2dn7_A107 Receptor-type tyrosine-protein phosphatase F; LAR 99.07
1x5j_A113 Neogenin; RGM binding, fibronectin type III domain 99.07
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 99.06
2crz_A110 Fibronectin type-III domain containing protein 3A; 99.06
2gys_A419 Cytokine receptor common beta chain; dimer of inte 99.06
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 99.05
3k2m_C101 Monobody HA4; engineered binding protein, antibody 99.05
1wis_A124 KIAA1514 protein; FNIII domain, sidekick-2, struct 99.05
1x4x_A106 Fibronectin type-III domain containing protein 3A; 99.05
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 99.03
1ujt_A120 KIAA1568 protein; fibronectin type III domain, str 99.03
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 99.03
2dju_A106 Receptor-type tyrosine-protein phosphatase F; LAR 99.03
3n1f_C102 Cell adhesion molecule-related/DOWN-regulated BY; 99.03
1x5z_A115 Receptor-type tyrosine-protein phosphatase delta; 99.03
1v5j_A108 KIAA1355 protein, RSGI RUH-008; FN3 domain, human 99.02
3e0g_A483 Leukemia inhibitory factor receptor; IG domain, cy 99.02
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 99.02
1x4z_A121 Biregional cell adhesion molecule-related/DOWN- re 99.01
1x4y_A114 Biregional cell adhesion molecule-related/DOWN- re 99.01
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 99.0
3g9v_A211 Interleukin 22 receptor, alpha 2; cytokine, cytoki 98.99
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 98.98
1uey_A127 KIAA0343 protein; immunoglobulin-like beta-sandwic 98.97
2crz_A110 Fibronectin type-III domain containing protein 3A; 98.97
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 98.96
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 98.96
1wk0_A137 KIAA0970 protein; fibronectin type III domain, str 98.95
2edy_A103 Receptor-type tyrosine-protein phosphatase F; LAR 98.94
2w1n_A238 O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol 98.94
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 98.94
1x5x_A109 Fibronectin type-III domain containing protein 3A; 98.93
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 98.93
1x5y_A111 Myosin binding protein C, fast-type; fast MYBP-C, 98.93
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 98.93
4doh_R221 Interleukin-20 receptor subunit alpha; IL10 family 98.93
1eer_B227 Epobp, erythropoietin receptor; signal transductio 98.92
2ee3_A108 Collagen alpha-1(XX) chain; KIAA1510, structural g 98.92
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 98.91
3qht_C97 Monobody YSMB-1; fibronectin type III, yeast small 98.91
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 98.9
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 98.89
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 98.88
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 98.88
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 98.86
4doh_B206 Interleukin-20 receptor subunit beta; IL10 family 98.86
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 98.86
3v6o_A206 Leptin receptor; receptor-antibody complex, cytoki 98.86
2cum_A105 Tenascin-X; hexabrachion-like, fibronectin type II 98.86
2yuw_A110 Myosin binding protein C, SLOW type; fibronectin I 98.85
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 98.85
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 98.84
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 98.84
2kbg_A114 N-CAM 2, neural cell adhesion molecule 2; fibronec 98.84
3b83_A100 Ten-D3; beta sheet, computational redesigned prote 98.83
1uem_A117 KIAA1568 protein; immunoglobulin-like beta-sandwic 98.83
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 98.83
3k2m_C101 Monobody HA4; engineered binding protein, antibody 98.83
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 98.81
1wf5_A121 Sidekick 2 protein; FNIII domain, structural genom 98.81
3teu_A98 Fibcon; FN3 domain, fibronectin TPYE III domain, c 98.81
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 98.81
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.81
2rb8_A104 Tenascin; beta sheet,loop design, alternative spli 98.79
2cuh_A115 Tenascin-X; fibronectin type III domain, extracell 98.78
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 98.77
1wfu_A120 Unnamed protein product; FN3 domain, similar to 17 98.77
1j8k_A94 Fibronectin; EDA, TYPEIII domain, protein binding; 98.75
2ocf_D121 Fibronectin; estrogen receptor, LBD, monobody, est 98.75
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 98.75
1bpv_A112 Titin, A71, connectin; fibronectin type III; NMR { 98.74
2dmk_A127 Midline 2 isoform 2; midline defect 2, tripartite 98.73
2db8_A110 Tripartite motif protein 9, isoform 2; ring finger 98.73
2yux_A120 Myosin-binding protein C, SLOW-type; fibronectin I 98.72
2ekj_A105 Collagen alpha-1(XX) chain; KIAA1510, structural g 98.71
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 98.71
2erj_C247 Cytokine receptor common gamma chain; immune syste 98.7
3qwq_B114 Adnectin; cell surface receptor, tyrosine kinase, 98.66
3tes_A98 Tencon; fibronectin type III domain, FN3, consensu 98.64
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 98.63
2ic2_A115 CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t 98.63
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 98.61
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 98.61
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 98.58
2cui_A112 Tenascin-X; fibronectin type III domain, extracell 98.57
2dle_A104 Receptor-type tyrosine-protein phosphatase ETA; pr 98.54
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 98.54
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 98.52
2dkm_A104 Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, 98.5
1k85_A88 Chitinase A1; fibronectin type III domain, chitin 98.5
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 98.41
1uc6_A109 CNTF receptor, ciliary neurotrophic factor recepto 98.4
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 98.39
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.39
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 98.35
2erj_C247 Cytokine receptor common gamma chain; immune syste 98.31
2b5i_C199 Cytokine receptor common gamma chain; four-helix b 98.28
2h41_A95 Fibronectin; beta sandwich, cell adhesion, structu 98.26
1wft_A123 1700129L13RIK protein; FN3 domain, similar to HOST 98.25
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 98.24
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 98.21
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 98.2
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 98.12
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 98.08
3up1_A223 Interleukin-7 receptor subunit alpha; cytokine rec 98.02
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 98.0
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 97.98
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 97.92
2b5i_B214 Interleukin-2 receptor beta chain; four-helix bund 97.9
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 97.88
1oww_A98 FN, fibronectin first type III module, CIG; fibron 97.88
3mpc_A103 FN3-like protein; fibronectin, FN(III), unknown fu 97.84
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 97.81
1wft_A123 1700129L13RIK protein; FN3 domain, similar to HOST 97.79
3csg_A461 MBP, maltose-binding protein monobody YS1 fusion, 97.73
3d85_D306 IL-12B, interleukin-12 subunit P40, cytotoxic lymp 97.61
3dlq_R211 Interleukin-22 receptor subunit alpha-1; cytokine- 97.6
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 97.55
1oww_A98 FN, fibronectin first type III module, CIG; fibron 97.46
3tgx_A219 Interleukin-21 receptor; class I cytokine, class I 97.38
1q38_A89 Fibronectin; amyloid fibril, anastellin, extracell 97.35
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 97.33
3og6_B226 Interleukin 28 receptor, alpha (interferon, lambd 97.28
1iar_B207 Protein (interleukin-4 receptor alpha chain); cyto 97.13
1fyh_B229 Interferon-gamma receptor alpha chain; cytokine-re 97.08
3s9d_B199 Interferon alpha/beta receptor 2; human, type I in 96.96
3s9d_B199 Interferon alpha/beta receptor 2; human, type I in 96.78
2hft_A218 Human tissue factor; coagulation factor; 1.69A {Ho 96.67
1y6k_R214 Interleukin-10 receptor alpha chain; helix bundle, 96.65
3qt2_A317 Interleukin-5 receptor subunit alpha; cytokine typ 96.64
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 96.36
2hft_A218 Human tissue factor; coagulation factor; 1.69A {Ho 96.17
3cxe_C120 Granulocyte-macrophage colony-stimulating factor s 95.62
3bes_R250 Interferon-gamma binding protein C4R; orthopoxviru 94.58
2csp_A130 RIM-BP2, RIM binding protein 2; FN3 domain, struct 94.12
3pdd_A190 Glycoside hydrolase, family 9; CBHA, beta-sandwich 92.29
2uvf_A 608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 91.46
3bes_R250 Interferon-gamma binding protein C4R; orthopoxviru 91.09
4gns_A290 Chitin biosynthesis protein CHS5; FN3, BRCT, tetra 88.39
1du3_A130 Death receptor 5; trail, DR5, complex; 2.20A {Homo 87.92
2hey_R146 Tumor necrosis factor receptor superfamily member; 85.15
3arx_A 584 Chitinase A; TIM barrel, inhibitor complex, glycos 84.16
3b4n_A 344 Endo-pectate lyase; pectin, galacturonic acid, rig 84.06
2uvf_A 608 Exopolygalacturonase; GH28, pectin, cell WALL, hyd 82.96
3b4n_A344 Endo-pectate lyase; pectin, galacturonic acid, rig 82.5
4go6_A45 HCF N-terminal chain 1; tandem fibronectin repeat, 80.69
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
Probab=100.00  E-value=8.1e-119  Score=1133.86  Aligned_cols=814  Identities=31%  Similarity=0.587  Sum_probs=646.4

Q ss_pred             ccccCcccccccccccccCCcEEEeCceEEEEecCCCccCcccCCCCCeEEEccEEEEEeecCCCcccccCCCceEEecc
Q psy2190          62 KVCTDIDIRNYVSSFDVLKDCTVVEGFVQINLIDNSTAQDFENITFPKLREITEYLSFYHVSGLKSIGKLFPNLAIIRGN  141 (976)
Q Consensus        62 k~C~~~~~~~~~~~~~~~~~Ct~i~G~l~i~~~~~~~~~~~~~~sf~~i~eItG~l~i~~~~~l~sl~~~f~nL~~I~g~  141 (976)
                      |+|.|.+|++++++|++|+|||+|+|+|+|+...+...+++.+++|++|+||||||+|+++.+|++|++||+||++|||+
T Consensus         6 ~~C~~~~~~~~~~~~~~~~nct~i~g~l~i~~~~~~~~~~~~~~~f~~i~eitg~~~i~~~~~~~~l~~~~~nL~~I~g~   85 (897)
T 2dtg_E            6 EVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFRVYGLESLKDLFPNLTVIRGS   85 (897)
T ss_dssp             CEEEEEEEESSSGGGGGSSSCCEEEEEEEEECBSSCCGGGTTTCCCCSCCEESSCEEECSBTTCCBHHHHCTTCCEECCS
T ss_pred             cccCCcccccCHhHHhhccCCEEEeeeEEEEEecccCCCccccCccCCcEEEeEEEEEEEcCCcccHHhhCCCccEEccc
Confidence            78999999988899999999999999999999876556677888999999999999999998899998899999999999


Q ss_pred             ccccceEEEEEecCcceEecccccceeeeeeEEEeeCc--------cchhcccc-CcEEEccCcCccc-ccCCCCCC---
Q psy2190         142 TLIWDYTFSVFSMFNLQEIGLHRLTHIMKGTVVILRNP--------DWKRITKK-GSVVINDIKSKEA-CLQEGEPG---  208 (976)
Q Consensus       142 ~l~~~~~l~i~~n~~l~~lgl~~L~~i~~g~v~i~~N~--------~w~~i~~~-~~~~~~~n~~~~~-C~~~~C~~---  208 (976)
                      .|+.+|||+|++|++|++|||++|++|.+|+|+|.+|+        +|++|+.+ ....|..|++..+ |.+. |++   
T Consensus        86 ~~~~~~~l~i~~~~~l~~l~l~~L~~i~~g~v~i~~n~~lC~~~ti~w~~i~~~~~~~~i~~n~~~~~~C~~~-C~~~~~  164 (897)
T 2dtg_E           86 RLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNELCYLATIDWSRILDSVEDNHIVLNKDDNEECGDI-CPGTAK  164 (897)
T ss_dssp             SCBTTEEEEEESCTTCCBCCCCSCCBCCSCEEEEECCSCCCBTSSSCHHHHSSCCTTCEEESSSTTSSCCCCC-CSCTTC
T ss_pred             ccccceeEEEEecCCcCEeCCcchhhccCCcEEEecCccccCCCCCCHHHHhCCccceEEeccCCcccccccc-CCcccc
Confidence            99999999999999999999999999999999999999        99999998 3333788988887 9665 887   


Q ss_pred             ---CCC----CCCCCCCCCCCCcccccCCC----------Cc-ccccccCccCCCCCCc-cccccceeecCccccccccc
Q psy2190         209 ---ARS----GPEKCEFYWSNNDCQLIKEI----------EE-CHPLCAGGCTGKRAED-CFVCIGFIHDGHCLDQCPPN  269 (976)
Q Consensus       209 ---~~~----~~~~~~~Cw~~~~Cq~~C~~----------~~-C~~~C~~~C~g~~~~~-C~~C~~~~~~~~Cv~~Cp~~  269 (976)
                         .|.    +|....+||+.++||+.|+.          ++ ||++|++||+||++++ |++|+++.++|.||++||.+
T Consensus       165 ~~~~C~~~~~~~~~~~~Cw~~~~cq~~C~~~C~~~~c~~~~~CCh~~C~ggC~gp~~~~~C~~C~~~~~~~~Cv~~Cp~~  244 (897)
T 2dtg_E          165 GKTNCPATVINGQFVERCWTHSHCQKVCPTICKSHGCTAEGLCCHSECLGNCSQPDDPTKCVACRNFYLDGRCVETCPPP  244 (897)
T ss_dssp             SSCCSCEECGGGCCEECBSSSSCBCCCCCTTTGGGCBCSSSCBCCTTCCSEESSSSCGGGEECCSSCBBTTBCCSSCCSS
T ss_pred             ccccCcccccCCCccCCCCCCchhhccccccccCCcccCCCCccChhhCcCCCCCCCCCceeECccCccCCcchhhcCCc
Confidence               454    45567899999999998875          45 9999999999999998 99999999999999999999


Q ss_pred             ccCCccceeeeecCceeeeccCccccccccccCCCCCccccCCCCCCcccCCCCcccccCCcccccCCCCcccCCCCCCc
Q psy2190         270 LQGQVATLQRILYGGIRYSYMNRRCLTREECLNNKRVTTKNFPQNMRMSYSDKAKWRPFNGSCMEECPPGYNTTADETSC  349 (976)
Q Consensus       270 ~~~~~~~~~~~~~~~~~y~~~~~~C~~~~~C~~~~~~~tC~gp~~~~~~C~~c~~~~~~~~~Cv~~Cp~g~~~~~~~~~C  349 (976)
                      +                |.+++++|+++.+|..+.+  .|.++..     ++|++|+.+++.||.+||.||+.+...+.|
T Consensus       245 ~----------------y~~~~~~C~~~~~C~~~~~--~c~~~~~-----~~c~~~~~~~~~Cv~~CP~g~~~~~~~~~C  301 (897)
T 2dtg_E          245 Y----------------YHFQDWRCVNFSFCQDLHH--KCKNSRR-----QGCHQYVIHNNKCIPECPSGYTMNSSNLLC  301 (897)
T ss_dssp             C----------------CCCTTSBCCCHHHHHHHSS--CCCSTTT-----TSCCCCEEETTEEESSCCSSCEECSSSCBE
T ss_pred             e----------------eEecCcEEcChhHhhccCc--cccCCCc-----ccccceeeECCEEccCCCCCccccCCCCee
Confidence            9                9888889999889987665  5665553     457889889999999999999987677899


Q ss_pred             ccCC-CCCCCC----CcceeeccccccccCCCeEEcCceEEEEecCCCchhHHHHHHhhccceeeeeEEEEEeecCcccc
Q psy2190         350 VPCP-DCPKVC----KGVHVKSIEVARSTKGCTVINGSLGIQIQTGDSEVVHQELEKGLGMITNITGHLKISHSLPIQSL  424 (976)
Q Consensus       350 ~~C~-~C~~~C----~g~~~~~~~~~~~~~~C~~i~G~l~i~~~~g~~~~~~~~l~~~l~~i~~I~G~L~i~~s~~l~~l  424 (976)
                      ++|+ .|+|+|    .|..|++++++++|+|||+|+|+|+|.++.|  .+++++++++|++|++|+|||+|++++.|++|
T Consensus       302 ~~C~~~C~k~C~~~~~~~~~~~~~~~~~~~~Ct~i~G~L~I~~~~g--~~~~~~~~~~l~~v~~Itg~L~i~~~~~l~~l  379 (897)
T 2dtg_E          302 TPCLGPCPKVCHLLEGEKTIDSVTSAQELRGCTVINGSLIINIRGG--NNLAAELEANLGLIEEISGYLKIRRSYALVSL  379 (897)
T ss_dssp             ECCCSSCCCEECCTTSCCCCCSHHHHHTTTTCCEESSCCEECCCCC--SSTHHHHHHHHTTCCEESSCEEEESCTTCSBG
T ss_pred             ccCCCCCCCCccccCCCceeechhhhHhhcCCeEECcEEEEEEcCC--CCccHHHHhhccCcEEEeEEEEEEEeccccch
Confidence            9999 999999    4678999999999999999999999999877  46778999999999999999999998899999


Q ss_pred             ccccccceecceeeeeeCCcccCCccCceEEEEEeCCCcccccCcCCCCCCCCCceeEecceEEEecCcccchhhhccce
Q psy2190         425 SFLKSLQSIHGEREIIRGDTSESSVYSNYSLIVWDNPNLQELWGWSNLPDGQRPKFEIKKGKILFHDNPKLCLDKIYELI  504 (976)
Q Consensus       425 ~fl~nL~~I~g~~~~~~~~~~~~~~~~~~~l~i~~n~~L~~l~~~~~~~~~~~~~~~i~~g~v~~~~N~~Lc~~~~~~~~  504 (976)
                      +||+||++|+|+.+          ..+.|+|+|++|++|+.||+++      ...++|.+|+|+|++|++||+.+|.+|.
T Consensus       380 ~~~~nL~~I~g~~~----------~~~~~~l~~~~n~~l~~l~~~~------~~~l~i~~G~v~i~~n~~LC~~~i~~~~  443 (897)
T 2dtg_E          380 SFFRKLRLIRGETL----------EIGNYSFYALDNQNLRQLWDWS------KHNLTITQGKLFFHYNPKLCLSEIHKME  443 (897)
T ss_dssp             GGGTTCCEECCTTC----------BTTTEEEEEESCTTCCBSCCTT------SCCCBCSSCEEEEESBTTSCHHHHHHHH
T ss_pred             hhccCccEEcCeec----------cCCCEEEEEEeccChhhhCccc------cCceEEccCEEEEEeCCcccccccccHH
Confidence            99999999999998          7789999999999999999986      3456899999999999999999999999


Q ss_pred             eccccccC-CccccccccCCCcccccceeeeE---EEeccceEEEEeeccCCCCCCC--c-eeEEEEEEEcCCCCccccc
Q psy2190         505 NVTNITYD-SDFDVLKESNGDEFICGFSNLAL---VVLNKTDVSIRFQLNENEKVPD--N-QRYVLFYMKADNGMYTDFD  577 (976)
Q Consensus       505 ~~~~~~~~-~~~~v~~~sNg~~~~C~~~~L~v---~vs~~si~~LsW~~~p~~~~~d--~-~gY~v~y~~~~~~n~t~~~  577 (976)
                      .+++...+ .+.++.+.+||+++.|....+++   .+++++|. |+|+  ++.. .+  . .+|.|+|++.+.+|+++++
T Consensus       444 ~~~g~~~~~~~~di~~~tNgd~~~C~~~~~~l~v~~~s~~sv~-LsW~--~p~~-~~~~~i~gY~V~y~~~~~~n~t~~~  519 (897)
T 2dtg_E          444 EVSGTKGRQERNDIALKTNGDQASCENELLKFSYIRTSFDKIL-LRWE--PYWP-PDFRDLLGFMLFYKEAPYQNVTEFD  519 (897)
T ss_dssp             HHTTCSSSCCSSSBCSTTBSTTCCCSCCBCCCSEEEECSSCEE-EECC--CCCS-SSCCCEEEECCCSSSCCTTTCCCCC
T ss_pred             HhcCCcccccccceehhhcCCccccccceeEEEEEEEecCeEE-EEec--CCCC-CCCceeeeEEEEEEeCCCCCccccc
Confidence            98877665 67788899999999999987766   88999999 9999  5543 23  2 8999999999889999999


Q ss_pred             CCCccCCCCcEEEecCCC----------CceEEeeCCccCceEEEEEEE-EeC-CC----CCCCCeEEEecCCCCCCCCc
Q psy2190         578 TVGSCSASGWKFKDINSK----------NKTVEVMNLEPATEYAFFVKI-YNS-QR----IVRSNISLQTTLPTKPSIPY  641 (976)
Q Consensus       578 ~~~~c~~~~W~~~~v~~~----------~~~~~l~~L~P~T~Y~~~V~a-~n~-g~----g~~S~~~~~~T~~~~Ps~P~  641 (976)
                      ++++|+++.|..+.+..+          .++++|.+|+|+|+|.|+|+| ++. |.    +++|+++.++|.+++|++|.
T Consensus       520 ~~~~c~~~~w~~~~~~~~~~~~~~~~~~~~~~~l~~L~P~T~Y~~~V~A~~n~~G~~~~~~~~S~~v~~~T~~~~Ps~P~  599 (897)
T 2dtg_E          520 GQDACGSNSWTVVDIDPPLRSNDPKSQNHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVPL  599 (897)
T ss_dssp             CCCCSCCCCCCCCCSCCEEEECCCCSSSCCEEEECSCCSSCBCCBEEEECCCCCSSCCCCCCBCCCBCCBCCCCCCCCCE
T ss_pred             CccccCCCcceEEecCCCccccccccccccceEeCCCCCCcEEEEEEEEEEeccCCccccCCccceEEEECCCCCCcCCc
Confidence            999999999998765432          478999999999999999999 887 55    78999999999999999999


Q ss_pred             eeEEEEecCcEEEEEecCCCCCCCceeEEEEEEEE-ecCcCcccccccccccc--ccCCCCCcchhccccccccccCCCC
Q psy2190         642 QFEVVRVNSSSVTLRWGEPKHPHGILEKYVIKAYY-QDYDKDYLDTRNYCVDK--LRDLSDSTYAASHLMRFAKTTRKPL  718 (976)
Q Consensus       642 ~l~~~~~s~tsi~vsW~pP~~~nG~I~~Y~V~~~~-~~~~~~~~~~~~~c~~~--~~~~~~~~~~~~~~~~~~~~~~~~~  718 (976)
                      ++++...++++|.|+|+||..+||.|++|+|  +| ....+..+..++||...  +|...+..   .+.+....+  +..
T Consensus       600 ~l~~~~~s~tsI~LsW~pP~~~nG~I~~Y~V--~~~~~~~~~~~~~~~~~~~~~l~p~t~Y~~---~V~A~~~~~--~s~  672 (897)
T 2dtg_E          600 DPISVSNSSSQIILKWKPPSDPNGNITHYLV--FWERQAEDSELFELDYCLKGLKLPSRTWSP---PFESEDSQK--HNQ  672 (897)
T ss_dssp             EEEEEECSSSCEEEEEECCCCSSSSCSEEEC--CEEEECCCCSCTTCSSSCSCCCCCC----------------------
T ss_pred             ceEEEeCCCCEEEEEEeCCCCCCCCeeEEEE--EEEECCCCccceecccccCCCcCCccccce---eeecccccC--ccc
Confidence            9999999999999999999999999999999  99 44444455577888653  23322222   111111100  111


Q ss_pred             cc-c-CCCCCCCCC-cc-----chhhhcccchhccccccceEEecccCCcccccCCCCCCCCcccCCCCCCCcceeeecc
Q psy2190         719 KE-C-CGKFPCDFD-HE-----SFQYMTSQMQLIQQCDNYIFKYLQYNDLHKAYGGDLPSLGNISSRLPDREENDVLYPE  790 (976)
Q Consensus       719 ~~-~-~~~~~c~c~-~~-----~~~~~~~~~~fe~~~~~~v~~~~~~~~~~~r~v~~~~~~~~~~~~~~~~~~~~v~~~~  790 (976)
                      .. . -...+|.|| .+     +.......+.|++..++.++.  +++.+.++.+....+.+   +.. ........++.
T Consensus       673 ~~~~~~~~~~~~~p~~p~~~~~~~~~~s~~~~W~~~~~n~v~~--~~p~~~r~~l~~~~n~t---~~~-~~~~~~~~~~~  746 (897)
T 2dtg_E          673 SEYEDSAGECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFV--PRPSRKRRSLGDVGNAG---NNE-EHRPFEKVVNK  746 (897)
T ss_dssp             ---------------------------------------------------------------------CCSCSCEECSC
T ss_pred             ccccccCCCccCCcCcccchhhhhhhhheeeeEEEccCceEEc--cCCCccccccccccccc---Ccc-ccceEEecCCc
Confidence            10 0 123455665 11     011111134477766666666  55544444443222211   000 01112233456


Q ss_pred             cEEEEcCCccccEEEEEEEEEecCccCCCCCCCCCCCCCCccceeEEecccCCCCCCCCCCeeEEEecCCcEEEEEecCC
Q psy2190         791 TSYTMVGLGHFRSIVFTISACRKEQKDKFLPYDPEEGRCSEETLVMSRTEVDHLADTIPADSLNFEMINASALRIRWHPP  870 (976)
Q Consensus       791 ~~~~l~gL~p~T~Y~~~V~A~~~~~~~~~~~~~~~~~g~s~~~~~~~~T~~~~~~~~~p~~v~~~~~~~~~sv~l~W~~P  870 (976)
                      ++++|.+|+|+|.|.|+|+|++..         |.+..+|.+..+.++|.+...++.+|.++.+...+. ++|.|+|++|
T Consensus       747 t~~~i~gL~p~t~Y~~~V~A~n~~---------G~g~~~s~s~~v~~~T~~~~~~p~~P~~l~~~~~~~-~sv~LsW~~P  816 (897)
T 2dtg_E          747 ESLVISGLRHFTGYRIELQACNQD---------TPEERCSVAAYVSARTMPEAKADDIVGPVTHEIFEN-NVVHLMWQEP  816 (897)
T ss_dssp             SEEEECSSCSSCEEEECCEEESCS---------SSSCCBCCCCCEEEECCCCCCCCCCCCCCCCCSSSS-SCCCCCCCCC
T ss_pred             eEEEECCCCCCcEEEEEEEEEeCC---------CCCCCCCCCceeEEeccCccCCCCCCcceEEEeCCC-CEEEEEECCC
Confidence            899999999999999999999998         444445677788899987666777888887777666 8999999999


Q ss_pred             CCCCCceEEEEEEEEEcCCCCcceeeeeeccccCCCcEEEeecCCceEEEEEEEEeCCCCCCCCCcEeEEEecCC
Q psy2190         871 SRPNGIIVAYNIEYKRESGGNSENMCRTRKDIDRDSGLYLYDYPAGSYLFRLRVVSLGGEGPWTSWKPCVIESAE  945 (976)
Q Consensus       871 ~~~NG~I~~Y~I~y~~~~~~~~~~~~v~~~~~~~~~~~~l~~L~pg~Y~~~V~A~t~aG~G~~S~~~~~~~~~~~  945 (976)
                      ..+||.|++|.|+|+..+.. +...++.+..+...+++.|.+|.||+|.|+|+|.|.+|.|++|+++.|++++++
T Consensus       817 ~~~nG~I~~Y~V~y~~~~~~-~~~~~~~~~~~~~~~~~~l~~L~pgtY~~rV~A~n~~G~G~~S~~v~~~T~~~p  890 (897)
T 2dtg_E          817 KEPNGLIVLYEVSYRRYGDE-ELHLCDTRKHFALERGCRLRGLSPGNYSVRIRATSLAGNGSWTEPTYFYVTDYL  890 (897)
T ss_dssp             CSCSSCEEEECCCCBSSSBC-CCCCCCCSSSCCCTTCCCCCSCCSSEECCCCCEEETTBCCCCCCCCEECCCCCC
T ss_pred             CCCCCCEEEEEEEEEECCCc-ceEEEEeeeeecccCcEEECCCCCCcEEEEEEEEeCCcccCCCCCEEEEeCCCC
Confidence            99999999999999877652 434444443344566899999999999999999999999999999999998765
>2hr7_A Insulin receptor; hormone receptor, leucine rich repeat, transferase; HET: NAG BMA MAN FUC P33; 2.32A {Homo sapiens} Back     alignment and structure
>1igr_A Insulin-like growth factor receptor 1; hormone receptor, insulin receptor family; HET: NAG FUC BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 Back     alignment and structure
>1mox_A Epidermal growth factor receptor; EGFR, receptor, complex, transferase-growth F complex; HET: NAG FUC BMA MAN; 2.50A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 Back     alignment and structure
>1n8y_C Protooncoprotein; tyrosin kinase receptor, cell surface receptor, transferase; HET: NAG; 2.40A {Rattus norvegicus} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 1n8z_C* 3be1_A* 1s78_A* 3mzw_A* 3n85_A* 2a91_A* 3h3b_A Back     alignment and structure
>3i2t_A Epidermal growth factor receptor, isoform A; EGFR, ectodomain, unliganded, autoinhibited, ATP nucleotide-binding, tyrosine-protein kinase; HET: NDG NAG BMA; 2.70A {Drosophila melanogaster} PDB: 3ltf_A* 3ltg_A Back     alignment and structure
>1m6b_A C-ER, receptor protein-tyrosine kinase ERBB-3; cell surface receptor, immunity, signaling transferase; HET: NAG NDG; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3p11_A* Back     alignment and structure
>1yy9_A Epidermal growth factor receptor; cell surface receptor, tyrosine kinase, glycoprotein, antigen:antibody complex, FAB fragment, antitumor, drug; HET: NDG NAG BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3qwq_A* 1nql_A* 3b2v_A* 1ivo_A* 3njp_A* Back     alignment and structure
>2ahx_A P180ERBB4, receptor tyrosine-protein kinase ERBB-4; X-RAY crystallography, neuregulins, heparin-binding, cell CY signaling protein; HET: NAG NDG; 2.40A {Homo sapiens} PDB: 3u2p_A* Back     alignment and structure
>1yy9_A Epidermal growth factor receptor; cell surface receptor, tyrosine kinase, glycoprotein, antigen:antibody complex, FAB fragment, antitumor, drug; HET: NDG NAG BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3qwq_A* 1nql_A* 3b2v_A* 1ivo_A* 3njp_A* Back     alignment and structure
>1m6b_A C-ER, receptor protein-tyrosine kinase ERBB-3; cell surface receptor, immunity, signaling transferase; HET: NAG NDG; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 3p11_A* Back     alignment and structure
>2ahx_A P180ERBB4, receptor tyrosine-protein kinase ERBB-4; X-RAY crystallography, neuregulins, heparin-binding, cell CY signaling protein; HET: NAG NDG; 2.40A {Homo sapiens} PDB: 3u2p_A* Back     alignment and structure
>1n8y_C Protooncoprotein; tyrosin kinase receptor, cell surface receptor, transferase; HET: NAG; 2.40A {Rattus norvegicus} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 PDB: 1n8z_C* 3be1_A* 1s78_A* 3mzw_A* 3n85_A* 2a91_A* 3h3b_A Back     alignment and structure
>3i2t_A Epidermal growth factor receptor, isoform A; EGFR, ectodomain, unliganded, autoinhibited, ATP nucleotide-binding, tyrosine-protein kinase; HET: NDG NAG BMA; 2.70A {Drosophila melanogaster} PDB: 3ltf_A* 3ltg_A Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Back     alignment and structure
>3p0y_A Epidermal growth factor receptor; beta-sandwich, antigens EGFR, immune system; HET: NAG FUL; 1.80A {Homo sapiens} PDB: 3b2u_A* 3c09_A* Back     alignment and structure
>1mox_A Epidermal growth factor receptor; EGFR, receptor, complex, transferase-growth F complex; HET: NAG FUC BMA MAN; 2.50A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 g.3.9.1 Back     alignment and structure
>2hr7_A Insulin receptor; hormone receptor, leucine rich repeat, transferase; HET: NAG BMA MAN FUC P33; 2.32A {Homo sapiens} Back     alignment and structure
>1igr_A Insulin-like growth factor receptor 1; hormone receptor, insulin receptor family; HET: NAG FUC BMA MAN; 2.60A {Homo sapiens} SCOP: c.10.2.5 c.10.2.5 g.3.9.1 Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3p0y_A Epidermal growth factor receptor; beta-sandwich, antigens EGFR, immune system; HET: NAG FUL; 1.80A {Homo sapiens} PDB: 3b2u_A* 3c09_A* Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Back     alignment and structure
>3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Back     alignment and structure
>2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Back     alignment and structure
>1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Back     alignment and structure
>1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Back     alignment and structure
>3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Back     alignment and structure
>1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Back     alignment and structure
>1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Back     alignment and structure
>3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Back     alignment and structure
>3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Back     alignment and structure
>1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Back     alignment and structure
>2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Back     alignment and structure
>2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Back     alignment and structure
>1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Back     alignment and structure
>2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Back     alignment and structure
>2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Back     alignment and structure
>1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Back     alignment and structure
>2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Back     alignment and structure
>3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Back     alignment and structure
>2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Back     alignment and structure
>2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Back     alignment and structure
>1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Back     alignment and structure
>3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Back     alignment and structure
>1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Back     alignment and structure
>1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Back     alignment and structure
>3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Back     alignment and structure
>1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Back     alignment and structure
>1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I Back     alignment and structure
>3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* Back     alignment and structure
>3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* Back     alignment and structure
>2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... Back     alignment and structure
>1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Back     alignment and structure
>3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... Back     alignment and structure
>3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} Back     alignment and structure
>3bes_R Interferon-gamma binding protein C4R; orthopoxvirus, protein complex antiviral defense, cytokine, glycoprotein, receptor, immune; HET: NAG BMA; 2.20A {Ectromelia virus} Back     alignment and structure
>2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Back     alignment and structure
>3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A Back     alignment and structure
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Back     alignment and structure
>3bes_R Interferon-gamma binding protein C4R; orthopoxvirus, protein complex antiviral defense, cytokine, glycoprotein, receptor, immune; HET: NAG BMA; 2.20A {Ectromelia virus} Back     alignment and structure
>4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>1du3_A Death receptor 5; trail, DR5, complex; 2.20A {Homo sapiens} SCOP: g.24.1.1 g.24.1.1 g.24.1.1 PDB: 1d0g_R 2h9g_R 1za3_R 1d4v_A Back     alignment and structure
>2hey_R Tumor necrosis factor receptor superfamily member; cytokine, receptor-ligan complex, CO-stimulator, TNFSF; 2.00A {Homo sapiens} SCOP: g.24.1.1 g.24.1.1 g.24.1.1 PDB: 2hev_R Back     alignment and structure
>3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* Back     alignment and structure
>3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A Back     alignment and structure
>2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* Back     alignment and structure
>3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A Back     alignment and structure
>4go6_A HCF N-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 976
d2dtge4153 c.10.2.5 (E:4-156) Insulin receptor {Human (Homo s 6e-38
d2dtge4153 c.10.2.5 (E:4-156) Insulin receptor {Human (Homo s 1e-24
d1igra1149 c.10.2.5 (A:1-149) Type 1 insulin-like growth fact 1e-34
d1igra1149 c.10.2.5 (A:1-149) Type 1 insulin-like growth fact 2e-21
d2dtge5156 c.10.2.5 (E:312-467) Insulin receptor {Human (Homo 8e-33
d2dtge5156 c.10.2.5 (E:312-467) Insulin receptor {Human (Homo 1e-22
d1igra2179 c.10.2.5 (A:300-478) Type 1 insulin-like growth fa 4e-32
d1igra2179 c.10.2.5 (A:300-478) Type 1 insulin-like growth fa 2e-21
d3b2ua1169 c.10.2.5 (A:312-480) EGF receptor extracellular do 2e-29
d3b2ua1169 c.10.2.5 (A:312-480) EGF receptor extracellular do 5e-24
d1m6ba2169 c.10.2.5 (A:311-479) Receptor protein-tyrosine kin 3e-28
d1m6ba2169 c.10.2.5 (A:311-479) Receptor protein-tyrosine kin 3e-25
d1n8yc2166 c.10.2.5 (C:323-488) Protooncoprotein Her2 extrace 5e-27
d1n8yc2166 c.10.2.5 (C:323-488) Protooncoprotein Her2 extrace 4e-25
d1moxa1162 c.10.2.5 (A:1-162) EGF receptor extracellular doma 3e-24
d1moxa1162 c.10.2.5 (A:1-162) EGF receptor extracellular doma 8e-18
d1m6ba1158 c.10.2.5 (A:8-165) Receptor protein-tyrosine kinas 3e-24
d1m6ba1158 c.10.2.5 (A:8-165) Receptor protein-tyrosine kinas 1e-21
d1n8yc1165 c.10.2.5 (C:1-165) Protooncoprotein Her2 extracell 2e-23
d1n8yc1165 c.10.2.5 (C:1-165) Protooncoprotein Her2 extracell 6e-19
d1nqla4134 g.3.9.1 (A:481-614) EGF receptor Cys-rich domains 5e-11
d1nqla4134 g.3.9.1 (A:481-614) EGF receptor Cys-rich domains 5e-04
d1n8yc4120 g.3.9.1 (C:489-608) Protooncoprotein Her2 extracel 1e-10
d1n8yc4120 g.3.9.1 (C:489-608) Protooncoprotein Her2 extracel 9e-07
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 3e-10
d2dtge2196 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo 7e-07
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 7e-09
d1wfna1106 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) 1e-06
d1igra3150 g.3.9.1 (A:150-299) Type 1 insulin-like growth fac 1e-08
d2dtge6155 g.3.9.1 (E:157-311) Insulin receptor {Human (Homo 2e-08
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 9e-08
d1x5ga1103 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ 2e-04
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 9e-08
d1x5la198 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human 5e-05
d1m6ba4101 g.3.9.1 (A:480-580) Receptor protein-tyrosine kina 5e-07
d1m6ba4101 g.3.9.1 (A:480-580) Receptor protein-tyrosine kina 4e-06
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 1e-06
d2dn7a194 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p 0.003
d1va9a1109 b.1.2.1 (A:8-116) Down syndrome cell adhesion mole 5e-06
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 6e-06
d1x3da1105 b.1.2.1 (A:8-112) Fibronectin type-III domain cont 4e-05
d1s78a476 g.3.9.1 (A:489-564) Protooncoprotein Her2 extracel 6e-06
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 7e-06
d1x5za1102 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p 0.001
d1x5ha1119 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ 7e-06
d1x4za1108 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { 8e-06
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 9e-06
d1wfoa1117 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) 1e-04
d2dtge1102 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo 9e-06
d1m6ba3145 g.3.9.1 (A:166-310) Receptor protein-tyrosine kina 1e-05
d1moxa3149 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains 1e-05
d1wfta_123 b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus 2e-05
d2crza197 b.1.2.1 (A:8-104) Fibronectin type-III domain cont 5e-05
d1y6kr199 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10 6e-05
d1wf5a1108 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) 1e-04
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 2e-04
d1uena_125 b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens 0.004
d1x5ka1111 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ 2e-04
d1cd9b2106 b.1.2.1 (B:108-213) Granulocyte colony-stimulating 3e-04
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 8e-04
d1uema_117 b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens 9e-04
d1fnfa389 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m 0.001
d1x5fa1107 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ 0.001
d2dtge3125 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo 0.001
d2d9qb2105 b.1.2.1 (B:204-308) Granulocyte colony-stimulating 0.002
d1f6fb2103 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu 0.002
>d2dtge4 c.10.2.5 (E:4-156) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: L domain
domain: Insulin receptor
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  137 bits (345), Expect = 6e-38
 Identities = 56/150 (37%), Positives = 91/150 (60%), Gaps = 10/150 (6%)

Query: 62  KVCTDIDIRNYVSSFDVLKDCTVVEGFVQINLIDNSTAQDFENITFPKLREITEYLSFYH 121
           +VC  +DIRN ++    L++C+V+EG +QI L+  +  +DF +++FPKL  IT+YL  + 
Sbjct: 3   EVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDYLLLFR 62

Query: 122 VSGLKSIGKLFPNLAIIRGNTLIWDYTFSVFSMFNLQEIGLHRLTHIMKGTVVILRNP-- 179
           V GL+S+  LFPNL +IRG+ L ++Y   +F M +L+E+GL+ L +I +G+V I +N   
Sbjct: 63  VYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIEKNNEL 122

Query: 180 ------DWKRITKKGS--VVINDIKSKEAC 201
                 DW RI        ++ +    E C
Sbjct: 123 CYLATIDWSRILDSVEDNHIVLNKDDNEEC 152
>d2dtge4 c.10.2.5 (E:4-156) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 153 Back     information, alignment and structure
>d1igra1 c.10.2.5 (A:1-149) Type 1 insulin-like growth factor receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1igra1 c.10.2.5 (A:1-149) Type 1 insulin-like growth factor receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d2dtge5 c.10.2.5 (E:312-467) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2dtge5 c.10.2.5 (E:312-467) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1igra2 c.10.2.5 (A:300-478) Type 1 insulin-like growth factor receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Length = 179 Back     information, alignment and structure
>d1igra2 c.10.2.5 (A:300-478) Type 1 insulin-like growth factor receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Length = 179 Back     information, alignment and structure
>d3b2ua1 c.10.2.5 (A:312-480) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d3b2ua1 c.10.2.5 (A:312-480) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1m6ba2 c.10.2.5 (A:311-479) Receptor protein-tyrosine kinase Erbb-3 extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1m6ba2 c.10.2.5 (A:311-479) Receptor protein-tyrosine kinase Erbb-3 extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1n8yc2 c.10.2.5 (C:323-488) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 166 Back     information, alignment and structure
>d1n8yc2 c.10.2.5 (C:323-488) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 166 Back     information, alignment and structure
>d1moxa1 c.10.2.5 (A:1-162) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1moxa1 c.10.2.5 (A:1-162) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1m6ba1 c.10.2.5 (A:8-165) Receptor protein-tyrosine kinase Erbb-3 extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Length = 158 Back     information, alignment and structure
>d1m6ba1 c.10.2.5 (A:8-165) Receptor protein-tyrosine kinase Erbb-3 extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Length = 158 Back     information, alignment and structure
>d1n8yc1 c.10.2.5 (C:1-165) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 165 Back     information, alignment and structure
>d1n8yc1 c.10.2.5 (C:1-165) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 165 Back     information, alignment and structure
>d1nqla4 g.3.9.1 (A:481-614) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Length = 134 Back     information, alignment and structure
>d1nqla4 g.3.9.1 (A:481-614) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Length = 134 Back     information, alignment and structure
>d1n8yc4 g.3.9.1 (C:489-608) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 120 Back     information, alignment and structure
>d1n8yc4 g.3.9.1 (C:489-608) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 120 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1igra3 g.3.9.1 (A:150-299) Type 1 insulin-like growth factor receptor Cys-rich domain {Human (Homo sapiens) [TaxId: 9606]} Length = 150 Back     information, alignment and structure
>d2dtge6 g.3.9.1 (E:157-311) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 155 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1m6ba4 g.3.9.1 (A:480-580) Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1m6ba4 g.3.9.1 (A:480-580) Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1s78a4 g.3.9.1 (A:489-564) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1m6ba3 g.3.9.1 (A:166-310) Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Length = 145 Back     information, alignment and structure
>d1moxa3 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Length = 149 Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query976
d1igra2179 Type 1 insulin-like growth factor receptor extrace 99.96
d2dtge4153 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.96
d1igra1149 Type 1 insulin-like growth factor receptor extrace 99.95
d1m6ba2169 Receptor protein-tyrosine kinase Erbb-3 extracellu 99.94
d3b2ua1169 EGF receptor extracellular domain {Human (Homo sap 99.94
d1n8yc2166 Protooncoprotein Her2 extracellular domain {Rat (R 99.94
d2dtge5156 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.94
d1m6ba2169 Receptor protein-tyrosine kinase Erbb-3 extracellu 99.93
d1igra2179 Type 1 insulin-like growth factor receptor extrace 99.93
d1m6ba1158 Receptor protein-tyrosine kinase Erbb-3 extracellu 99.93
d3b2ua1169 EGF receptor extracellular domain {Human (Homo sap 99.92
d1moxa1162 EGF receptor extracellular domain {Human (Homo sap 99.92
d1n8yc1165 Protooncoprotein Her2 extracellular domain {Rat (R 99.92
d1n8yc2166 Protooncoprotein Her2 extracellular domain {Rat (R 99.92
d1igra1149 Type 1 insulin-like growth factor receptor extrace 99.91
d2dtge4153 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.9
d1moxa1162 EGF receptor extracellular domain {Human (Homo sap 99.88
d1m6ba1158 Receptor protein-tyrosine kinase Erbb-3 extracellu 99.88
d1n8yc1165 Protooncoprotein Her2 extracellular domain {Rat (R 99.87
d2dtge5156 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.84
d1nqla4134 EGF receptor Cys-rich domains {Human (Homo sapiens 99.65
d1n8yc4120 Protooncoprotein Her2 extracellular domain {Rat (R 99.63
d1m6ba4101 Receptor protein-tyrosine kinase Erbb-3 Cys-rich d 99.52
d2dtge6155 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.43
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.42
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.4
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.39
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.39
d1igra3150 Type 1 insulin-like growth factor receptor Cys-ric 99.37
d1wfoa1117 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.34
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.34
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.33
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.33
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.3
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.28
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.26
d1x5ga1103 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.26
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.26
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.26
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.25
d1x5ha1119 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.25
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.24
d1wfna1106 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.24
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.23
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.21
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.21
d2crza197 Fibronectin type-III domain containing protein 3a, 99.21
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.2
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.2
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.2
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.18
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.18
d1x5za1102 Receptor-type tyrosine-protein phosphatase delta, 99.18
d1s78a476 Protooncoprotein Her2 extracellular domain {Human 99.17
d1x3da1105 Fibronectin type-III domain containing protein 3a, 99.17
d1x5la198 Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta 99.16
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.16
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.15
d1x5xa196 Fibronectin type-III domain containing protein 3a, 99.15
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.15
d2vkwa293 Neural cell adhesion molecule 1, NCAM {Human (Homo 99.15
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 99.15
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 99.14
d1wj3a_117 Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI 99.13
d2djsa195 Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta 99.13
d1va9a1109 Down syndrome cell adhesion molecule-like protein 99.13
d2dtge2196 Insulin receptor {Human (Homo sapiens) [TaxId: 960 99.12
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.12
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 99.11
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.1
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.09
d1wf5a1108 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 99.09
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.09
d1x5ka1111 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.09
d1qg3a2103 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.08
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 99.06
d1qg3a192 Integrin beta-4 subunit {Human (Homo sapiens) [Tax 99.06
d1x5ya198 Myosin binding protein C, fast-type {Mouse (Mus mu 99.06
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 99.06
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 99.06
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 99.05
d2dn7a194 Receptor-type tyrosine-protein phosphatase F, PTPR 99.05
d1wfta_123 Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T 99.05
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.05
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 99.05
d2crma1107 Fibronectin type-III domain containing protein 3a, 99.04
d1x4xa193 Fibronectin type-III domain containing protein 3a, 99.04
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 99.03
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 99.03
d1x5fa1107 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 99.02
d1x5aa194 Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta 99.01
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 99.01
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 99.01
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 99.01
d1cfba2105 Neuroglian, two amino proximal Fn3 repeats {Drosop 99.0
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 99.0
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 98.98
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 98.98
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 98.98
d1ujta_120 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 98.98
d1wisa1111 Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} 98.98
d1uema_117 KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 98.97
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.95
d1uena_125 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 98.95
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 98.95
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 98.93
d1x5ia1113 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.93
d2crza197 Fibronectin type-III domain containing protein 3a, 98.93
d1x4za1108 Brother of CDO precursor (BOC) {Mouse (Mus musculu 98.93
d1x5xa196 Fibronectin type-III domain containing protein 3a, 98.92
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 98.92
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 98.92
d2dtge3125 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.91
d1ueya_127 KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 98.91
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 98.91
d1k85a_88 Fibronectin type III domain from chitinase A1. {Ba 98.89
d1cfba1100 Neuroglian, two amino proximal Fn3 repeats {Drosop 98.89
d1x4ya1101 Brother of CDO precursor (BOC) {Mouse (Mus musculu 98.89
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.87
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 98.87
d1v5ja_108 KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} 98.87
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.87
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 98.86
d2haza1101 Neural cell adhesion molecule 1, NCAM {Human (Homo 98.85
d1x5ja1100 Neogenin {Human (Homo sapiens) [TaxId: 9606]} 98.85
d1tdqa292 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.85
d2ibga195 Hedgehog receptor iHog {Fruit fly (Drosophila mela 98.84
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 98.84
d1bpva_104 Type I titin module {Human (Homo sapiens) [TaxId: 98.83
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 98.83
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 98.83
d2fnba_95 Fibronectin, different Fn3 modules {Human (Homo sa 98.82
d1m6ba3145 Receptor protein-tyrosine kinase Erbb-3 Cys-rich d 98.82
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 98.81
d1moxa3149 EGF receptor Cys-rich domains {Human (Homo sapiens 98.8
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.8
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 98.8
d2d9qb2105 Granulocyte colony-stimulating factor (GC-SF) rece 98.8
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.8
d1fnaa_91 Fibronectin, different Fn3 modules {Human (Homo sa 98.79
d2ic2a1107 Hedgehog receptor iHog {Fruit fly (Drosophila mela 98.79
d1fnfa389 Fibronectin, different Fn3 modules {Human (Homo sa 98.79
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 98.79
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 98.78
d1qr4a187 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 98.78
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 98.78
d1cd9b2106 Granulocyte colony-stimulating factor (GC-SF) rece 98.78
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 98.77
d2cuma193 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.76
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 98.76
d1fnfa194 Fibronectin, different Fn3 modules {Human (Homo sa 98.76
d1tena_90 Tenascin {Human (Homo sapiens) [TaxId: 9606]} 98.75
d1qr4a288 Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} 98.75
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 98.74
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.74
d1wk0a_137 Fibronectin type-III domain containing protein 3a, 98.73
d1fnfa291 Fibronectin, different Fn3 modules {Human (Homo sa 98.73
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 98.73
d1owwa_93 Fibronectin, different Fn3 modules {Human (Homo sa 98.73
d1j8ka_94 Fibronectin, different Fn3 modules {Human (Homo sa 98.72
d1wfua_120 Fibronectin type 3 and ankyrin repeat domains 1 pr 98.72
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.71
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 98.71
d1fnha290 Fibronectin, different Fn3 modules {Human (Homo sa 98.71
d1fnha389 Fibronectin, different Fn3 modules {Human (Homo sa 98.71
d1fnha190 Fibronectin, different Fn3 modules {Human (Homo sa 98.71
d2cuha1102 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.71
d1tdqa386 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.7
d2b5ib2104 Interleukin-2 receptor beta chain {Human (Homo sap 98.69
d1bqua2115 Cytokine receptor gp130 cytokine-binding domains { 98.69
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 98.67
d1tdqa193 Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} 98.65
d2dtge1102 Insulin receptor {Human (Homo sapiens) [TaxId: 960 98.65
d2cspa1117 Rim binding protein 2 {Human (Homo sapiens) [TaxId 98.63
d3d48r2104 Prolactin receptor {Human (Homo sapiens) [TaxId: 9 98.63
d1f6fb2103 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 98.63
d1axib2106 Growth hormone receptor {Human (Homo sapiens) [Tax 98.59
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 98.59
d2b5ic195 Cytokine receptor common gamma chain {Human (Homo 98.57
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 98.56
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.54
d1n26a3104 Interleukin-6 receptor alpha chain, domains 2 and 98.54
d1bqua195 Cytokine receptor gp130 cytokine-binding domains { 98.52
d2cuia1101 Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} 98.52
d1nqla4134 EGF receptor Cys-rich domains {Human (Homo sapiens 98.45
d2gysa2114 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.45
d1iarb2101 Interleukin-4 receptor alpha chain {Human (Homo sa 98.43
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 98.42
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 98.39
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 98.39
d1cd9b1107 Granulocyte colony-stimulating factor (GC-SF) rece 98.37
d1erna2105 Erythropoietin (EPO) receptor {Human (Homo sapiens 98.36
d1n8yc4120 Protooncoprotein Her2 extracellular domain {Rat (R 98.34
d1n8yc3157 Protooncoprotein Her2 extracellular domain {Rat (R 98.31
d1m6ba4101 Receptor protein-tyrosine kinase Erbb-3 Cys-rich d 98.3
d1uc6a_109 Ciliary neurotrophic factor receptor alpha {Human 98.29
d1s78a476 Protooncoprotein Her2 extracellular domain {Human 98.23
d2gysa4100 Common beta-chain in the GM-CSF, IL-3 and IL-5 rec 98.01
d1m6ba3145 Receptor protein-tyrosine kinase Erbb-3 Cys-rich d 97.92
d1fyhb198 Interferon-gamma receptor alpha chain {Human (Homo 97.84
d1moxa3149 EGF receptor Cys-rich domains {Human (Homo sapiens 97.72
d3d85d394 The p40 domain of interleukin-12 (IL-12 beta chain 97.66
d1y6kr199 Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa 97.61
d3b2ua226 EGF receptor Cys-rich domains {Human (Homo sapiens 97.56
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 96.2
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 95.91
d2hfta1106 Extracellular region of human tissue factor {Human 94.96
d1n8yc3157 Protooncoprotein Her2 extracellular domain {Rat (R 94.86
d2qfra1112 Purple acid phosphatase, N-terminal domain {Kidney 94.77
d1a21a1103 Extracellular region of human tissue factor {Rabbi 94.46
d1xzwa1119 Purple acid phosphatase, N-terminal domain {Sweet 93.87
d2hyma1109 Interferon-alpha/beta receptor beta chain {Human ( 93.21
d2dtge6155 Insulin receptor {Human (Homo sapiens) [TaxId: 960 93.16
d2c4fu1116 Extracellular region of human tissue factor {Human 93.06
d2hyma1109 Interferon-alpha/beta receptor beta chain {Human ( 90.19
d1igra3150 Type 1 insulin-like growth factor receptor Cys-ric 89.97
d2c4fu1116 Extracellular region of human tissue factor {Human 84.45
d1f6fb196 Prolactin receptor {Rat (Rattus norvegicus) [TaxId 83.33
d2hfta1106 Extracellular region of human tissue factor {Human 83.25
>d1igra2 c.10.2.5 (A:300-478) Type 1 insulin-like growth factor receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: L domain
domain: Type 1 insulin-like growth factor receptor extracellular domain
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.96  E-value=1.4e-30  Score=257.05  Aligned_cols=162  Identities=40%  Similarity=0.647  Sum_probs=141.8

Q ss_pred             CCCCCCcceeeccccccccCCCeEEcCceEEEEecCCCchhHHHHHHhhccceeeeeEEEEEeecCccccccccccceec
Q psy2190         355 CPKVCKGVHVKSIEVARSTKGCTVINGSLGIQIQTGDSEVVHQELEKGLGMITNITGHLKISHSLPIQSLSFLKSLQSIH  434 (976)
Q Consensus       355 C~~~C~g~~~~~~~~~~~~~~C~~i~G~l~i~~~~g~~~~~~~~l~~~l~~i~~I~G~L~i~~s~~l~~l~fl~nL~~I~  434 (976)
                      |++.|.|..|+++++++.++|||+|.|+|.|.+..+  .+...+++.+|++|++|+|||.|++++.|+||+||+|||+|+
T Consensus         3 C~~~~~~~~I~s~~~~~~l~~CTvI~G~L~I~~~~~--~~~~~~l~~~l~~l~eItGyL~I~~s~~L~sL~fL~nL~~Ir   80 (179)
T d1igra2           3 CEEEKKTKTIDSVTSAQMLQGCTIFKGNLLINIRRG--NNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLIL   80 (179)
T ss_dssp             EEEEEEEEEECSSGGGSTTTTCSEEEEEEEECCCCC--SSCSSTTHHHHTTCCEESSCEEEESCTTCSCSTTCCSCCEEC
T ss_pred             CCCcCCCcEEecHhhHHhCCCCEEEeCEEEEEEecC--CCchHHHHhhcCCcEEEEEEEEEEEcCCccchhhhcCccEEe
Confidence            567789999999999999999999999999987765  344557888999999999999999988999999999999999


Q ss_pred             ceeeeeeCCcccCCccCceEEEEEeCCCcccccCcCCCCCCCCCceeEecceEEEecCcccchhhhccceeccccccC-C
Q psy2190         435 GEREIIRGDTSESSVYSNYSLIVWDNPNLQELWGWSNLPDGQRPKFEIKKGKILFHDNPKLCLDKIYELINVTNITYD-S  513 (976)
Q Consensus       435 g~~~~~~~~~~~~~~~~~~~l~i~~n~~L~~l~~~~~~~~~~~~~~~i~~g~v~~~~N~~Lc~~~~~~~~~~~~~~~~-~  513 (976)
                      |+.+          .+..|||+|.+|++|+.||+++      .+.++|.+|+|+|++||+|||.++.+|.++++..+. .
T Consensus        81 G~~l----------~~~~yaL~I~~N~~L~~L~~~~------l~~l~I~~G~v~i~~Np~LC~~~~i~w~~i~~~~~~~~  144 (179)
T d1igra2          81 GEEQ----------LEGNYSFYVLDNQNLQQLWDWD------HRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQS  144 (179)
T ss_dssp             CSSC----------BTTTEEEEEECCSSCCCSSCTT------TCCCEESSCEEEEESBTTSCHHHHHHHHHHHTCTTCCC
T ss_pred             Cccc----------ccCceeEEEEeCCCcccccccc------CCceEeeccEEEEecCccccCcChhhHHHHhCCCCccc
Confidence            9998          7788999999999999999987      334579999999999999999999999999887665 6


Q ss_pred             ccccccccCCCcccccceeee
Q psy2190         514 DFDVLKESNGDEFICGFSNLA  534 (976)
Q Consensus       514 ~~~v~~~sNg~~~~C~~~~L~  534 (976)
                      +.++...+||+++.|...-++
T Consensus       145 ~~~v~~~~Ng~~~~C~~~~l~  165 (179)
T d1igra2         145 KGDINTRNNGERASCESDVDD  165 (179)
T ss_dssp             SSSBCTTTBSTTSCCC-----
T ss_pred             eeeeccccCCCCCCCCCcccc
Confidence            778888999999999987654
>d2dtge4 c.10.2.5 (E:4-156) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igra1 c.10.2.5 (A:1-149) Type 1 insulin-like growth factor receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ba2 c.10.2.5 (A:311-479) Receptor protein-tyrosine kinase Erbb-3 extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b2ua1 c.10.2.5 (A:312-480) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n8yc2 c.10.2.5 (C:323-488) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dtge5 c.10.2.5 (E:312-467) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ba2 c.10.2.5 (A:311-479) Receptor protein-tyrosine kinase Erbb-3 extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igra2 c.10.2.5 (A:300-478) Type 1 insulin-like growth factor receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ba1 c.10.2.5 (A:8-165) Receptor protein-tyrosine kinase Erbb-3 extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b2ua1 c.10.2.5 (A:312-480) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxa1 c.10.2.5 (A:1-162) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n8yc1 c.10.2.5 (C:1-165) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n8yc2 c.10.2.5 (C:323-488) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1igra1 c.10.2.5 (A:1-149) Type 1 insulin-like growth factor receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge4 c.10.2.5 (E:4-156) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxa1 c.10.2.5 (A:1-162) EGF receptor extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ba1 c.10.2.5 (A:8-165) Receptor protein-tyrosine kinase Erbb-3 extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n8yc1 c.10.2.5 (C:1-165) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dtge5 c.10.2.5 (E:312-467) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqla4 g.3.9.1 (A:481-614) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n8yc4 g.3.9.1 (C:489-608) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m6ba4 g.3.9.1 (A:480-580) Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge6 g.3.9.1 (E:157-311) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igra3 g.3.9.1 (A:150-299) Type 1 insulin-like growth factor receptor Cys-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s78a4 g.3.9.1 (A:489-564) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Back     information, alignment and structure
>d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ba3 g.3.9.1 (A:166-310) Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxa3 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqla4 g.3.9.1 (A:481-614) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n8yc4 g.3.9.1 (C:489-608) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1n8yc3 g.3.9.1 (C:166-322) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m6ba4 g.3.9.1 (A:480-580) Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s78a4 g.3.9.1 (A:489-564) Protooncoprotein Her2 extracellular domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6ba3 g.3.9.1 (A:166-310) Receptor protein-tyrosine kinase Erbb-3 Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxa3 g.3.9.1 (A:163-311) EGF receptor Cys-rich domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n8yc3 g.3.9.1 (C:166-322) Protooncoprotein Her2 extracellular domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} Back     information, alignment and structure
>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dtge6 g.3.9.1 (E:157-311) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igra3 g.3.9.1 (A:150-299) Type 1 insulin-like growth factor receptor Cys-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure