Psyllid ID: psy221
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 205 | ||||||
| 389609465 | 146 | glutaredoxin [Papilio xuthus] | 0.619 | 0.869 | 0.651 | 1e-43 | |
| 195457355 | 166 | GK18554 [Drosophila willistoni] gi|19417 | 0.580 | 0.716 | 0.616 | 6e-40 | |
| 195133576 | 163 | GI16412 [Drosophila mojavensis] gi|19390 | 0.585 | 0.736 | 0.619 | 2e-39 | |
| 156546246 | 142 | PREDICTED: glutaredoxin-related protein | 0.473 | 0.683 | 0.742 | 6e-39 | |
| 383849979 | 134 | PREDICTED: glutaredoxin-related protein | 0.492 | 0.753 | 0.745 | 6e-39 | |
| 24642023 | 159 | CG14407 [Drosophila melanogaster] gi|195 | 0.473 | 0.610 | 0.721 | 1e-38 | |
| 350406647 | 134 | PREDICTED: glutaredoxin-related protein | 0.536 | 0.820 | 0.669 | 1e-38 | |
| 340721707 | 163 | PREDICTED: glutaredoxin-related protein | 0.619 | 0.779 | 0.538 | 1e-38 | |
| 195354579 | 158 | GM12034 [Drosophila sechellia] gi|194129 | 0.551 | 0.715 | 0.637 | 2e-38 | |
| 195397435 | 163 | GJ17033 [Drosophila virilis] gi|19414710 | 0.585 | 0.736 | 0.595 | 2e-38 |
| >gi|389609465|dbj|BAM18344.1| glutaredoxin [Papilio xuthus] | Back alignment and taxonomy information |
|---|
Score = 181 bits (460), Expect = 1e-43, Method: Compositional matrix adjust.
Identities = 84/129 (65%), Positives = 106/129 (82%), Gaps = 2/129 (1%)
Query: 1 MNTFLQRCMLPRLAINSRFHNAWRTPYSTDVQKSIDEMVKKSKVVVFMKGVPEAPRCGFS 60
MNT +++ + P NS + RT ++ + ID++VK +KVVVFMKGVP+APRCGFS
Sbjct: 1 MNTLIRKGIRPLF--NSTIRASCRTFADVNINEKIDKIVKDNKVVVFMKGVPDAPRCGFS 58
Query: 61 NAVVQILRMHDVPYDSHDVLKDESIRNGIKEYTSWPTIPQVFINGEFVGGCDILLKLHQS 120
NAVVQI+RMH VPY SHDVL DE++R GIKEY++WPTIPQVFINGEFVGGCDI+L++HQS
Sbjct: 59 NAVVQIMRMHAVPYVSHDVLSDENLRQGIKEYSNWPTIPQVFINGEFVGGCDIMLQMHQS 118
Query: 121 GELVEQLEK 129
GELVE+L+K
Sbjct: 119 GELVEELKK 127
|
Source: Papilio xuthus Species: Papilio xuthus Genus: Papilio Family: Papilionidae Order: Lepidoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|195457355|ref|XP_002075537.1| GK18554 [Drosophila willistoni] gi|194171622|gb|EDW86523.1| GK18554 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
| >gi|195133576|ref|XP_002011215.1| GI16412 [Drosophila mojavensis] gi|193907190|gb|EDW06057.1| GI16412 [Drosophila mojavensis] | Back alignment and taxonomy information |
|---|
| >gi|156546246|ref|XP_001605234.1| PREDICTED: glutaredoxin-related protein 5, mitochondrial-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|383849979|ref|XP_003700609.1| PREDICTED: glutaredoxin-related protein 5, mitochondrial-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|24642023|ref|NP_572974.1| CG14407 [Drosophila melanogaster] gi|19527631|gb|AAL89930.1| RH03087p [Drosophila melanogaster] gi|22832241|gb|AAF48392.2| CG14407 [Drosophila melanogaster] gi|220949162|gb|ACL87124.1| CG14407-PA [synthetic construct] | Back alignment and taxonomy information |
|---|
| >gi|350406647|ref|XP_003487837.1| PREDICTED: glutaredoxin-related protein 5, mitochondrial-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340721707|ref|XP_003399257.1| PREDICTED: glutaredoxin-related protein 5, mitochondrial-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|195354579|ref|XP_002043774.1| GM12034 [Drosophila sechellia] gi|194129000|gb|EDW51043.1| GM12034 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|195397435|ref|XP_002057334.1| GJ17033 [Drosophila virilis] gi|194147101|gb|EDW62820.1| GJ17033 [Drosophila virilis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 205 | ||||||
| FB|FBgn0030584 | 159 | CG14407 [Drosophila melanogast | 0.380 | 0.490 | 0.769 | 3.7e-32 | |
| ZFIN|ZDB-GENE-040426-1957 | 155 | glrx5 "glutaredoxin 5 homolog | 0.478 | 0.632 | 0.595 | 3.9e-28 | |
| UNIPROTKB|Q5ZK23 | 162 | GLRX5 "Uncharacterized protein | 0.380 | 0.481 | 0.683 | 5.7e-27 | |
| RGD|1308383 | 152 | Glrx5 "glutaredoxin 5" [Rattus | 0.380 | 0.513 | 0.670 | 5.7e-27 | |
| UNIPROTKB|A6QLZ6 | 158 | GLRX5 "Uncharacterized protein | 0.380 | 0.493 | 0.670 | 9.4e-27 | |
| UNIPROTKB|Q86SX6 | 157 | GLRX5 "Glutaredoxin-related pr | 0.380 | 0.496 | 0.670 | 9.4e-27 | |
| UNIPROTKB|F1SAR5 | 154 | GLRX5 "Uncharacterized protein | 0.380 | 0.506 | 0.670 | 9.4e-27 | |
| MGI|MGI:1920296 | 152 | Glrx5 "glutaredoxin 5 homolog | 0.380 | 0.513 | 0.670 | 9.4e-27 | |
| UNIPROTKB|G4N1C1 | 167 | MGG_09542 "Monothiol glutaredo | 0.502 | 0.616 | 0.504 | 1.1e-23 | |
| CGD|CAL0004286 | 175 | orf19.2782 [Candida albicans ( | 0.590 | 0.691 | 0.416 | 6.1e-23 |
| FB|FBgn0030584 CG14407 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 352 (129.0 bits), Expect = 3.7e-32, P = 3.7e-32
Identities = 60/78 (76%), Positives = 74/78 (94%)
Query: 52 PEAPRCGFSNAVVQILRMHDVPYDSHDVLKDESIRNGIKEYTSWPTIPQVFINGEFVGGC 111
P+APRCGFSNAVVQI+RMH V YD+HDVL++ES+R G+K+YT WPTIPQVFINGEFVGGC
Sbjct: 61 PQAPRCGFSNAVVQIMRMHGVQYDAHDVLQNESLRQGVKDYTDWPTIPQVFINGEFVGGC 120
Query: 112 DILLKLHQSGELVEQLEK 129
DILL++HQSG+L+E+L+K
Sbjct: 121 DILLQMHQSGDLIEELKK 138
|
|
| ZFIN|ZDB-GENE-040426-1957 glrx5 "glutaredoxin 5 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5ZK23 GLRX5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|1308383 Glrx5 "glutaredoxin 5" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A6QLZ6 GLRX5 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q86SX6 GLRX5 "Glutaredoxin-related protein 5, mitochondrial" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SAR5 GLRX5 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1920296 Glrx5 "glutaredoxin 5 homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4N1C1 MGG_09542 "Monothiol glutaredoxin-5" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0004286 orf19.2782 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 205 | |||
| cd03028 | 90 | cd03028, GRX_PICOT_like, Glutaredoxin (GRX) family | 6e-55 | |
| TIGR00365 | 97 | TIGR00365, TIGR00365, monothiol glutaredoxin, Grx4 | 5e-49 | |
| COG0278 | 105 | COG0278, COG0278, Glutaredoxin-related protein [Po | 4e-45 | |
| cd02066 | 72 | cd02066, GRX_family, Glutaredoxin (GRX) family; co | 3e-30 | |
| PTZ00062 | 204 | PTZ00062, PTZ00062, glutaredoxin; Provisional | 6e-26 | |
| PRK10824 | 115 | PRK10824, PRK10824, glutaredoxin-4; Provisional | 2e-23 | |
| pfam00462 | 60 | pfam00462, Glutaredoxin, Glutaredoxin | 8e-23 | |
| cd03419 | 82 | cd03419, GRX_GRXh_1_2_like, Glutaredoxin (GRX) fam | 3e-14 | |
| TIGR02180 | 84 | TIGR02180, GRX_euk, Glutaredoxin | 2e-12 | |
| COG0695 | 80 | COG0695, GrxC, Glutaredoxin and related proteins [ | 3e-11 | |
| TIGR02181 | 79 | TIGR02181, GRX_bact, Glutaredoxin, GrxC family | 4e-09 | |
| cd03031 | 147 | cd03031, GRX_GRX_like, Glutaredoxin (GRX) family, | 1e-08 | |
| cd03418 | 75 | cd03418, GRX_GRXb_1_3_like, Glutaredoxin (GRX) fam | 3e-08 | |
| TIGR02189 | 99 | TIGR02189, GlrX-like_plant, Glutaredoxin-like fami | 3e-06 | |
| TIGR02190 | 79 | TIGR02190, GlrX-dom, Glutaredoxin-family domain | 3e-05 | |
| cd03029 | 72 | cd03029, GRX_hybridPRX5, Glutaredoxin (GRX) family | 5e-05 | |
| PRK10638 | 83 | PRK10638, PRK10638, glutaredoxin 3; Provisional | 5e-05 |
| >gnl|CDD|239326 cd03028, GRX_PICOT_like, Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
Score = 169 bits (430), Expect = 6e-55
Identities = 50/90 (55%), Positives = 71/90 (78%)
Query: 35 IDEMVKKSKVVVFMKGVPEAPRCGFSNAVVQILRMHDVPYDSHDVLKDESIRNGIKEYTS 94
I +++K++ VV+FMKG PE PRCGFS VVQIL V + + D+L+DE +R G+KEY++
Sbjct: 1 IKKLIKENPVVLFMKGTPEEPRCGFSRKVVQILNQLGVDFGTFDILEDEEVRQGLKEYSN 60
Query: 95 WPTIPQVFINGEFVGGCDILLKLHQSGELV 124
WPT PQ+++NGE VGGCDI+ ++H+SGEL
Sbjct: 61 WPTFPQLYVNGELVGGCDIVKEMHESGELQ 90
|
The non-PICOT members of this family contain only the GRX-like domain, whereas PICOT contains an N-terminal TRX-like domain followed by one to three GRX-like domains. It is interesting to note that PICOT from plants contain three repeats of the GRX-like domain, metazoan proteins (except for insect) have two repeats, while fungal sequences contain only one copy of the domain. PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes. PICOT inhibits the activation of c-Jun N-terminal kinase and the transcription factors, AP-1 and NF-kB, induced by PKC theta or T-cell activating stimuli. Both GRX and TRX domains of PICOT are required for its activity. Characterized non-PICOT members of this family include CXIP1, a CAX-interacting protein in Arabidopsis thaliana, and PfGLP-1, a GRX-like protein from Plasmodium falciparum. Length = 90 |
| >gnl|CDD|188046 TIGR00365, TIGR00365, monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >gnl|CDD|223355 COG0278, COG0278, Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|239017 cd02066, GRX_family, Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|240250 PTZ00062, PTZ00062, glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|182759 PRK10824, PRK10824, glutaredoxin-4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215931 pfam00462, Glutaredoxin, Glutaredoxin | Back alignment and domain information |
|---|
| >gnl|CDD|239511 cd03419, GRX_GRXh_1_2_like, Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|233765 TIGR02180, GRX_euk, Glutaredoxin | Back alignment and domain information |
|---|
| >gnl|CDD|223767 COG0695, GrxC, Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|233766 TIGR02181, GRX_bact, Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >gnl|CDD|239329 cd03031, GRX_GRX_like, Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs | Back alignment and domain information |
|---|
| >gnl|CDD|239510 cd03418, GRX_GRXb_1_3_like, Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >gnl|CDD|233771 TIGR02189, GlrX-like_plant, Glutaredoxin-like family | Back alignment and domain information |
|---|
| >gnl|CDD|131245 TIGR02190, GlrX-dom, Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >gnl|CDD|239327 cd03029, GRX_hybridPRX5, Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >gnl|CDD|182607 PRK10638, PRK10638, glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 205 | |||
| cd03031 | 147 | GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d | 100.0 | |
| KOG2824|consensus | 281 | 100.0 | ||
| PRK10824 | 115 | glutaredoxin-4; Provisional | 99.96 | |
| TIGR00365 | 97 | monothiol glutaredoxin, Grx4 family. The gene for | 99.95 | |
| TIGR02189 | 99 | GlrX-like_plant Glutaredoxin-like family. This fam | 99.93 | |
| cd03028 | 90 | GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte | 99.93 | |
| PHA03050 | 108 | glutaredoxin; Provisional | 99.93 | |
| COG0278 | 105 | Glutaredoxin-related protein [Posttranslational mo | 99.93 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 99.92 | |
| KOG1752|consensus | 104 | 99.9 | ||
| PRK10638 | 83 | glutaredoxin 3; Provisional | 99.88 | |
| TIGR02181 | 79 | GRX_bact Glutaredoxin, GrxC family. This family of | 99.87 | |
| KOG0911|consensus | 227 | 99.86 | ||
| cd03030 | 92 | GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 | 99.86 | |
| cd03418 | 75 | GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b | 99.83 | |
| cd03027 | 73 | GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg | 99.83 | |
| TIGR02180 | 84 | GRX_euk Glutaredoxin. This model represents eukary | 99.8 | |
| COG0695 | 80 | GrxC Glutaredoxin and related proteins [Posttransl | 99.8 | |
| cd03419 | 82 | GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h | 99.79 | |
| cd03029 | 72 | GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb | 99.78 | |
| TIGR02190 | 79 | GlrX-dom Glutaredoxin-family domain. This C-termin | 99.77 | |
| cd02066 | 72 | GRX_family Glutaredoxin (GRX) family; composed of | 99.75 | |
| TIGR02183 | 86 | GRXA Glutaredoxin, GrxA family. This model include | 99.75 | |
| PRK11200 | 85 | grxA glutaredoxin 1; Provisional | 99.75 | |
| PF00462 | 60 | Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl | 99.7 | |
| PRK12759 | 410 | bifunctional gluaredoxin/ribonucleoside-diphosphat | 99.66 | |
| TIGR02194 | 72 | GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red | 99.59 | |
| PRK10329 | 81 | glutaredoxin-like protein; Provisional | 99.57 | |
| PF04908 | 99 | SH3BGR: SH3-binding, glutamic acid-rich protein; I | 99.48 | |
| TIGR02196 | 74 | GlrX_YruB Glutaredoxin-like protein, YruB-family. | 99.36 | |
| cd02976 | 73 | NrdH NrdH-redoxin (NrdH) family; NrdH is a small m | 99.32 | |
| TIGR02200 | 77 | GlrX_actino Glutaredoxin-like protein. This family | 99.22 | |
| cd02973 | 67 | TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- | 98.99 | |
| cd03041 | 77 | GST_N_2GST_N GST_N family, 2 repeats of the N-term | 98.85 | |
| cd00570 | 71 | GST_N_family Glutathione S-transferase (GST) famil | 98.75 | |
| cd03040 | 77 | GST_N_mPGES2 GST_N family; microsomal Prostaglandi | 98.74 | |
| cd03037 | 71 | GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) sub | 98.68 | |
| cd03036 | 111 | ArsC_like Arsenate Reductase (ArsC) family, unknow | 98.51 | |
| TIGR03140 | 515 | AhpF alkyl hydroperoxide reductase, F subunit. Thi | 98.5 | |
| PRK15317 | 517 | alkyl hydroperoxide reductase subunit F; Provision | 98.45 | |
| cd02977 | 105 | ArsC_family Arsenate Reductase (ArsC) family; comp | 98.44 | |
| cd03055 | 89 | GST_N_Omega GST_N family, Class Omega subfamily; G | 98.42 | |
| cd03059 | 73 | GST_N_SspA GST_N family, Stringent starvation prot | 98.41 | |
| cd03060 | 71 | GST_N_Omega_like GST_N family, Omega-like subfamil | 98.38 | |
| cd03026 | 89 | AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid | 98.36 | |
| PF05768 | 81 | DUF836: Glutaredoxin-like domain (DUF836); InterPr | 98.34 | |
| PF13417 | 75 | GST_N_3: Glutathione S-transferase, N-terminal dom | 98.32 | |
| PRK01655 | 131 | spxA transcriptional regulator Spx; Reviewed | 98.3 | |
| cd03051 | 74 | GST_N_GTT2_like GST_N family, Saccharomyces cerevi | 98.3 | |
| cd03045 | 74 | GST_N_Delta_Epsilon GST_N family, Class Delta and | 98.28 | |
| TIGR00411 | 82 | redox_disulf_1 small redox-active disulfide protei | 98.21 | |
| cd03056 | 73 | GST_N_4 GST_N family, unknown subfamily 4; compose | 98.2 | |
| KOG4023|consensus | 108 | 98.19 | ||
| TIGR01617 | 117 | arsC_related transcriptional regulator, Spx/MgsR f | 98.15 | |
| cd03032 | 115 | ArsC_Spx Arsenate Reductase (ArsC) family, Spx sub | 98.14 | |
| KOG3029|consensus | 370 | 98.08 | ||
| PRK12559 | 131 | transcriptional regulator Spx; Provisional | 98.07 | |
| PRK13344 | 132 | spxA transcriptional regulator Spx; Reviewed | 98.05 | |
| cd03035 | 105 | ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb s | 98.04 | |
| cd03054 | 72 | GST_N_Metaxin GST_N family, Metaxin subfamily; com | 97.96 | |
| PHA02125 | 75 | thioredoxin-like protein | 97.95 | |
| cd02975 | 113 | PfPDO_like_N Pyrococcus furiosus protein disulfide | 97.95 | |
| cd03033 | 113 | ArsC_15kD Arsenate Reductase (ArsC) family, 15kD p | 97.94 | |
| TIGR00412 | 76 | redox_disulf_2 small redox-active disulfide protei | 97.87 | |
| cd03053 | 76 | GST_N_Phi GST_N family, Class Phi subfamily; compo | 97.83 | |
| cd03058 | 74 | GST_N_Tau GST_N family, Class Tau subfamily; GSTs | 97.81 | |
| cd03061 | 91 | GST_N_CLIC GST_N family, Chloride Intracellular Ch | 97.8 | |
| cd03052 | 73 | GST_N_GDAP1 GST_N family, Ganglioside-induced diff | 97.73 | |
| TIGR03143 | 555 | AhpF_homolog putative alkyl hydroperoxide reductas | 97.68 | |
| cd03076 | 73 | GST_N_Pi GST_N family, Class Pi subfamily; GSTs ar | 97.67 | |
| cd03042 | 73 | GST_N_Zeta GST_N family, Class Zeta subfamily; GST | 97.66 | |
| PF13192 | 76 | Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY | 97.62 | |
| cd03049 | 73 | GST_N_3 GST_N family, unknown subfamily 3; compose | 97.58 | |
| cd03080 | 75 | GST_N_Metaxin_like GST_N family, Metaxin subfamily | 97.58 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 97.57 | |
| cd03039 | 72 | GST_N_Sigma_like GST_N family, Class Sigma_like; c | 97.56 | |
| TIGR01295 | 122 | PedC_BrcD bacteriocin transport accessory protein, | 97.56 | |
| PHA02278 | 103 | thioredoxin-like protein | 97.55 | |
| COG1393 | 117 | ArsC Arsenate reductase and related proteins, glut | 97.53 | |
| cd02953 | 104 | DsbDgamma DsbD gamma family; DsbD gamma is the C-t | 97.51 | |
| cd03048 | 81 | GST_N_Ure2p_like GST_N family, Ure2p-like subfamil | 97.49 | |
| TIGR01616 | 126 | nitro_assoc nitrogenase-associated protein. This m | 97.43 | |
| TIGR02182 | 209 | GRXB Glutaredoxin, GrxB family. This model include | 97.42 | |
| COG4545 | 85 | Glutaredoxin-related protein [Posttranslational mo | 97.4 | |
| cd03038 | 84 | GST_N_etherase_LigE GST_N family, Beta etherase Li | 97.4 | |
| PRK10026 | 141 | arsenate reductase; Provisional | 97.39 | |
| PRK10387 | 210 | glutaredoxin 2; Provisional | 97.38 | |
| TIGR00014 | 114 | arsC arsenate reductase (glutaredoxin). composed o | 97.38 | |
| PRK10853 | 118 | putative reductase; Provisional | 97.37 | |
| cd03034 | 112 | ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC s | 97.35 | |
| cd01659 | 69 | TRX_superfamily Thioredoxin (TRX) superfamily; a l | 97.3 | |
| cd02949 | 97 | TRX_NTR TRX domain, novel NADPH thioredoxin reduct | 97.25 | |
| PF13409 | 70 | GST_N_2: Glutathione S-transferase, N-terminal dom | 97.25 | |
| cd03050 | 76 | GST_N_Theta GST_N family, Class Theta subfamily; c | 97.18 | |
| cd03044 | 75 | GST_N_EF1Bgamma GST_N family, Gamma subunit of Elo | 97.16 | |
| cd02947 | 93 | TRX_family TRX family; composed of two groups: Gro | 97.13 | |
| cd02954 | 114 | DIM1 Dim1 family; Dim1 is also referred to as U5 s | 97.13 | |
| PTZ00051 | 98 | thioredoxin; Provisional | 97.01 | |
| cd02985 | 103 | TRX_CDSP32 TRX family, chloroplastic drought-induc | 97.0 | |
| PF14595 | 129 | Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. | 96.99 | |
| cd02989 | 113 | Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior | 96.99 | |
| cd02957 | 113 | Phd_like Phosducin (Phd)-like family; composed of | 96.99 | |
| PRK09481 | 211 | sspA stringent starvation protein A; Provisional | 96.96 | |
| cd03047 | 73 | GST_N_2 GST_N family, unknown subfamily 2; compose | 96.93 | |
| PF00085 | 103 | Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio | 96.87 | |
| cd03057 | 77 | GST_N_Beta GST_N family, Class Beta subfamily; GST | 96.77 | |
| PF03960 | 110 | ArsC: ArsC family; InterPro: IPR006660 Several bac | 96.75 | |
| cd02951 | 125 | SoxW SoxW family; SoxW is a bacterial periplasmic | 96.75 | |
| cd03046 | 76 | GST_N_GTT1_like GST_N family, Saccharomyces cerevi | 96.68 | |
| cd03043 | 73 | GST_N_1 GST_N family, unknown subfamily 1; compose | 96.67 | |
| cd02987 | 175 | Phd_like_Phd Phosducin (Phd)-like family, Phd subf | 96.65 | |
| cd02986 | 114 | DLP Dim1 family, Dim1-like protein (DLP) subfamily | 96.63 | |
| TIGR00862 | 236 | O-ClC intracellular chloride channel protein. Thes | 96.63 | |
| cd02994 | 101 | PDI_a_TMX PDIa family, TMX subfamily; composed of | 96.59 | |
| KOG0910|consensus | 150 | 96.51 | ||
| COG3118 | 304 | Thioredoxin domain-containing protein [Posttransla | 96.5 | |
| PRK15113 | 214 | glutathione S-transferase; Provisional | 96.47 | |
| TIGR02187 | 215 | GlrX_arch Glutaredoxin-like domain protein. This f | 96.47 | |
| TIGR01068 | 101 | thioredoxin thioredoxin. Several proteins, such as | 96.46 | |
| cd02959 | 117 | ERp19 Endoplasmic reticulum protein 19 (ERp19) fam | 96.21 | |
| cd03000 | 104 | PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o | 96.14 | |
| cd02963 | 111 | TRX_DnaJ TRX domain, DnaJ domain containing protei | 96.14 | |
| cd02984 | 97 | TRX_PICOT TRX domain, PICOT (for PKC-interacting c | 96.12 | |
| PRK09381 | 109 | trxA thioredoxin; Provisional | 96.05 | |
| COG3634 | 520 | AhpF Alkyl hydroperoxide reductase, large subunit | 96.05 | |
| cd02948 | 102 | TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus | 96.05 | |
| cd02956 | 96 | ybbN ybbN protein family; ybbN is a hypothetical p | 95.98 | |
| cd02962 | 152 | TMX2 TMX2 family; composed of proteins similar to | 95.96 | |
| PF13098 | 112 | Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ | 95.95 | |
| PRK10996 | 139 | thioredoxin 2; Provisional | 95.84 | |
| KOG4244|consensus | 281 | 95.83 | ||
| cd02961 | 101 | PDI_a_family Protein Disulfide Isomerase (PDIa) fa | 95.82 | |
| cd03005 | 102 | PDI_a_ERp46 PDIa family, endoplasmic reticulum pro | 95.77 | |
| TIGR01126 | 102 | pdi_dom protein disulfide-isomerase domain. This m | 95.72 | |
| cd02955 | 124 | SSP411 TRX domain, SSP411 protein family; members | 95.69 | |
| PLN02817 | 265 | glutathione dehydrogenase (ascorbate) | 95.68 | |
| TIGR01262 | 210 | maiA maleylacetoacetate isomerase. Maleylacetoacet | 95.65 | |
| cd02996 | 108 | PDI_a_ERp44 PDIa family, endoplasmic reticulum pro | 95.62 | |
| KOG0406|consensus | 231 | 95.57 | ||
| PLN02473 | 214 | glutathione S-transferase | 95.55 | |
| PRK10877 | 232 | protein disulfide isomerase II DsbC; Provisional | 95.54 | |
| cd03003 | 101 | PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam | 95.5 | |
| KOG0907|consensus | 106 | 95.42 | ||
| cd02988 | 192 | Phd_like_VIAF Phosducin (Phd)-like family, Viral i | 95.42 | |
| cd02999 | 100 | PDI_a_ERp44_like PDIa family, endoplasmic reticulu | 95.41 | |
| PLN02378 | 213 | glutathione S-transferase DHAR1 | 95.39 | |
| cd02965 | 111 | HyaE HyaE family; HyaE is also called HupG and Hox | 95.38 | |
| COG3019 | 149 | Predicted metal-binding protein [General function | 95.24 | |
| cd03001 | 103 | PDI_a_P5 PDIa family, P5 subfamily; composed of eu | 95.21 | |
| cd03004 | 104 | PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam | 95.16 | |
| COG2999 | 215 | GrxB Glutaredoxin 2 [Posttranslational modificatio | 95.15 | |
| cd03079 | 74 | GST_N_Metaxin2 GST_N family, Metaxin subfamily, Me | 94.98 | |
| cd02993 | 109 | PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat | 94.96 | |
| cd03077 | 79 | GST_N_Alpha GST_N family, Class Alpha subfamily; G | 94.95 | |
| PTZ00062 | 204 | glutaredoxin; Provisional | 94.81 | |
| PF13728 | 215 | TraF: F plasmid transfer operon protein | 94.72 | |
| cd03006 | 113 | PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil | 94.58 | |
| cd02952 | 119 | TRP14_like Human TRX-related protein 14 (TRP14)-li | 94.57 | |
| cd03078 | 73 | GST_N_Metaxin1_like GST_N family, Metaxin subfamil | 94.47 | |
| cd03002 | 109 | PDI_a_MPD1_like PDI family, MPD1-like subfamily; c | 94.45 | |
| cd03008 | 146 | TryX_like_RdCVF Tryparedoxin (TryX)-like family, R | 94.4 | |
| cd02950 | 142 | TxlA TRX-like protein A (TxlA) family; TxlA was or | 94.27 | |
| cd02998 | 105 | PDI_a_ERp38 PDIa family, endoplasmic reticulum pro | 94.25 | |
| cd03020 | 197 | DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil | 94.2 | |
| KOG1422|consensus | 221 | 94.18 | ||
| cd02972 | 98 | DsbA_family DsbA family; consists of DsbA and DsbA | 93.92 | |
| COG0625 | 211 | Gst Glutathione S-transferase [Posttranslational m | 93.85 | |
| PRK13728 | 181 | conjugal transfer protein TrbB; Provisional | 93.84 | |
| PRK00293 | 571 | dipZ thiol:disulfide interchange protein precursor | 93.8 | |
| TIGR02740 | 271 | TraF-like TraF-like protein. This protein is relat | 93.79 | |
| PRK10357 | 202 | putative glutathione S-transferase; Provisional | 93.71 | |
| PF11009 | 105 | DUF2847: Protein of unknown function (DUF2847); In | 93.59 | |
| PTZ00102 | 477 | disulphide isomerase; Provisional | 93.43 | |
| PF13899 | 82 | Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ | 93.43 | |
| PLN00410 | 142 | U5 snRNP protein, DIM1 family; Provisional | 93.38 | |
| PLN02395 | 215 | glutathione S-transferase | 93.37 | |
| PF02798 | 76 | GST_N: Glutathione S-transferase, N-terminal domai | 93.37 | |
| cd03065 | 120 | PDI_b_Calsequestrin_N PDIb family, Calsequestrin s | 93.33 | |
| PTZ00443 | 224 | Thioredoxin domain-containing protein; Provisional | 93.31 | |
| cd02997 | 104 | PDI_a_PDIR PDIa family, PDIR subfamily; composed o | 93.23 | |
| PF06953 | 123 | ArsD: Arsenical resistance operon trans-acting rep | 93.07 | |
| cd02992 | 114 | PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas | 92.99 | |
| COG2143 | 182 | Thioredoxin-related protein [Posttranslational mod | 92.89 | |
| PRK13972 | 215 | GSH-dependent disulfide bond oxidoreductase; Provi | 92.36 | |
| PRK11752 | 264 | putative S-transferase; Provisional | 92.25 | |
| TIGR02739 | 256 | TraF type-F conjugative transfer system pilin asse | 91.98 | |
| cd03009 | 131 | TryX_like_TryX_NRX Tryparedoxin (TryX)-like family | 91.52 | |
| PF06764 | 202 | DUF1223: Protein of unknown function (DUF1223); In | 91.37 | |
| cd02958 | 114 | UAS UAS family; UAS is a domain of unknown functio | 91.08 | |
| PRK13703 | 248 | conjugal pilus assembly protein TraF; Provisional | 91.06 | |
| PTZ00057 | 205 | glutathione s-transferase; Provisional | 90.83 | |
| cd02995 | 104 | PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain | 90.6 | |
| cd03075 | 82 | GST_N_Mu GST_N family, Class Mu subfamily; GSTs ar | 90.58 | |
| TIGR02738 | 153 | TrbB type-F conjugative transfer system pilin asse | 90.57 | |
| KOG3425|consensus | 128 | 90.53 | ||
| PF06110 | 119 | DUF953: Eukaryotic protein of unknown function (DU | 90.43 | |
| cd02964 | 132 | TryX_like_family Tryparedoxin (TryX)-like family; | 90.17 | |
| COG5494 | 265 | Predicted thioredoxin/glutaredoxin [Posttranslatio | 89.66 | |
| cd02982 | 103 | PDI_b'_family Protein Disulfide Isomerase (PDIb') | 88.45 | |
| TIGR00424 | 463 | APS_reduc 5'-adenylylsulfate reductase, thioredoxi | 88.3 | |
| TIGR01130 | 462 | ER_PDI_fam protein disulfide isomerases, eukaryoti | 88.11 | |
| PRK03147 | 173 | thiol-disulfide oxidoreductase; Provisional | 88.01 | |
| PRK10542 | 201 | glutathionine S-transferase; Provisional | 87.67 | |
| KOG0868|consensus | 217 | 86.69 | ||
| PLN02309 | 457 | 5'-adenylylsulfate reductase | 86.16 | |
| cd03010 | 127 | TlpA_like_DsbE TlpA-like family, DsbE (also known | 85.17 | |
| KOG1695|consensus | 206 | 84.9 | ||
| TIGR00385 | 173 | dsbE periplasmic protein thiol:disulfide oxidoredu | 84.86 | |
| cd03011 | 123 | TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso | 84.13 | |
| PF10568 | 72 | Tom37: Outer mitochondrial membrane transport comp | 84.12 | |
| cd02960 | 130 | AGR Anterior Gradient (AGR) family; members of thi | 84.09 | |
| TIGR02661 | 189 | MauD methylamine dehydrogenase accessory protein M | 84.01 | |
| cd03023 | 154 | DsbA_Com1_like DsbA family, Com1-like subfamily; c | 81.3 | |
| COG5429 | 261 | Uncharacterized secreted protein [Function unknown | 80.92 | |
| PRK11657 | 251 | dsbG disulfide isomerase/thiol-disulfide oxidase; | 80.77 | |
| COG0526 | 127 | TrxA Thiol-disulfide isomerase and thioredoxins [P | 80.3 |
| >cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs | Back alignment and domain information |
|---|
Probab=100.00 E-value=9e-38 Score=249.93 Aligned_cols=137 Identities=26% Similarity=0.386 Sum_probs=126.4
Q ss_pred cEEEEEeeCCCC-CCChHHHHHHHHHHhCCCCeEEEEccCCHhHHHHHHHHhCC----CCccEEeeCCeEeechhHHHHH
Q psy221 43 KVVVFMKGVPEA-PRCGFSNAVVQILRMHDVPYDSHDVLKDESIRNGIKEYTSW----PTIPQVFINGEFVGGCDILLKL 117 (205)
Q Consensus 43 ~VvlYsk~~~~~-~~Cp~C~~ak~lL~~~gV~~~e~DI~~d~~~~~eL~~~~g~----~tvPqvFI~G~~IGG~del~~l 117 (205)
+||||+++++++ .+||+|.+||++|++++|+|+++||++|++++++|+++++. .++|||||+|++|||+||+++|
T Consensus 1 ~VvlYttsl~giR~t~~~C~~ak~iL~~~~V~~~e~DVs~~~~~~~EL~~~~g~~~~~~tvPqVFI~G~~IGG~del~~L 80 (147)
T cd03031 1 RVVLYTTSLRGVRKTFEDCNNVRAILESFRVKFDERDVSMDSGFREELRELLGAELKAVSLPRVFVDGRYLGGAEEVLRL 80 (147)
T ss_pred CEEEEEcCCcCCCCcChhHHHHHHHHHHCCCcEEEEECCCCHHHHHHHHHHhCCCCCCCCCCEEEECCEEEecHHHHHHH
Confidence 589999999999 99999999999999999999999999999999999999875 8999999999999999999999
Q ss_pred HhcccHHHHHhhcCCccccceeecccCCC--CcccCcccCCCCccccC---CCCccccccccceeeEec
Q psy221 118 HQSGELVEQLEKGDQKRKQFILINYISGD--AVRCYECSSAQDPKGED---NCGAYSKFHKERHISVEC 181 (205)
Q Consensus 118 ~e~GeL~~~L~~~~~~~~~~~~~~~gcGg--fv~C~~CsGS~k~~~~~---~~g~~~~~~~~~~~~~~c 181 (205)
|++|+|.++|+.++.. .....|.+||| ||||.+|+||+|++.++ .++.-++.++++|.-|+|
T Consensus 81 ~e~G~L~~lL~~~~~~--~~~~~C~~Cgg~rfv~C~~C~Gs~k~~~~~~~~~~~~~rC~~Cnengl~~c 147 (147)
T cd03031 81 NESGELRKLLKGIRAR--AGGGVCEGCGGARFVPCSECNGSCKVFAENATAAGGFLRCPECNENGLVRC 147 (147)
T ss_pred HHcCCHHHHHhhcccc--cCCCCCCCCCCcCeEECCCCCCcceEEeccCcccccEEECCCCCccccccC
Confidence 9999999999988433 23445889998 89999999999999988 477889999999999988
|
This subfamily is predominantly composed of plant proteins. GRX is a glutathione (GSH) dependent reductase, catalyzing the disulfide reduction of target proteins via a redox active CXXC motif using a similar dithiol mechanism employed by TRXs. GRX has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. Proteins containing only the C-terminal cysteine are generally redox inactive. |
| >KOG2824|consensus | Back alignment and domain information |
|---|
| >PRK10824 glutaredoxin-4; Provisional | Back alignment and domain information |
|---|
| >TIGR00365 monothiol glutaredoxin, Grx4 family | Back alignment and domain information |
|---|
| >TIGR02189 GlrX-like_plant Glutaredoxin-like family | Back alignment and domain information |
|---|
| >cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins | Back alignment and domain information |
|---|
| >PHA03050 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >COG0278 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >KOG1752|consensus | Back alignment and domain information |
|---|
| >PRK10638 glutaredoxin 3; Provisional | Back alignment and domain information |
|---|
| >TIGR02181 GRX_bact Glutaredoxin, GrxC family | Back alignment and domain information |
|---|
| >KOG0911|consensus | Back alignment and domain information |
|---|
| >cd03030 GRX_SH3BGR Glutaredoxin (GRX) family, SH3BGR (SH3 domain binding glutamic acid-rich protein) subfamily; a recently-identified subfamily composed of SH3BGR and similar proteins possessing significant sequence similarity to GRX, but without a redox active CXXC motif | Back alignment and domain information |
|---|
| >cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions | Back alignment and domain information |
|---|
| >TIGR02180 GRX_euk Glutaredoxin | Back alignment and domain information |
|---|
| >COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria | Back alignment and domain information |
|---|
| >TIGR02190 GlrX-dom Glutaredoxin-family domain | Back alignment and domain information |
|---|
| >cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain | Back alignment and domain information |
|---|
| >TIGR02183 GRXA Glutaredoxin, GrxA family | Back alignment and domain information |
|---|
| >PRK11200 grxA glutaredoxin 1; Provisional | Back alignment and domain information |
|---|
| >PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional | Back alignment and domain information |
|---|
| >TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH | Back alignment and domain information |
|---|
| >PRK10329 glutaredoxin-like protein; Provisional | Back alignment and domain information |
|---|
| >PF04908 SH3BGR: SH3-binding, glutamic acid-rich protein; InterPro: IPR006993 This family of proteins, which contains SH3BGRL3, is functionally uncharacterised | Back alignment and domain information |
|---|
| >TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family | Back alignment and domain information |
|---|
| >cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile | Back alignment and domain information |
|---|
| >TIGR02200 GlrX_actino Glutaredoxin-like protein | Back alignment and domain information |
|---|
| >cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) | Back alignment and domain information |
|---|
| >cd03041 GST_N_2GST_N GST_N family, 2 repeats of the N-terminal domain of soluble GSTs (2 GST_N) subfamily; composed of uncharacterized proteins | Back alignment and domain information |
|---|
| >cd00570 GST_N_family Glutathione S-transferase (GST) family, N-terminal domain; a large, diverse group of cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03040 GST_N_mPGES2 GST_N family; microsomal Prostaglandin E synthase Type 2 (mPGES2) subfamily; mPGES2 is a membrane-anchored dimeric protein containing a CXXC motif which catalyzes the isomerization of PGH2 to PGE2 | Back alignment and domain information |
|---|
| >cd03037 GST_N_GRX2 GST_N family, Glutaredoxin 2 (GRX2) subfamily; composed of bacterial proteins similar to E | Back alignment and domain information |
|---|
| >cd03036 ArsC_like Arsenate Reductase (ArsC) family, unknown subfamily; uncharacterized proteins containing a CXXC motif with similarity to thioredoxin (TRX)-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit | Back alignment and domain information |
|---|
| >PRK15317 alkyl hydroperoxide reductase subunit F; Provisional | Back alignment and domain information |
|---|
| >cd02977 ArsC_family Arsenate Reductase (ArsC) family; composed of TRX-fold arsenic reductases and similar proteins including the transcriptional regulator, Spx | Back alignment and domain information |
|---|
| >cd03055 GST_N_Omega GST_N family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03059 GST_N_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E | Back alignment and domain information |
|---|
| >cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs | Back alignment and domain information |
|---|
| >cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides | Back alignment and domain information |
|---|
| >PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors | Back alignment and domain information |
|---|
| >PF13417 GST_N_3: Glutathione S-transferase, N-terminal domain; PDB: 3ERG_B 3IBH_A 3ERF_A 3UBL_A 3UBK_A 3IR4_A 3M8N_B 2R4V_A 2PER_A 2R5G_A | Back alignment and domain information |
|---|
| >PRK01655 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >cd03051 GST_N_GTT2_like GST_N family, Saccharomyces cerevisiae GTT2-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03045 GST_N_Delta_Epsilon GST_N family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 | Back alignment and domain information |
|---|
| >cd03056 GST_N_4 GST_N family, unknown subfamily 4; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >KOG4023|consensus | Back alignment and domain information |
|---|
| >TIGR01617 arsC_related transcriptional regulator, Spx/MgsR family | Back alignment and domain information |
|---|
| >cd03032 ArsC_Spx Arsenate Reductase (ArsC) family, Spx subfamily; Spx is a unique RNA polymerase (RNAP)-binding protein present in bacilli and some mollicutes | Back alignment and domain information |
|---|
| >KOG3029|consensus | Back alignment and domain information |
|---|
| >PRK12559 transcriptional regulator Spx; Provisional | Back alignment and domain information |
|---|
| >PRK13344 spxA transcriptional regulator Spx; Reviewed | Back alignment and domain information |
|---|
| >cd03035 ArsC_Yffb Arsenate Reductase (ArsC) family, Yffb subfamily; Yffb is an uncharacterized bacterial protein encoded by the yffb gene, related to the thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >cd03054 GST_N_Metaxin GST_N family, Metaxin subfamily; composed of metaxins and related proteins | Back alignment and domain information |
|---|
| >PHA02125 thioredoxin-like protein | Back alignment and domain information |
|---|
| >cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding | Back alignment and domain information |
|---|
| >cd03033 ArsC_15kD Arsenate Reductase (ArsC) family, 15kD protein subfamily; composed of proteins of unknown function with similarity to thioredoxin-fold arsenic reductases, ArsC | Back alignment and domain information |
|---|
| >TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 | Back alignment and domain information |
|---|
| >cd03053 GST_N_Phi GST_N family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins | Back alignment and domain information |
|---|
| >cd03058 GST_N_Tau GST_N family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03061 GST_N_CLIC GST_N family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin and similar proteins | Back alignment and domain information |
|---|
| >cd03052 GST_N_GDAP1 GST_N family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells | Back alignment and domain information |
|---|
| >TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit | Back alignment and domain information |
|---|
| >cd03076 GST_N_Pi GST_N family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >cd03042 GST_N_Zeta GST_N family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B | Back alignment and domain information |
|---|
| >cd03049 GST_N_3 GST_N family, unknown subfamily 3; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >cd03080 GST_N_Metaxin_like GST_N family, Metaxin subfamily, Metaxin-like proteins; a heterogenous group of proteins, predominantly uncharacterized, with similarity to metaxins and GSTs | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >cd03039 GST_N_Sigma_like GST_N family, Class Sigma_like; composed of GSTs belonging to class Sigma and similar proteins, including GSTs from class Mu, Pi and Alpha | Back alignment and domain information |
|---|
| >TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative | Back alignment and domain information |
|---|
| >PHA02278 thioredoxin-like protein | Back alignment and domain information |
|---|
| >COG1393 ArsC Arsenate reductase and related proteins, glutaredoxin family [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD | Back alignment and domain information |
|---|
| >cd03048 GST_N_Ure2p_like GST_N family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs | Back alignment and domain information |
|---|
| >TIGR01616 nitro_assoc nitrogenase-associated protein | Back alignment and domain information |
|---|
| >TIGR02182 GRXB Glutaredoxin, GrxB family | Back alignment and domain information |
|---|
| >COG4545 Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03038 GST_N_etherase_LigE GST_N family, Beta etherase LigE subfamily; composed of proteins similar to Sphingomonas paucimobilis beta etherase, LigE, a GST-like protein that catalyzes the cleavage of the beta-aryl ether linkages present in low-moleculer weight lignins using GSH as the hydrogen donor | Back alignment and domain information |
|---|
| >PRK10026 arsenate reductase; Provisional | Back alignment and domain information |
|---|
| >PRK10387 glutaredoxin 2; Provisional | Back alignment and domain information |
|---|
| >TIGR00014 arsC arsenate reductase (glutaredoxin) | Back alignment and domain information |
|---|
| >PRK10853 putative reductase; Provisional | Back alignment and domain information |
|---|
| >cd03034 ArsC_ArsC Arsenate Reductase (ArsC) family, ArsC subfamily; arsenic reductases similar to that encoded by arsC on the R733 plasmid of Escherichia coli | Back alignment and domain information |
|---|
| >cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold | Back alignment and domain information |
|---|
| >cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains | Back alignment and domain information |
|---|
| >PF13409 GST_N_2: Glutathione S-transferase, N-terminal domain; PDB: 3C8E_B 3M1G_A 3R3E_A 3O3T_A 1RK4_A 1K0O_B 1K0N_A 3QR6_A 3SWL_A 3TGZ_B | Back alignment and domain information |
|---|
| >cd03050 GST_N_Theta GST_N family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase | Back alignment and domain information |
|---|
| >cd03044 GST_N_EF1Bgamma GST_N family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis | Back alignment and domain information |
|---|
| >cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains | Back alignment and domain information |
|---|
| >cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein | Back alignment and domain information |
|---|
| >PTZ00051 thioredoxin; Provisional | Back alignment and domain information |
|---|
| >cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif | Back alignment and domain information |
|---|
| >PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A | Back alignment and domain information |
|---|
| >cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif | Back alignment and domain information |
|---|
| >cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions | Back alignment and domain information |
|---|
| >PRK09481 sspA stringent starvation protein A; Provisional | Back alignment and domain information |
|---|
| >cd03047 GST_N_2 GST_N family, unknown subfamily 2; composed of uncharacterized bacterial proteins with similarity to GSTs | Back alignment and domain information |
|---|
| >PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms | Back alignment and domain information |
|---|
| >cd03057 GST_N_Beta GST_N family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PF03960 ArsC: ArsC family; InterPro: IPR006660 Several bacterial taxon have a chromosomal resistance system, encoded by the ars operon, for the detoxification of arsenate, arsenite, and antimonite [] | Back alignment and domain information |
|---|
| >cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation | Back alignment and domain information |
|---|
| >cd03046 GST_N_GTT1_like GST_N family, Saccharomyces cerevisiae GTT1-like subfamily; composed of predominantly uncharacterized proteins with similarity to the S | Back alignment and domain information |
|---|
| >cd03043 GST_N_1 GST_N family, unknown subfamily 1; composed of uncharacterized proteins, predominantly from bacteria, with similarity to GSTs | Back alignment and domain information |
|---|
| >cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions | Back alignment and domain information |
|---|
| >cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 | Back alignment and domain information |
|---|
| >TIGR00862 O-ClC intracellular chloride channel protein | Back alignment and domain information |
|---|
| >cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX | Back alignment and domain information |
|---|
| >KOG0910|consensus | Back alignment and domain information |
|---|
| >COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK15113 glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02187 GlrX_arch Glutaredoxin-like domain protein | Back alignment and domain information |
|---|
| >TIGR01068 thioredoxin thioredoxin | Back alignment and domain information |
|---|
| >cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain | Back alignment and domain information |
|---|
| >cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus | Back alignment and domain information |
|---|
| >cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain | Back alignment and domain information |
|---|
| >cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes | Back alignment and domain information |
|---|
| >PRK09381 trxA thioredoxin; Provisional | Back alignment and domain information |
|---|
| >COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein | Back alignment and domain information |
|---|
| >cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain | Back alignment and domain information |
|---|
| >cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library | Back alignment and domain information |
|---|
| >PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A | Back alignment and domain information |
|---|
| >PRK10996 thioredoxin 2; Provisional | Back alignment and domain information |
|---|
| >KOG4244|consensus | Back alignment and domain information |
|---|
| >cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains | Back alignment and domain information |
|---|
| >TIGR01126 pdi_dom protein disulfide-isomerase domain | Back alignment and domain information |
|---|
| >cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif | Back alignment and domain information |
|---|
| >PLN02817 glutathione dehydrogenase (ascorbate) | Back alignment and domain information |
|---|
| >TIGR01262 maiA maleylacetoacetate isomerase | Back alignment and domain information |
|---|
| >cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention | Back alignment and domain information |
|---|
| >KOG0406|consensus | Back alignment and domain information |
|---|
| >PLN02473 glutathione S-transferase | Back alignment and domain information |
|---|
| >PRK10877 protein disulfide isomerase II DsbC; Provisional | Back alignment and domain information |
|---|
| >cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >KOG0907|consensus | Back alignment and domain information |
|---|
| >cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis | Back alignment and domain information |
|---|
| >cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 | Back alignment and domain information |
|---|
| >PLN02378 glutathione S-transferase DHAR1 | Back alignment and domain information |
|---|
| >cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO | Back alignment and domain information |
|---|
| >COG3019 Predicted metal-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) | Back alignment and domain information |
|---|
| >cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains | Back alignment and domain information |
|---|
| >COG2999 GrxB Glutaredoxin 2 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd03079 GST_N_Metaxin2 GST_N family, Metaxin subfamily, Metaxin 2; a metaxin 1 binding protein identified through a yeast two-hybrid system using metaxin 1 as the bait | Back alignment and domain information |
|---|
| >cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases | Back alignment and domain information |
|---|
| >cd03077 GST_N_Alpha GST_N family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >PTZ00062 glutaredoxin; Provisional | Back alignment and domain information |
|---|
| >PF13728 TraF: F plasmid transfer operon protein | Back alignment and domain information |
|---|
| >cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox | Back alignment and domain information |
|---|
| >cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 | Back alignment and domain information |
|---|
| >cd03078 GST_N_Metaxin1_like GST_N family, Metaxin subfamily, Metaxin 1-like proteins; composed of metaxins 1 and 3, and similar proteins including Tom37 from fungi | Back alignment and domain information |
|---|
| >cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein | Back alignment and domain information |
|---|
| >cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors | Back alignment and domain information |
|---|
| >cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus | Back alignment and domain information |
|---|
| >cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 | Back alignment and domain information |
|---|
| >cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold | Back alignment and domain information |
|---|
| >KOG1422|consensus | Back alignment and domain information |
|---|
| >cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins | Back alignment and domain information |
|---|
| >COG0625 Gst Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13728 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional | Back alignment and domain information |
|---|
| >TIGR02740 TraF-like TraF-like protein | Back alignment and domain information |
|---|
| >PRK10357 putative glutathione S-transferase; Provisional | Back alignment and domain information |
|---|
| >PF11009 DUF2847: Protein of unknown function (DUF2847); InterPro: IPR022551 Members of this protein family, including YtxJ from Bacillus subtilis, occur in species that encode proteins for synthesizing bacillithiol | Back alignment and domain information |
|---|
| >PTZ00102 disulphide isomerase; Provisional | Back alignment and domain information |
|---|
| >PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A | Back alignment and domain information |
|---|
| >PLN00410 U5 snRNP protein, DIM1 family; Provisional | Back alignment and domain information |
|---|
| >PLN02395 glutathione S-transferase | Back alignment and domain information |
|---|
| >PF02798 GST_N: Glutathione S-transferase, N-terminal domain; InterPro: IPR004045 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione | Back alignment and domain information |
|---|
| >cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle | Back alignment and domain information |
|---|
| >PTZ00443 Thioredoxin domain-containing protein; Provisional | Back alignment and domain information |
|---|
| >cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) | Back alignment and domain information |
|---|
| >PF06953 ArsD: Arsenical resistance operon trans-acting repressor ArsD; InterPro: IPR010712 This family consists of several bacterial arsenical resistance operon trans-acting repressor ArsD proteins | Back alignment and domain information |
|---|
| >cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein | Back alignment and domain information |
|---|
| >COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK13972 GSH-dependent disulfide bond oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK11752 putative S-transferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF | Back alignment and domain information |
|---|
| >cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif | Back alignment and domain information |
|---|
| >PF06764 DUF1223: Protein of unknown function (DUF1223); InterPro: IPR010634 This family consists of several hypothetical proteins of around 250 residues in length, which are found in both plants and bacteria | Back alignment and domain information |
|---|
| >cd02958 UAS UAS family; UAS is a domain of unknown function | Back alignment and domain information |
|---|
| >PRK13703 conjugal pilus assembly protein TraF; Provisional | Back alignment and domain information |
|---|
| >PTZ00057 glutathione s-transferase; Provisional | Back alignment and domain information |
|---|
| >cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 | Back alignment and domain information |
|---|
| >cd03075 GST_N_Mu GST_N family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress | Back alignment and domain information |
|---|
| >TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB | Back alignment and domain information |
|---|
| >KOG3425|consensus | Back alignment and domain information |
|---|
| >PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like | Back alignment and domain information |
|---|
| >cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX | Back alignment and domain information |
|---|
| >COG5494 Predicted thioredoxin/glutaredoxin [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants | Back alignment and domain information |
|---|
| >TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent | Back alignment and domain information |
|---|
| >TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic | Back alignment and domain information |
|---|
| >PRK03147 thiol-disulfide oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK10542 glutathionine S-transferase; Provisional | Back alignment and domain information |
|---|
| >KOG0868|consensus | Back alignment and domain information |
|---|
| >PLN02309 5'-adenylylsulfate reductase | Back alignment and domain information |
|---|
| >cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif | Back alignment and domain information |
|---|
| >KOG1695|consensus | Back alignment and domain information |
|---|
| >TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily | Back alignment and domain information |
|---|
| >cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif | Back alignment and domain information |
|---|
| >PF10568 Tom37: Outer mitochondrial membrane transport complex protein; InterPro: IPR019564 Tom37 is one of the outer membrane proteins that make up the TOM complex for guiding cytosolic mitochondrial beta-barrel proteins from the cytosol across the outer mitochondrial membrane into the intramembrane space | Back alignment and domain information |
|---|
| >cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus | Back alignment and domain information |
|---|
| >TIGR02661 MauD methylamine dehydrogenase accessory protein MauD | Back alignment and domain information |
|---|
| >cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti | Back alignment and domain information |
|---|
| >COG5429 Uncharacterized secreted protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional | Back alignment and domain information |
|---|
| >COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 205 | ||||
| 2wul_A | 118 | Crystal Structure Of The Human Glutaredoxin 5 With | 5e-28 | ||
| 2lku_A | 109 | Solution Structure Of Reduced Poplar Apo Grxs14 Len | 1e-22 | ||
| 3ipz_A | 109 | Crystal Structure Of Arabidopsis Monothiol Glutared | 7e-22 | ||
| 3gx8_A | 121 | Structural And Biochemical Characterization Of Yeas | 4e-20 | ||
| 3zyw_A | 111 | Crystal Structure Of The First Glutaredoxin Domain | 1e-18 | ||
| 2yan_A | 105 | Crystal Structure Of The Second Glutaredoxin Domain | 4e-17 | ||
| 1wik_A | 109 | Solution Structure Of The Picot Homology 2 Domain O | 1e-15 | ||
| 1yka_A | 115 | Solution Structure Of Grx4, A Monothiol Glutaredoxi | 1e-14 | ||
| 2wci_A | 135 | Structure Of E. Coli Monothiol Glutaredoxin Grx4 Ho | 1e-14 | ||
| 2e7p_A | 116 | Crystal Structure Of The Holo Form Of Glutaredoxin | 1e-06 | ||
| 1z7p_A | 117 | Solution Structure Of Reduced Glutaredoxin C1 From | 1e-06 | ||
| 1jhb_A | 106 | Human Glutaredoxin In Fully Reduced Form, Nmr, 20 S | 1e-04 | ||
| 3fz9_A | 112 | Crystal Structure Of Poplar Glutaredoxin S12 In Com | 4e-04 | ||
| 2khp_A | 92 | Solution Structure Of Glutaredoxin From Brucella Me | 8e-04 |
| >pdb|2WUL|A Chain A, Crystal Structure Of The Human Glutaredoxin 5 With Bound Glutathione In An Fes Cluster Length = 118 | Back alignment and structure |
|
| >pdb|2LKU|A Chain A, Solution Structure Of Reduced Poplar Apo Grxs14 Length = 109 | Back alignment and structure |
| >pdb|3IPZ|A Chain A, Crystal Structure Of Arabidopsis Monothiol Glutaredoxin Atgr Length = 109 | Back alignment and structure |
| >pdb|3GX8|A Chain A, Structural And Biochemical Characterization Of Yeast Monothiol Glutaredoxin Grx5 Length = 121 | Back alignment and structure |
| >pdb|3ZYW|A Chain A, Crystal Structure Of The First Glutaredoxin Domain Of Human Glutaredoxin 3 (Glrx3) Length = 111 | Back alignment and structure |
| >pdb|2YAN|A Chain A, Crystal Structure Of The Second Glutaredoxin Domain Of Human Txnl2 Length = 105 | Back alignment and structure |
| >pdb|1WIK|A Chain A, Solution Structure Of The Picot Homology 2 Domain Of The Mouse Pkc-Interacting Cousin Of Thioredoxin Protein Length = 109 | Back alignment and structure |
| >pdb|1YKA|A Chain A, Solution Structure Of Grx4, A Monothiol Glutaredoxin From E. Coli Length = 115 | Back alignment and structure |
| >pdb|2WCI|A Chain A, Structure Of E. Coli Monothiol Glutaredoxin Grx4 Homodimer Length = 135 | Back alignment and structure |
| >pdb|2E7P|A Chain A, Crystal Structure Of The Holo Form Of Glutaredoxin C1 From Populus Tremula X Tremuloides Length = 116 | Back alignment and structure |
| >pdb|1Z7P|A Chain A, Solution Structure Of Reduced Glutaredoxin C1 From Populus Tremula X Tremuloides Length = 117 | Back alignment and structure |
| >pdb|1JHB|A Chain A, Human Glutaredoxin In Fully Reduced Form, Nmr, 20 Structures Length = 106 | Back alignment and structure |
| >pdb|3FZ9|A Chain A, Crystal Structure Of Poplar Glutaredoxin S12 In Complex With Glutathione Length = 112 | Back alignment and structure |
| >pdb|2KHP|A Chain A, Solution Structure Of Glutaredoxin From Brucella Melitensis Length = 92 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 205 | |||
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 5e-57 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 7e-57 | |
| 2yan_A | 105 | Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H | 9e-57 | |
| 2wem_A | 118 | Glutaredoxin-related protein 5; chromosome 14 open | 1e-55 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 1e-55 | |
| 3gx8_A | 121 | Monothiol glutaredoxin-5, mitochondrial; TRX fold, | 5e-54 | |
| 2wci_A | 135 | Glutaredoxin-4; redox-active center, iron-sulfur c | 4e-53 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 1e-35 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 2e-27 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 6e-26 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 9e-26 | |
| 3l4n_A | 127 | Monothiol glutaredoxin-6; C-terminal domain of GRX | 6e-22 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 8e-22 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 2e-21 | |
| 3ctg_A | 129 | Glutaredoxin-2; reduced form, electron transport, | 3e-21 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 3e-21 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 3e-19 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 3e-19 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 5e-19 | |
| 2jad_A | 362 | Yellow fluorescent protein glutaredoxin fusion pro | 3e-18 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 7e-18 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 4e-16 | |
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 6e-13 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 4e-11 | |
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 6e-11 | |
| 1u6t_A | 121 | SH3 domain-binding glutamic acid-rich-like protein | 3e-10 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 2e-09 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 2e-09 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 5e-09 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 2e-08 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 4e-08 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 8e-07 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 6e-06 | |
| 3nzn_A | 103 | Glutaredoxin; structural genomics, PSI2, MCSG, pro | 4e-05 |
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Length = 109 | Back alignment and structure |
|---|
Score = 174 bits (444), Expect = 5e-57
Identities = 37/101 (36%), Positives = 66/101 (65%)
Query: 29 TDVQKSIDEMVKKSKVVVFMKGVPEAPRCGFSNAVVQILRMHDVPYDSHDVLKDESIRNG 88
+ + + K+ V++FMKG + +CGFS +++IL V Y++ D+L+DE +R G
Sbjct: 2 SSGSSGLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQG 61
Query: 89 IKEYTSWPTIPQVFINGEFVGGCDILLKLHQSGELVEQLEK 129
+K +++WPT PQ+++ G+ VGG DI+ +L +GEL+ L+
Sbjct: 62 LKTFSNWPTYPQLYVRGDLVGGLDIVKELKDNGELLPILKG 102
|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} Length = 109 | Back alignment and structure |
|---|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Length = 121 | Back alignment and structure |
|---|
| >2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Length = 135 | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Length = 116 | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Length = 105 | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Length = 118 | Back alignment and structure |
|---|
| >3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Length = 127 | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Length = 113 | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 130 | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Length = 129 | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Length = 146 | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Length = 82 | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Length = 114 | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Length = 92 | Back alignment and structure |
|---|
| >2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Length = 362 | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} Length = 99 | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Length = 89 | Back alignment and structure |
|---|
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Length = 93 | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Length = 598 | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Length = 121 | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Length = 89 | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Length = 85 | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Length = 81 | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Length = 92 | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Length = 75 | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Length = 87 | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Length = 241 | Back alignment and structure |
|---|
| >3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Length = 103 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 205 | |||
| 2wul_A | 118 | Glutaredoxin related protein 5; chromosome 14 open | 99.97 | |
| 3ipz_A | 109 | Monothiol glutaredoxin-S14, chloroplastic; electro | 99.96 | |
| 3zyw_A | 111 | Glutaredoxin-3; metal binding protein; 1.84A {Homo | 99.96 | |
| 3gx8_A | 121 | Monothiol glutaredoxin-5, mitochondrial; TRX fold, | 99.95 | |
| 2wem_A | 118 | Glutaredoxin-related protein 5; chromosome 14 open | 99.95 | |
| 2wci_A | 135 | Glutaredoxin-4; redox-active center, iron-sulfur c | 99.94 | |
| 3h8q_A | 114 | Thioredoxin reductase 3; oxidoreductase, structura | 99.94 | |
| 2yan_A | 105 | Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H | 99.93 | |
| 1wik_A | 109 | Thioredoxin-like protein 2; picot homology 2 domai | 99.92 | |
| 3l4n_A | 127 | Monothiol glutaredoxin-6; C-terminal domain of GRX | 99.92 | |
| 3rhb_A | 113 | ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox | 99.91 | |
| 1t1v_A | 93 | SH3BGRL3, SH3 domain-binding glutamic acid-rich pr | 99.89 | |
| 3qmx_A | 99 | Glutaredoxin A, glutaredoxin 3; electron transport | 99.89 | |
| 3ctg_A | 129 | Glutaredoxin-2; reduced form, electron transport, | 99.89 | |
| 2ct6_A | 111 | SH3 domain-binding glutamic acid-rich-like protein | 99.89 | |
| 3c1r_A | 118 | Glutaredoxin-1; oxidized form, oxidoreductase, cyt | 99.88 | |
| 1u6t_A | 121 | SH3 domain-binding glutamic acid-rich-like protein | 99.87 | |
| 2jad_A | 362 | Yellow fluorescent protein glutaredoxin fusion pro | 99.86 | |
| 1kte_A | 105 | Thioltransferase; redox-active center, electron tr | 99.85 | |
| 2cq9_A | 130 | GLRX2 protein, glutaredoxin 2; glutathione-S-trans | 99.84 | |
| 2ht9_A | 146 | Glutaredoxin-2; thioredoxin fold, iron-sulfur clus | 99.84 | |
| 2hze_A | 114 | Glutaredoxin-1; thioredoxin fold, arsenic, dimethy | 99.83 | |
| 1aba_A | 87 | Glutaredoxin; electron transport; HET: MES; 1.45A | 99.81 | |
| 2khp_A | 92 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 99.8 | |
| 1fov_A | 82 | Glutaredoxin 3, GRX3; active site disulfide, CIS P | 99.79 | |
| 2lqo_A | 92 | Putative glutaredoxin RV3198.1/MT3292; TRX fold, o | 99.78 | |
| 2klx_A | 89 | Glutaredoxin; thioredoxin type domain, ssgcid, ele | 99.76 | |
| 2x8g_A | 598 | Thioredoxin glutathione reductase; redox-active ce | 99.76 | |
| 3msz_A | 89 | Glutaredoxin 1; alpha-beta sandwich, center for st | 99.71 | |
| 2e7p_A | 116 | Glutaredoxin; thioredoxin fold, poplar, electron t | 99.64 | |
| 3nzn_A | 103 | Glutaredoxin; structural genomics, PSI2, MCSG, pro | 99.59 | |
| 1ego_A | 85 | Glutaredoxin; electron transport; NMR {Escherichia | 99.59 | |
| 1nm3_A | 241 | Protein HI0572; hybrid, peroxiredoxin, glutaredoxi | 99.58 | |
| 3ic4_A | 92 | Glutaredoxin (GRX-1); structural genomics, PSI, MC | 99.57 | |
| 1h75_A | 81 | Glutaredoxin-like protein NRDH; electron transport | 99.49 | |
| 1r7h_A | 75 | NRDH-redoxin; thioredoxin, glutaredoxin, redox pro | 99.48 | |
| 2k8s_A | 80 | Thioredoxin; dimer, structural genomics, PSI-2, pr | 99.24 | |
| 1wjk_A | 100 | C330018D20RIK protein; glutaredoxin, thioredoxin f | 99.23 | |
| 2fgx_A | 107 | Putative thioredoxin; NET3, NESG, GFT-glutaredoxin | 99.14 | |
| 1ttz_A | 87 | Conserved hypothetical protein; structural genomic | 99.14 | |
| 1z3e_A | 132 | Regulatory protein SPX; bacterial transcription re | 98.83 | |
| 1rw1_A | 114 | Conserved hypothetical protein YFFB; thioredoxin f | 98.81 | |
| 2axo_A | 270 | Hypothetical protein ATU2684; alpha beta protein., | 98.81 | |
| 1hyu_A | 521 | AHPF, alkyl hydroperoxide reductase subunit F; thi | 98.8 | |
| 2kok_A | 120 | Arsenate reductase; brucellosis, zoonotic, oxidore | 98.77 | |
| 3kp9_A | 291 | Vkorc1/thioredoxin domain protein; warfarin, disul | 98.52 | |
| 3l78_A | 120 | Regulatory protein SPX; transcription, transcripti | 98.45 | |
| 1s3c_A | 141 | Arsenate reductase; ARSC, arsenite, oxidoreductase | 98.43 | |
| 3rdw_A | 121 | Putative arsenate reductase; structural genomics, | 98.37 | |
| 3gkx_A | 120 | Putative ARSC family related protein; ARSC family | 98.36 | |
| 3kp8_A | 106 | Vkorc1/thioredoxin domain protein; blood coagulati | 98.35 | |
| 3fz4_A | 120 | Putative arsenate reductase; APC61768, structural | 98.34 | |
| 1nho_A | 85 | Probable thioredoxin; beta sheet, alpha helix, oxi | 98.29 | |
| 1fo5_A | 85 | Thioredoxin; disulfide oxidoreductase, structural | 98.17 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 98.17 | |
| 3f0i_A | 119 | Arsenate reductase; structural genomics, IDP01300, | 98.15 | |
| 3ir4_A | 218 | Glutaredoxin 2; glutathione, IDP00895, structural | 97.94 | |
| 2oe3_A | 114 | Thioredoxin-3; electron transport, alpha/beta sand | 97.91 | |
| 2l6c_A | 110 | Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu | 97.87 | |
| 1ep7_A | 112 | Thioredoxin CH1, H-type; electron transport; 2.10A | 97.86 | |
| 3m9j_A | 105 | Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} | 97.82 | |
| 2r4v_A | 247 | XAP121, chloride intracellular channel protein 2; | 97.8 | |
| 2vm1_A | 118 | Thioredoxin, thioredoxin H isoform 1.; oxidoreduct | 97.8 | |
| 2ahe_A | 267 | Chloride intracellular channel protein 4; glutathi | 97.78 | |
| 3qav_A | 243 | RHO-class glutathione S-transferase; cytosol; 2.10 | 97.76 | |
| 3qfa_C | 116 | Thioredoxin; protein-protein complex, rossmann fol | 97.73 | |
| 3f3q_A | 109 | Thioredoxin-1; His TAG, electron transport, cytopl | 97.73 | |
| 2cz2_A | 223 | Maleylacetoacetate isomerase; structural genomics, | 97.7 | |
| 4hoj_A | 210 | REGF protein; GST, glutathione S-transferase, enzy | 97.68 | |
| 2xc2_A | 117 | Thioredoxinn; oxidoreductase, protein disulfide re | 97.68 | |
| 3d6i_A | 112 | Monothiol glutaredoxin-3; thioredoxin-like, electr | 97.67 | |
| 2vim_A | 104 | Thioredoxin, TRX; thioredoxin fold, oxidoreductase | 97.66 | |
| 1oyj_A | 231 | Glutathione S-transferase; herbicide detoxificatio | 97.64 | |
| 3fy7_A | 250 | Chloride intracellular channel protein 3; GST, glu | 97.63 | |
| 1gh2_A | 107 | Thioredoxin-like protein; redox-active center, ele | 97.63 | |
| 1k0m_A | 241 | CLIC1, NCC27, chloride intracellular channel prote | 97.63 | |
| 1yy7_A | 213 | SSPA, stringent starvation protein A; GST fold, tr | 97.63 | |
| 1syr_A | 112 | Thioredoxin; SGPP, structural genomics, PSI, prote | 97.62 | |
| 3lyk_A | 216 | Stringent starvation protein A homolog; structural | 97.62 | |
| 3iv4_A | 112 | Putative oxidoreductase; APC23140, meticillin-resi | 97.61 | |
| 4g10_A | 265 | Glutathione S-transferase homolog; thioredoxin fol | 97.61 | |
| 1axd_A | 209 | Glutathione S-transferase I; transferase, herbicid | 97.61 | |
| 3lyp_A | 215 | Stringent starvation protein A; structural genomic | 97.6 | |
| 3bby_A | 215 | Uncharacterized GST-like protein YFCF; NP_416804.1 | 97.6 | |
| 2vlu_A | 122 | Thioredoxin, thioredoxin H isoform 2.; oxidoreduct | 97.59 | |
| 1xwb_A | 106 | Thioredoxin; dimerization, redox regulation, THI X | 97.58 | |
| 1e6b_A | 221 | Glutathione S-transferase; 1.65A {Arabidopsis thal | 97.58 | |
| 2e0q_A | 104 | Thioredoxin; electron transport; 1.49A {Sulfolobus | 97.58 | |
| 2wz9_A | 153 | Glutaredoxin-3; protein binding; 1.55A {Homo sapie | 97.58 | |
| 1gwc_A | 230 | Glutathione S-transferase TSI-1; herbicide detoxif | 97.57 | |
| 4hi7_A | 228 | GI20122; GST, glutathione S-transferase, enzyme fu | 97.57 | |
| 1zl9_A | 207 | GST class-sigma, glutathione S-transferase 5; glut | 97.56 | |
| 4iel_A | 229 | Glutathione S-transferase, N-terminal domain PROT; | 97.56 | |
| 1gnw_A | 211 | Glutathione S-transferase; herbicide detoxificatio | 97.56 | |
| 3vln_A | 241 | GSTO-1, glutathione S-transferase omega-1; GST fol | 97.55 | |
| 2on5_A | 206 | Nagst-2, Na glutathione S-transferase 2; hookworm; | 97.54 | |
| 3lxz_A | 229 | Glutathione S-transferase family protein; structur | 97.54 | |
| 1ti3_A | 113 | Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul | 97.53 | |
| 2ws2_A | 204 | NU-class GST, glutathione S-transferase; parasite, | 97.52 | |
| 2v6k_A | 214 | Maleylpyruvate isomerase; glutathione-S-transferas | 97.52 | |
| 2vo4_A | 219 | 2,4-D inducible glutathione S-transferase; herbici | 97.52 | |
| 1pn9_A | 209 | GST class-delta, glutathione S-transferase 1-6; pr | 97.51 | |
| 1aw9_A | 216 | Glutathione S-transferase III; herbicide detoxific | 97.51 | |
| 2a2r_A | 210 | Glutathione S-transferase P; detoxification, nitri | 97.51 | |
| 2on7_A | 206 | Nagst-1, Na glutathione S-transferase 1; hookworm; | 97.51 | |
| 2imi_A | 221 | Epsilon-class glutathione S-transferase; HET: GSH; | 97.5 | |
| 1yq1_A | 208 | Glutathione S-transferase; nematoda, structural ge | 97.5 | |
| 1okt_A | 211 | Glutathione S-transferase; GST; 1.9A {Plasmodium f | 97.49 | |
| 1xfl_A | 124 | Thioredoxin H1; AT3G51030, structural genomics, pr | 97.49 | |
| 2cvd_A | 198 | Glutathione-requiring prostaglandin D synthase; gl | 97.48 | |
| 1tw9_A | 206 | Glutathione S-transferase 2; 1.71A {Heligmosomoide | 97.48 | |
| 2yzu_A | 109 | Thioredoxin; redox protein, electron transport, st | 97.48 | |
| 1r26_A | 125 | Thioredoxin; redox-active disulfide, electron tran | 97.48 | |
| 3n5o_A | 235 | Glutathione transferase; seattle structural genomi | 97.47 | |
| 3ay8_A | 216 | Glutathione S-transferase; GST fold, GST binding, | 97.46 | |
| 1v2a_A | 210 | Glutathione transferase GST1-6; glutathione S-tran | 97.45 | |
| 1faa_A | 124 | Thioredoxin F; electron transport; 1.85A {Spinacia | 97.45 | |
| 2i4a_A | 107 | Thioredoxin; acidophIle, disulfide exchange, oxido | 97.44 | |
| 3die_A | 106 | Thioredoxin, TRX; electron transport, SWAP domain, | 97.44 | |
| 3m3m_A | 210 | Glutathione S-transferase; PSI-II, structural geno | 97.43 | |
| 3zzx_A | 105 | Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va | 97.43 | |
| 1zma_A | 118 | Bacterocin transport accessory protein; alpha-beta | 97.42 | |
| 3rbt_A | 246 | Glutathione transferase O1; glutathione S-transfer | 97.41 | |
| 3gnj_A | 111 | Thioredoxin domain protein; APC92103, STR genomics | 97.4 | |
| 2pu9_C | 111 | TRX-F, thioredoxin F-type, chloroplast; protein-pr | 97.4 | |
| 1z9h_A | 290 | Membrane-associated prostaglandin E synthase-2; me | 97.38 | |
| 2c3n_A | 247 | Glutathione S-transferase theta 1; glutathione tra | 97.38 | |
| 3q18_A | 239 | GSTO-2, glutathione S-transferase omega-2; glutath | 97.38 | |
| 1thx_A | 115 | Thioredoxin, thioredoxin 2; oxido-reductase, elect | 97.37 | |
| 3m8n_A | 225 | Possible glutathione S-transferase; PSI-II, struct | 97.37 | |
| 2hnl_A | 225 | Glutathione S-transferase 1; prostaglandin synthas | 97.36 | |
| 3ic8_A | 310 | Uncharacterized GST-like proteinprotein; glutathio | 97.35 | |
| 1r5a_A | 218 | Glutathione transferase; glutathione S-transferase | 97.35 | |
| 1ljr_A | 244 | HGST T2-2, glutathione S-transferase; HET: GSH; 3. | 97.35 | |
| 3gyk_A | 175 | 27KDA outer membrane protein; APC61738.2, siliciba | 97.33 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 97.32 | |
| 4dej_A | 231 | Glutathione S-transferase related protein; transfe | 97.32 | |
| 3f6d_A | 219 | Adgstd4-4, glutathione transferase GST1-4; HET: GT | 97.32 | |
| 3tco_A | 109 | Thioredoxin (TRXA-1); disulfide oxidoreductase, ox | 97.32 | |
| 1k0d_A | 260 | URE2 protein; nitrate assimilation, structural gen | 97.31 | |
| 2gsq_A | 202 | Squid GST, glutathione S-transferase; squid digest | 97.31 | |
| 4f03_A | 253 | Glutathione transferase; GST fold; 1.80A {Phaneroc | 97.3 | |
| 1fb6_A | 105 | Thioredoxin M; electron transport; 2.10A {Spinacia | 97.28 | |
| 1ilo_A | 77 | Conserved hypothetical protein MTH895; beta-alpha- | 97.28 | |
| 3ubk_A | 242 | Glutathione transferase; GSH binding; 1.95A {Lepto | 97.27 | |
| 3uvt_A | 111 | Thioredoxin domain-containing protein 5; thioredox | 97.25 | |
| 1nsw_A | 105 | Thioredoxin, TRX; thermostability, electron transp | 97.25 | |
| 2wb9_A | 211 | Glutathione transferase sigma class; thioredoxin f | 97.25 | |
| 3ibh_A | 233 | GST-II, saccharomyces cerevisiae GTT2; glutathione | 97.25 | |
| 3cxg_A | 133 | Putative thioredoxin; malaria, structural GEN oxid | 97.24 | |
| 3m0f_A | 213 | Uncharacterized protein GST_N; PSI-2, NYSGXRC, glu | 97.24 | |
| 3ein_A | 209 | GST class-theta, glutathione S-transferase 1-1; de | 97.23 | |
| 1x5e_A | 126 | Thioredoxin domain containing protein 1; TMX, TXND | 97.19 | |
| 4hz2_A | 230 | Glutathione S-transferase domain; glutathione,enzy | 97.19 | |
| 2voc_A | 112 | Thioredoxin; electron transport, homodimer, disulf | 97.19 | |
| 3emx_A | 135 | Thioredoxin; structural genomics, oxidoreductase, | 97.18 | |
| 3niv_A | 222 | Glutathione S-transferase; structural genomics, PS | 97.18 | |
| 4glt_A | 225 | Glutathione S-transferase-like protein; structural | 97.17 | |
| 2j23_A | 121 | Thioredoxin; immune protein, autoreactivity, cross | 97.17 | |
| 1w4v_A | 119 | Thioredoxin, mitochondrial; antioxidant enzyme, mi | 97.17 | |
| 3vk9_A | 216 | Glutathione S-transferase delta; glutathione bindi | 97.17 | |
| 4euy_A | 105 | Uncharacterized protein; structural genomics, PSI- | 97.16 | |
| 2f51_A | 118 | Thioredoxin; electron transport; 1.90A {Trichomona | 97.14 | |
| 1t00_A | 112 | Thioredoxin, TRX; redox regulation, multifunction | 97.13 | |
| 2trx_A | 108 | Thioredoxin; electron transport; 1.68A {Escherichi | 97.13 | |
| 3d22_A | 139 | TRXH4, thioredoxin H-type; electron transport, cyt | 97.12 | |
| 1wou_A | 123 | Thioredoxin -related protein, 14 kDa; electron tra | 97.12 | |
| 3r2q_A | 202 | Uncharacterized GST-like protein YIBF; transferase | 97.11 | |
| 2i1u_A | 121 | Thioredoxin, TRX, MPT46; redox protein, electron t | 97.11 | |
| 1vf1_A | 229 | Glutathione S-transferase 3; detoxification; HET: | 97.1 | |
| 1t3b_A | 211 | Thiol:disulfide interchange protein DSBC; oxidored | 97.09 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 97.09 | |
| 1k3y_A | 221 | GSTA1-1, glutathione S-transferase A1; S-hexyl glu | 97.09 | |
| 3fk8_A | 133 | Disulphide isomerase; APC61824.1, xylella fastidio | 97.09 | |
| 1dby_A | 107 | Chloroplast thioredoxin M CH2; thioredoxin CH2, ch | 97.06 | |
| 4exj_A | 238 | Uncharacterized protein; transferase-like protein, | 97.04 | |
| 1tu7_A | 208 | Glutathione S-transferase 2; HET: GSH; 1.50A {Onch | 97.03 | |
| 2fwh_A | 134 | Thiol:disulfide interchange protein DSBD; thioredo | 97.02 | |
| 1eej_A | 216 | Thiol:disulfide interchange protein; oxidoreductas | 97.0 | |
| 1mek_A | 120 | Protein disulfide isomerase; electron transport, r | 96.96 | |
| 2l57_A | 126 | Uncharacterized protein; structural genomics, unkn | 96.96 | |
| 2o8v_B | 128 | Thioredoxin 1; disulfide crosslinked complex, oxid | 96.96 | |
| 2l5l_A | 136 | Thioredoxin; structural genomics, electron transpo | 96.94 | |
| 1m0u_A | 249 | GST2 gene product; flight muscle protein, sigma, t | 96.93 | |
| 3hz4_A | 140 | Thioredoxin; NYSGXRC, PSI-II, reduced form, protei | 96.92 | |
| 3tou_A | 226 | Glutathione S-transferase protein; GSH binding sit | 96.92 | |
| 3cbu_A | 214 | Probable GST-related protein; thioredoxin fold, GS | 96.92 | |
| 4ags_A | 471 | Thiol-dependent reductase 1; transferase, leishman | 96.91 | |
| 3ik7_A | 222 | Glutathione S-transferase A4; human GST A4-4, enzy | 96.9 | |
| 2ppt_A | 155 | Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc | 96.88 | |
| 3gtu_B | 224 | Glutathione S-transferase; conjugation, detoxifica | 96.87 | |
| 2ju5_A | 154 | Thioredoxin disulfide isomerase; protein, oxidored | 96.86 | |
| 3ul3_B | 128 | Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; | 96.85 | |
| 2dj1_A | 140 | Protein disulfide-isomerase A4; protein ERP-72, ER | 96.84 | |
| 1v98_A | 140 | Thioredoxin; oxidoreductase, structural genomics, | 96.84 | |
| 1b48_A | 221 | GST, mgsta4-4, protein (glutathione S-transferase) | 96.83 | |
| 3p2a_A | 148 | Thioredoxin 2, putative thioredoxin-like protein; | 96.83 | |
| 1nhy_A | 219 | EF-1-gamma 1, elongation factor 1-gamma 1; protein | 96.82 | |
| 4ikh_A | 244 | Glutathione S-transferase; enzyme function initiat | 96.82 | |
| 3evi_A | 118 | Phosducin-like protein 2; alpha beta, 3-layer(ABA) | 96.76 | |
| 3aps_A | 122 | DNAJ homolog subfamily C member 10; thioredoxin fo | 96.76 | |
| 2ycd_A | 230 | Glutathione S-transferase; SOIL bacteria, herbicid | 96.76 | |
| 2yv7_A | 260 | CG10997-PA, LD46306P, CLIC; dmclic, chloride ION c | 96.74 | |
| 3gx0_A | 215 | GST-like protein YFCG; transferase, glutathione, g | 96.74 | |
| 1wmj_A | 130 | Thioredoxin H-type; structural genomics, program f | 96.72 | |
| 1oe8_A | 211 | Glutathione S-transferase; schistosomiasis, detoxi | 96.69 | |
| 2dbc_A | 135 | PDCL2, unnamed protein product; phosducin-like pro | 96.65 | |
| 2yv9_A | 291 | Chloride intracellular channel EXC-4; chloride ION | 96.64 | |
| 2av4_A | 160 | Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI | 96.59 | |
| 2kuc_A | 130 | Putative disulphide-isomerase; structural genomics | 96.57 | |
| 1zzo_A | 136 | RV1677; thioredoxin fold, structural genomics, PSI | 96.55 | |
| 4ecj_A | 244 | Glutathione S-transferase; transferase-like protei | 96.55 | |
| 3hxs_A | 141 | Thioredoxin, TRXP; electron transport; 2.00A {Bact | 96.55 | |
| 4id0_A | 214 | Glutathione S-transferase-like protein YIBF; GST, | 96.53 | |
| 1qgv_A | 142 | Spliceosomal protein U5-15KD; snRNP, thioredoxin, | 96.49 | |
| 1x5d_A | 133 | Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC | 96.44 | |
| 2c4j_A | 218 | Glutathione S-transferase MU 2; glutathione transf | 96.38 | |
| 2x64_A | 207 | Glutathione-S-transferase; detoxification enzyme; | 96.38 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 96.36 | |
| 1gsu_A | 219 | GST, CGSTM1-1, class-MU glutathione S-transferase; | 96.35 | |
| 3gix_A | 149 | Thioredoxin-like protein 4B; PRE-mRNA splicing, TX | 96.29 | |
| 2dj0_A | 137 | Thioredoxin-related transmembrane protein 2; AVLA2 | 96.25 | |
| 4hz4_A | 217 | Glutathione-S-transferase; enzyme function initiat | 96.25 | |
| 2fhe_A | 216 | GST, glutathione S-transferase; transferase-substr | 96.23 | |
| 1a8l_A | 226 | Protein disulfide oxidoreductase; PDI, thioredoxin | 96.17 | |
| 1z6n_A | 167 | Hypothetical protein PA1234; alpha-beta-alpha sand | 96.15 | |
| 3iso_A | 218 | Putative glutathione transferase; GST; HET: GSH; 1 | 96.1 | |
| 3lsz_A | 225 | Glutathione S-transferase; xenobiotic, biodegradat | 96.08 | |
| 3f9u_A | 172 | Putative exported cytochrome C biogenesis-related; | 96.03 | |
| 3h79_A | 127 | Thioredoxin-like protein; thioredoxin fold, cataly | 96.02 | |
| 3c8e_A | 288 | YGHU, glutathione S-transferase homologue; glutath | 95.98 | |
| 1z6m_A | 175 | Conserved hypothetical protein; structural genomic | 95.97 | |
| 2dml_A | 130 | Protein disulfide-isomerase A6; thioredoxin domain | 95.96 | |
| 2yj7_A | 106 | LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti | 94.95 | |
| 2f9s_A | 151 | Thiol-disulfide oxidoreductase RESA; thioredoxin-l | 95.94 | |
| 3gv1_A | 147 | Disulfide interchange protein; neisseria gonorrhoe | 95.86 | |
| 3qou_A | 287 | Protein YBBN; thioredoxin-like fold, tetratricopep | 95.85 | |
| 1lu4_A | 136 | Soluble secreted antigen MPT53; thioredoxin-like f | 95.83 | |
| 3uar_A | 227 | Glutathione S-transferase; GSH binding site; HET: | 95.8 | |
| 1dug_A | 234 | Chimera of glutathione S-transferase-synthetic lin | 95.76 | |
| 1a0r_P | 245 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 95.75 | |
| 2lrn_A | 152 | Thiol:disulfide interchange protein; structural ge | 95.69 | |
| 3ph9_A | 151 | Anterior gradient protein 3 homolog; thioredoxin f | 95.66 | |
| 2trc_P | 217 | Phosducin, MEKA, PP33; transducin, beta-gamma, sig | 95.65 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 95.63 | |
| 1n2a_A | 201 | Glutathione S-transferase; HET: GTS; 1.90A {Escher | 95.59 | |
| 3dxb_A | 222 | Thioredoxin N-terminally fused to PUF60(UHM); spli | 95.49 | |
| 1v58_A | 241 | Thiol:disulfide interchange protein DSBG; reduced | 95.47 | |
| 3eur_A | 142 | Uncharacterized protein; PSI2,MCSG, conserved prot | 95.47 | |
| 2lst_A | 130 | Thioredoxin; structural genomics, NEW YORK structu | 94.45 | |
| 2pvq_A | 201 | Glutathione S-transferase; xenobiotics detoxificat | 95.45 | |
| 2b5x_A | 148 | YKUV protein, TRXY; thioredoxin-like, oxidoreducta | 95.43 | |
| 3h93_A | 192 | Thiol:disulfide interchange protein DSBA; disulfid | 95.41 | |
| 3apq_A | 210 | DNAJ homolog subfamily C member 10; thioredoxin fo | 95.37 | |
| 3ewl_A | 142 | Uncharacterized conserved protein BF1870; alpha-be | 95.3 | |
| 1kng_A | 156 | Thiol:disulfide interchange protein CYCY; thioredo | 95.27 | |
| 3ha9_A | 165 | Uncharacterized thioredoxin-like protein; PSI, MCS | 95.27 | |
| 1pmt_A | 203 | PMGST, GST B1-1, glutathione transferase; glutathi | 95.24 | |
| 2djj_A | 121 | PDI, protein disulfide-isomerase; thioredoxin fold | 95.23 | |
| 2dsa_A | 203 | Glutathione S-transferase; HET: GSH HPX; 2.10A {Bu | 95.09 | |
| 2l5o_A | 153 | Putative thioredoxin; structural genomics, unknown | 95.08 | |
| 1o73_A | 144 | Tryparedoxin; electron transport, trypanosomatid, | 94.93 | |
| 3hd5_A | 195 | Thiol:disulfide interchange protein DSBA; protein | 94.92 | |
| 3or5_A | 165 | Thiol:disulfide interchange protein, thioredoxin p | 94.85 | |
| 1sen_A | 164 | Thioredoxin-like protein P19; endoplasmic reticulu | 94.83 | |
| 2lja_A | 152 | Putative thiol-disulfide oxidoreductase; structura | 94.82 | |
| 3h1n_A | 252 | Probable glutathione S-transferase; APC84167, bord | 94.79 | |
| 1i5g_A | 144 | Tryparedoxin II; electron transport; HET: TS5; 1.4 | 94.76 | |
| 4gf0_A | 215 | Glutathione S-transferase; GST, enzyme function in | 94.68 | |
| 3hcz_A | 148 | Possible thiol-disulfide isomerase; APC61559.2, cy | 94.64 | |
| 3ira_A | 173 | Conserved protein; methanosarcina mazei,structural | 94.63 | |
| 1o8x_A | 146 | Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot | 94.56 | |
| 2dj3_A | 133 | Protein disulfide-isomerase A4; protein ERP-72, ER | 94.5 | |
| 2qsi_A | 137 | Putative hydrogenase expression/formation protein; | 94.49 | |
| 1f2e_A | 201 | Glutathione S-transferase; GST complexed with glut | 94.33 | |
| 3kcm_A | 154 | Thioredoxin family protein; SGX, thioredoxin prote | 94.26 | |
| 2rem_A | 193 | Disulfide oxidoreductase; disulfide oxidoreductase | 94.24 | |
| 3ia1_A | 154 | THIO-disulfide isomerase/thioredoxin; oxidoreducta | 94.12 | |
| 1oaz_A | 123 | Thioredoxin 1; immune system, antibody/complex, an | 93.95 | |
| 3lwa_A | 183 | Secreted thiol-disulfide isomerase; thioredoxin, P | 93.89 | |
| 3idv_A | 241 | Protein disulfide-isomerase A4; thioredoxin-like f | 93.85 | |
| 3dml_A | 116 | Putative uncharacterized protein; thioredoxin, oxi | 93.77 | |
| 3fkf_A | 148 | Thiol-disulfide oxidoreductase; structural genomic | 93.77 | |
| 1b8x_A | 280 | Protein (AML-1B); nuclear matrix targeting signal | 93.7 | |
| 2b1k_A | 168 | Thiol:disulfide interchange protein DSBE; C-termin | 93.38 | |
| 3gl3_A | 152 | Putative thiol:disulfide interchange protein DSBE; | 93.37 | |
| 3ppu_A | 352 | Glutathione-S-transferase; GST fold; HET: GSH; 2.3 | 93.33 | |
| 4dvc_A | 184 | Thiol:disulfide interchange protein DSBA; pilus as | 93.25 | |
| 3s9f_A | 165 | Tryparedoxin; thioredoxin fold, disulfide reductas | 93.11 | |
| 1bg5_A | 254 | MAB, fusion protein of alpha-Na,K-ATPase with glut | 92.99 | |
| 2b5e_A | 504 | Protein disulfide-isomerase; 2.40A {Saccharomyces | 92.86 | |
| 2qgv_A | 140 | Hydrogenase-1 operon protein HYAE; alpha-beta prot | 92.8 | |
| 3q6o_A | 244 | Sulfhydryl oxidase 1; protein disulfide isomerase, | 92.74 | |
| 2lrt_A | 152 | Uncharacterized protein; structural genomics, thio | 92.73 | |
| 3ga4_A | 178 | Dolichyl-diphosphooligosaccharide-protein glycosyl | 92.73 | |
| 3ed3_A | 298 | Protein disulfide-isomerase MPD1; thioredoxin-like | 92.56 | |
| 2r2j_A | 382 | Thioredoxin domain-containing protein 4; CRFS moti | 92.23 | |
| 2znm_A | 195 | Thiol:disulfide interchange protein DSBA; thioredo | 92.13 | |
| 3raz_A | 151 | Thioredoxin-related protein; structural genomics, | 92.12 | |
| 3fw2_A | 150 | Thiol-disulfide oxidoreductase; structural genomic | 91.99 | |
| 3lor_A | 160 | Thiol-disulfide isomerase and thioredoxins; PSI, M | 91.98 | |
| 2lus_A | 143 | Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci | 91.21 | |
| 3ktb_A | 106 | Arsenical resistance operon trans-acting represso; | 91.94 | |
| 2es7_A | 142 | Q8ZP25_salty, putative thiol-disulfide isomerase a | 91.81 | |
| 2ywi_A | 196 | Hypothetical conserved protein; uncharacterized co | 91.76 | |
| 3m1g_A | 362 | Putative glutathione S-transferase; ECM4-like subf | 91.75 | |
| 2dlx_A | 153 | UBX domain-containing protein 7; UAS domain, prote | 91.58 | |
| 3kgk_A | 110 | Arsenical resistance operon trans-acting represso; | 91.57 | |
| 3erw_A | 145 | Sporulation thiol-disulfide oxidoreductase A; thio | 90.92 | |
| 2hls_A | 243 | Protein disulfide oxidoreductase; thioredoxin fold | 90.32 | |
| 2cvb_A | 188 | Probable thiol-disulfide isomerase/thioredoxin; re | 89.91 | |
| 3apo_A | 780 | DNAJ homolog subfamily C member 10; PDI family, th | 89.9 | |
| 2h30_A | 164 | Thioredoxin, peptide methionine sulfoxide reductas | 89.6 | |
| 2fno_A | 248 | AGR_PAT_752P; thioredoxin fold, GST C-terminal dom | 89.29 | |
| 3f8u_A | 481 | Protein disulfide-isomerase A3ERP57; endoplasmic r | 89.06 | |
| 2ywm_A | 229 | Glutaredoxin-like protein; redox protein, structur | 88.87 | |
| 3hdc_A | 158 | Thioredoxin family protein; ATCC53774, DSM 7210, , | 88.64 | |
| 3eyt_A | 158 | Uncharacterized protein SPOA0173; thioredoxin-like | 88.28 | |
| 1jfu_A | 186 | Thiol:disulfide interchange protein TLPA; thioredo | 87.84 | |
| 3qcp_A | 470 | QSOX from trypanosoma brucei (tbqsox); ERV fold, t | 87.36 | |
| 1sji_A | 350 | Calsequestrin 2, calsequestrin, cardiac muscle iso | 87.35 | |
| 4evm_A | 138 | Thioredoxin family protein; structural genomics, n | 87.13 | |
| 3us3_A | 367 | Calsequestrin-1; calcium-binding protein; 1.74A {O | 87.08 | |
| 1xg8_A | 111 | Hypothetical protein SA0798; structural genomics, | 86.53 | |
| 2ls5_A | 159 | Uncharacterized protein; structural genomics, unkn | 86.41 | |
| 3uem_A | 361 | Protein disulfide-isomerase; thioredoxin-like doma | 84.86 | |
| 3trh_A | 169 | Phosphoribosylaminoimidazole carboxylase carboxylt | 84.76 | |
| 4gci_A | 211 | Glutathione S-transferase; GST, enzyme function in | 84.61 | |
| 3kh7_A | 176 | Thiol:disulfide interchange protein DSBE; TRX-like | 83.41 | |
| 3drn_A | 161 | Peroxiredoxin, bacterioferritin comigratory prote | 83.36 | |
| 1u11_A | 182 | PURE (N5-carboxyaminoimidazole ribonucleotide MUT; | 81.5 | |
| 3t58_A | 519 | Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. | 81.43 | |
| 3l4e_A | 206 | Uncharacterized peptidase LMO0363; hypothetical pr | 81.03 | |
| 2vup_A | 190 | Glutathione peroxidase-like protein; oxidoreductas | 80.77 |
| >2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
Probab=99.97 E-value=4.9e-30 Score=197.32 Aligned_cols=105 Identities=61% Similarity=1.114 Sum_probs=99.5
Q ss_pred HHHHHHHHHhcCCcEEEEEeeCCCCCCChHHHHHHHHHHhCCC-CeEEEEccCCHhHHHHHHHHhCCCCccEEeeCCeEe
Q psy221 30 DVQKSIDEMVKKSKVVVFMKGVPEAPRCGFSNAVVQILRMHDV-PYDSHDVLKDESIRNGIKEYTSWPTIPQVFINGEFV 108 (205)
Q Consensus 30 ~~~~~l~~~~~~~~VvlYsk~~~~~~~Cp~C~~ak~lL~~~gV-~~~e~DI~~d~~~~~eL~~~~g~~tvPqvFI~G~~I 108 (205)
..++++++++++++||||+||+|..|.||||.+|+++|+.++| +|+++||+.+++++++|++++|++|+|||||||+||
T Consensus 8 ~~~e~i~~~i~~~~VvvF~Kgt~~~P~C~fc~~ak~lL~~~gv~~~~~~~v~~~~~~r~~l~~~sg~~TvPqIFI~g~~I 87 (118)
T 2wul_A 8 GSAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFV 87 (118)
T ss_dssp -CHHHHHHHHHHSSEEEEESBCSSSBSSHHHHHHHHHHHHTTCCSCEEEETTSCHHHHHHHHHHHTCCSSCEEEETTEEE
T ss_pred chHHHHHHHHhcCCEEEEEcCCCCCCCCHHHHHHHHHHHHhCCcCeEeecccCCHHHHHHHHHhccCCCCCeEeECCEEE
Confidence 3467899999999999999999999999999999999999999 699999999999999999999999999999999999
Q ss_pred echhHHHHHHhcccHHHHHhhcCCcc
Q psy221 109 GGCDILLKLHQSGELVEQLEKGDQKR 134 (205)
Q Consensus 109 GG~del~~l~e~GeL~~~L~~~~~~~ 134 (205)
||+|++.+|+++|+|.++|++++...
T Consensus 88 GG~Ddl~~l~~~GeL~~lL~~~Gi~~ 113 (118)
T 2wul_A 88 GGCDILLQMHQNGDLVEELKKLGIHS 113 (118)
T ss_dssp ECHHHHHHHHHHTHHHHHHHHTTCCC
T ss_pred CCHHHHHHHHHCCCHHHHHHHcCCcc
Confidence 99999999999999999999998643
|
| >3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A | Back alignment and structure |
|---|
| >3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} | Back alignment and structure |
|---|
| >3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A | Back alignment and structure |
|---|
| >3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* | Back alignment and structure |
|---|
| >1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A | Back alignment and structure |
|---|
| >3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* | Back alignment and structure |
|---|
| >2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* | Back alignment and structure |
|---|
| >1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A | Back alignment and structure |
|---|
| >2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} | Back alignment and structure |
|---|
| >1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* | Back alignment and structure |
|---|
| >2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* | Back alignment and structure |
|---|
| >2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B | Back alignment and structure |
|---|
| >1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A | Back alignment and structure |
|---|
| >2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} | Back alignment and structure |
|---|
| >1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* | Back alignment and structure |
|---|
| >2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} | Back alignment and structure |
|---|
| >2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* | Back alignment and structure |
|---|
| >3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* | Back alignment and structure |
|---|
| >2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A | Back alignment and structure |
|---|
| >3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A | Back alignment and structure |
|---|
| >1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 | Back alignment and structure |
|---|
| >3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A | Back alignment and structure |
|---|
| >1z3e_A Regulatory protein SPX; bacterial transcription regulation, disulfide stress; 1.50A {Bacillus subtilis} SCOP: c.47.1.12 PDB: 3gfk_A 3ihq_A | Back alignment and structure |
|---|
| >1rw1_A Conserved hypothetical protein YFFB; thioredoxin fold, structure 2 function project, S2F, structu genomics, unknown function; HET: MSE IPA; 1.02A {Pseudomonas aeruginosa} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 | Back alignment and structure |
|---|
| >1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A | Back alignment and structure |
|---|
| >2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} | Back alignment and structure |
|---|
| >3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} | Back alignment and structure |
|---|
| >3l78_A Regulatory protein SPX; transcription, transcriptional factor, disulfide bond, redox-active center, transcription regulati; 1.90A {Streptococcus mutans} SCOP: c.47.1.12 | Back alignment and structure |
|---|
| >1s3c_A Arsenate reductase; ARSC, arsenite, oxidoreductase; 1.25A {Escherichia coli} PDB: 1sd9_A 1i9d_A 1j9b_A 1sd8_A 1jzw_A* 1sk1_A* 1sjz_A* 1sk0_A* 1sk2_A 1s3d_A | Back alignment and structure |
|---|
| >3rdw_A Putative arsenate reductase; structural genomics, center for structural genomics of infec diseases, csgid, oxidoreductase; 2.20A {Yersinia pestis} | Back alignment and structure |
|---|
| >3gkx_A Putative ARSC family related protein; ARSC family protein, structural genomi 2, protein structure initiative; 2.20A {Bacteroides fragilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} | Back alignment and structure |
|---|
| >3fz4_A Putative arsenate reductase; APC61768, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.38A {Streptococcus mutans UA159} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3f0i_A Arsenate reductase; structural genomics, IDP01300, vibrio CH center for structural genomics of infectious diseases, CSGI oxidoreductase; HET: MSE; 1.88A {Vibrio cholerae} | Back alignment and structure |
|---|
| >3ir4_A Glutaredoxin 2; glutathione, IDP00895, structural genomics, for structural genomics of infectious diseases, csgid, oxidoreductase; HET: MSE GSH; 1.20A {Salmonella enterica subsp} PDB: 1g7o_A | Back alignment and structure |
|---|
| >2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A | Back alignment and structure |
|---|
| >2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A | Back alignment and structure |
|---|
| >1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A | Back alignment and structure |
|---|
| >3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... | Back alignment and structure |
|---|
| >2r4v_A XAP121, chloride intracellular channel protein 2; chloride intracellular channels, CLIC2, pore-forming protein ryanodine receptor, chloride channel; HET: GSH; 1.85A {Homo sapiens} PDB: 2r5g_A 2per_A* | Back alignment and structure |
|---|
| >2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A | Back alignment and structure |
|---|
| >2ahe_A Chloride intracellular channel protein 4; glutathione-S-transferase superfamily, CLIC4, NCC27, chloride ION channel, metal transport; 1.80A {Homo sapiens} PDB: 2d2z_A | Back alignment and structure |
|---|
| >3qav_A RHO-class glutathione S-transferase; cytosol; 2.10A {Laternula elliptica} PDB: 3qaw_A* | Back alignment and structure |
|---|
| >3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* | Back alignment and structure |
|---|
| >3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B | Back alignment and structure |
|---|
| >2cz2_A Maleylacetoacetate isomerase; structural genomics, GST, GSTZ1-1, NPPSFA, national project protein structural and functional analyses; HET: GSH; 1.40A {Mus musculus} PDB: 2cz3_A 1fw1_A* | Back alignment and structure |
|---|
| >4hoj_A REGF protein; GST, glutathione S-transferase, enzyme function initiative, structural genomics, transferase; HET: GSH; 1.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A | Back alignment and structure |
|---|
| >3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} | Back alignment and structure |
|---|
| >1oyj_A Glutathione S-transferase; herbicide detoxification; HET: GSH; 1.95A {Oryza sativa} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3fy7_A Chloride intracellular channel protein 3; GST, glutathione, CLIC, chloride channel, ION transport, ionic channel, nucleus, transport, gated channel; 1.95A {Homo sapiens} PDB: 3kjy_A | Back alignment and structure |
|---|
| >1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >1k0m_A CLIC1, NCC27, chloride intracellular channel protein 1; glutathione-S-tranferase superfamily, chloride ION channel, metal transport; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1k0n_A* 1k0o_A 1rk4_A 3uvh_A 3o3t_A 3p90_A 3qr6_A 3p8w_A 3tgz_A 3ma4_A 3swl_A | Back alignment and structure |
|---|
| >1yy7_A SSPA, stringent starvation protein A; GST fold, transcription; HET: CIT; 2.02A {Yersinia pestis} | Back alignment and structure |
|---|
| >1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3lyk_A Stringent starvation protein A homolog; structural genomics, GST-superfamily, SSPA, PSI-2, protein structure initiative; 2.10A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >4g10_A Glutathione S-transferase homolog; thioredoxin fold; HET: MSE GSH; 1.20A {Sphingomonas paucimobilis} | Back alignment and structure |
|---|
| >1axd_A Glutathione S-transferase I; transferase, herbicide detoxification, transferase-transfera inhibitor complex; HET: GGL CYW; 2.50A {Zea mays} SCOP: a.45.1.1 c.47.1.5 PDB: 1bye_A* | Back alignment and structure |
|---|
| >3lyp_A Stringent starvation protein A; structural genomics, GST-superfamily, SSPA, stringent starva protein A homolog, PSI-2; 1.60A {Pseudomonas fluorescens} PDB: 3mdk_A | Back alignment and structure |
|---|
| >3bby_A Uncharacterized GST-like protein YFCF; NP_416804.1, glutathione S-transferase, N-terminal domain, S genomics; 1.85A {Escherichia coli} | Back alignment and structure |
|---|
| >2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* | Back alignment and structure |
|---|
| >1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A | Back alignment and structure |
|---|
| >1e6b_A Glutathione S-transferase; 1.65A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A | Back alignment and structure |
|---|
| >2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A | Back alignment and structure |
|---|
| >1gwc_A Glutathione S-transferase TSI-1; herbicide detoxification, plant, TAU class; HET: GTX; 2.25A {Aegilops tauschii} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4hi7_A GI20122; GST, glutathione S-transferase, enzyme function initiative, structural genomics, unknown function; HET: GSH; 1.25A {Drosophila mojavensis} | Back alignment and structure |
|---|
| >1zl9_A GST class-sigma, glutathione S-transferase 5; glutathione transferase, C.elegans; HET: GSH; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4iel_A Glutathione S-transferase, N-terminal domain PROT; GST, glutathione S-transferase, enzyme function initiative, structural genomics; HET: GSH; 1.60A {Burkholderia ambifaria} | Back alignment and structure |
|---|
| >1gnw_A Glutathione S-transferase; herbicide detoxification; HET: GTX; 2.20A {Arabidopsis thaliana} SCOP: a.45.1.1 c.47.1.5 PDB: 1bx9_A* | Back alignment and structure |
|---|
| >3vln_A GSTO-1, glutathione S-transferase omega-1; GST fold, reductase; HET: ASC; 1.70A {Homo sapiens} PDB: 1eem_A* 3lfl_A* | Back alignment and structure |
|---|
| >2on5_A Nagst-2, Na glutathione S-transferase 2; hookworm; HET: GSH; 1.90A {Necator americanus} | Back alignment and structure |
|---|
| >3lxz_A Glutathione S-transferase family protein; structural genomics, PP0183, PSI-2, protein structure initiative; 1.76A {Pseudomonas putida} PDB: 3pr8_A* | Back alignment and structure |
|---|
| >1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2ws2_A NU-class GST, glutathione S-transferase; parasite, nematode; 2.01A {Haemonchus contortus} | Back alignment and structure |
|---|
| >2v6k_A Maleylpyruvate isomerase; glutathione-S-transferase, GST, plasmid, bacterial, biodegradation, fumaryl pyruvate; HET: TGG; 1.3A {Ralstonia SP} PDB: 2jl4_A* | Back alignment and structure |
|---|
| >2vo4_A 2,4-D inducible glutathione S-transferase; herbicide, TAU class GST, S-(P-nitrobenzyl- glutathione); HET: GTB 4NM; 1.75A {Glycine max} PDB: 3fhs_A* | Back alignment and structure |
|---|
| >1pn9_A GST class-delta, glutathione S-transferase 1-6; protein inhibitor complex; HET: GTX; 2.00A {Anopheles gambiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1aw9_A Glutathione S-transferase III; herbicide detoxification; 2.20A {Zea mays} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2a2r_A Glutathione S-transferase P; detoxification, nitric oxide carrier, S- nitrosoglutathione; HET: MES GSN; 1.40A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 11gs_A* 12gs_A* 14gs_A* 16gs_A* 18gs_A* 21gs_A* 13gs_A* 2a2s_A* 3dd3_A* 3dgq_A* 3n9j_A* 3pgt_A* 1pgt_A* 2pgt_A* 4pgt_A* 22gs_A* 17gs_A* 3gus_A* 10gs_A* 1aqv_A* ... | Back alignment and structure |
|---|
| >2on7_A Nagst-1, Na glutathione S-transferase 1; hookworm; 2.40A {Necator americanus} | Back alignment and structure |
|---|
| >2imi_A Epsilon-class glutathione S-transferase; HET: GSH; 1.40A {Anopheles gambiae} PDB: 2il3_A* 2imk_A* | Back alignment and structure |
|---|
| >1yq1_A Glutathione S-transferase; nematoda, structural genomics, PSI, protein structure initiative; 3.00A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >1okt_A Glutathione S-transferase; GST; 1.9A {Plasmodium falciparum} SCOP: a.45.1.1 c.47.1.5 PDB: 1pa3_A 1q4j_A* 3fr9_A* 3frc_A* 2aaw_A* 3fr6_A 3fr3_A* | Back alignment and structure |
|---|
| >1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2cvd_A Glutathione-requiring prostaglandin D synthase; glutathione-S-transferase, isomerase; HET: GSH HQL; 1.45A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1iyi_A* 1v40_A* 1iyh_A* 3vi5_A* 3vi7_A* 2vcq_A* 2vcw_A* 2vcx_A* 2vcz_A* 2vd0_A* 2vd1_A* 3kxo_A* 3ee2_A* 1pd2_1* | Back alignment and structure |
|---|
| >1tw9_A Glutathione S-transferase 2; 1.71A {Heligmosomoides polygyrus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A | Back alignment and structure |
|---|
| >1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3n5o_A Glutathione transferase; seattle structural genomics center for infectious disease, S GST, pathogenic fungus, coccidioidomycosis; HET: GSH; 1.85A {Coccidioides immitis} PDB: 3lg6_A* | Back alignment and structure |
|---|
| >3ay8_A Glutathione S-transferase; GST fold, GST binding, cytosolic; 2.10A {Bombyx mori} | Back alignment and structure |
|---|
| >1v2a_A Glutathione transferase GST1-6; glutathione S-transferase, detoxification, xenobiotics; HET: GTS; 2.15A {Anopheles dirus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} | Back alignment and structure |
|---|
| >3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A | Back alignment and structure |
|---|
| >3m3m_A Glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, N SGX research center for structural genomics; HET: GSH; 1.75A {Pseudomonas fluorescens} | Back alignment and structure |
|---|
| >3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} | Back alignment and structure |
|---|
| >1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3rbt_A Glutathione transferase O1; glutathione S-transferase omega3; 2.20A {Bombyx mori} | Back alignment and structure |
|---|
| >3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A | Back alignment and structure |
|---|
| >1z9h_A Membrane-associated prostaglandin E synthase-2; membran associated protein, indomethacin, isomerase; HET: IMN; 2.60A {Macaca fascicularis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pbj_A* | Back alignment and structure |
|---|
| >2c3n_A Glutathione S-transferase theta 1; glutathione transferase, polymorphism; 1.5A {Homo sapiens} PDB: 2c3q_A* 2c3t_A | Back alignment and structure |
|---|
| >3q18_A GSTO-2, glutathione S-transferase omega-2; glutathione transferase, dehydroascorbate reductase, reductase; 1.70A {Homo sapiens} PDB: 3q19_A* 3qag_A* | Back alignment and structure |
|---|
| >1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3m8n_A Possible glutathione S-transferase; PSI-II, structural genomics, protein structure initiative, nysgxrc; 2.04A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >2hnl_A Glutathione S-transferase 1; prostaglandin synthase, river BLI onchocerca volvulus, immune modulation; HET: GSH; 2.00A {Onchocerca volvulus} | Back alignment and structure |
|---|
| >3ic8_A Uncharacterized GST-like proteinprotein; glutathione, transferase, PSI, MCSG, structural genomics; 2.40A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1r5a_A Glutathione transferase; glutathione S-transferase, GST, GSH, mosquito, detoxification, xenobiotics; HET: GTS; 2.50A {Anopheles cracens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >1ljr_A HGST T2-2, glutathione S-transferase; HET: GSH; 3.20A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 2ljr_A 3ljr_A* | Back alignment and structure |
|---|
| >3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >4dej_A Glutathione S-transferase related protein; transferase-like protein, transcription regulation; 2.90A {Idiomarina loihiensis} | Back alignment and structure |
|---|
| >3f6d_A Adgstd4-4, glutathione transferase GST1-4; HET: GTX; 1.70A {Anopheles dirus} PDB: 3f63_A* 1jlw_A* 3g7i_A* 3g7j_A* | Back alignment and structure |
|---|
| >3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1k0d_A URE2 protein; nitrate assimilation, structural genomics, gene regulation; HET: GSH; 2.20A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 PDB: 1jzr_A* 1k0b_A* 1k0c_A* 1k0a_A* 1g6w_A 1g6y_A 1hqo_A | Back alignment and structure |
|---|
| >2gsq_A Squid GST, glutathione S-transferase; squid digestive gland, sigma class; HET: GBI; 2.20A {Ommastrephes sloani} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsq_A* | Back alignment and structure |
|---|
| >4f03_A Glutathione transferase; GST fold; 1.80A {Phanerochaete chrysosporium} PDB: 4g19_A* | Back alignment and structure |
|---|
| >1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C | Back alignment and structure |
|---|
| >1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3ubk_A Glutathione transferase; GSH binding; 1.95A {Leptospira interrogans serovar lai} PDB: 3ubl_A* | Back alignment and structure |
|---|
| >3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A | Back alignment and structure |
|---|
| >1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A | Back alignment and structure |
|---|
| >2wb9_A Glutathione transferase sigma class; thioredoxin fold; HET: GSH; 1.59A {Fasciola hepatica} PDB: 2wdu_A* | Back alignment and structure |
|---|
| >3ibh_A GST-II, saccharomyces cerevisiae GTT2; glutathione S-transferase, transferase; HET: GSH; 2.10A {Saccharomyces cerevisiae} PDB: 3erf_A* 3erg_A* | Back alignment and structure |
|---|
| >3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3m0f_A Uncharacterized protein GST_N; PSI-2, NYSGXRC, glutathione, structural genomics, protein structure initiative; HET: GSH; 1.60A {Pseudomonas fluorescens} PDB: 3lxt_A* | Back alignment and structure |
|---|
| >3ein_A GST class-theta, glutathione S-transferase 1-1; delta-class GST; HET: GSH; 1.13A {Drosophila melanogaster} PDB: 3mak_A* 3f6f_A 3gh6_A* 1jlv_A* | Back alignment and structure |
|---|
| >1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4hz2_A Glutathione S-transferase domain; glutathione,enzyme function initiative; HET: GSH; 1.50A {Xanthobacter autotrophicus} | Back alignment and structure |
|---|
| >2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A | Back alignment and structure |
|---|
| >3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3niv_A Glutathione S-transferase; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics; 2.30A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >4glt_A Glutathione S-transferase-like protein; structural genomics, function initiative, EFI; HET: GSH; 2.20A {Methylobacillus flagellatus} | Back alignment and structure |
|---|
| >2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} | Back alignment and structure |
|---|
| >1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A | Back alignment and structure |
|---|
| >3vk9_A Glutathione S-transferase delta; glutathione binding; 2.00A {Bombyx mori} | Back alignment and structure |
|---|
| >4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} | Back alignment and structure |
|---|
| >2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... | Back alignment and structure |
|---|
| >3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A | Back alignment and structure |
|---|
| >1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A | Back alignment and structure |
|---|
| >3r2q_A Uncharacterized GST-like protein YIBF; transferase, glutathione; HET: GSH; 1.05A {Escherichia coli} | Back alignment and structure |
|---|
| >2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A | Back alignment and structure |
|---|
| >1vf1_A Glutathione S-transferase 3; detoxification; HET: GSH; 1.77A {Gallus gallus} PDB: 1vf2_A* 1vf3_A* 1vf4_A | Back alignment and structure |
|---|
| >1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A | Back alignment and structure |
|---|
| >1k3y_A GSTA1-1, glutathione S-transferase A1; S-hexyl glutatione, water structu transferase; HET: GTX; 1.30A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1gsf_A* 1guh_A* 1gsd_A* 1k3o_A 1k3l_A* 1pl1_A* 1pkz_A 1pkw_A* 2r6k_A* 1gse_A* 3u6v_A 1usb_A* 1ydk_A* 3q74_A 3ktl_A* 1pl2_A* 2r3x_A* 1xwg_A 3l0h_A* 1ags_A* ... | Back alignment and structure |
|---|
| >3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >4exj_A Uncharacterized protein; transferase-like protein, transcription regulation, transfer structural genomics; 1.64A {Lodderomyces elongisporus nrrl yb-4239} | Back alignment and structure |
|---|
| >1tu7_A Glutathione S-transferase 2; HET: GSH; 1.50A {Onchocerca volvulus} SCOP: a.45.1.1 c.47.1.5 PDB: 1tu8_A* | Back alignment and structure |
|---|
| >2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A | Back alignment and structure |
|---|
| >1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A | Back alignment and structure |
|---|
| >1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 | Back alignment and structure |
|---|
| >2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} | Back alignment and structure |
|---|
| >2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} | Back alignment and structure |
|---|
| >2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >1m0u_A GST2 gene product; flight muscle protein, sigma, transferase; HET: GSH; 1.75A {Drosophila melanogaster} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3tou_A Glutathione S-transferase protein; GSH binding site, GSH; HET: GSH; 1.75A {Ralstonia solanacearum} PDB: 3tot_A* | Back alignment and structure |
|---|
| >3cbu_A Probable GST-related protein; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics; 2.05A {Ralstonia eutropha} | Back alignment and structure |
|---|
| >4ags_A Thiol-dependent reductase 1; transferase, leishmaniasis, DE-gluathionylation; HET: MSE GSH; 2.30A {Leishmania infantum} | Back alignment and structure |
|---|
| >3ik7_A Glutathione S-transferase A4; human GST A4-4, enzyme, cytoplasm, polymorphism; HET: BOB; 1.97A {Homo sapiens} PDB: 1gum_A 1gul_A* | Back alignment and structure |
|---|
| >2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >3gtu_B Glutathione S-transferase; conjugation, detoxification, cytosolic, heterodimer; 2.80A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} | Back alignment and structure |
|---|
| >3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1b48_A GST, mgsta4-4, protein (glutathione S-transferase); subunit cooperativity; HET: HAG GSH; 2.60A {Mus musculus} SCOP: a.45.1.1 c.47.1.5 PDB: 1guk_A | Back alignment and structure |
|---|
| >3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} | Back alignment and structure |
|---|
| >1nhy_A EF-1-gamma 1, elongation factor 1-gamma 1; protein synthesis, GST-like, translation; 3.00A {Saccharomyces cerevisiae} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >4ikh_A Glutathione S-transferase; enzyme function initiative, EFI, structural genomics; HET: GSH; 2.10A {Pseudomonas protegens} | Back alignment and structure |
|---|
| >3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >2ycd_A Glutathione S-transferase; SOIL bacteria, herbicide detoxification; HET: GTB; 1.40A {Agrobacterium tumefaciens} PDB: 3lq7_A | Back alignment and structure |
|---|
| >2yv7_A CG10997-PA, LD46306P, CLIC; dmclic, chloride ION channel, GST fold, metal transport; 1.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3gx0_A GST-like protein YFCG; transferase, glutathione, glutathione disulfide, disulfide bond oxidoreductase; HET: GDS; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >1oe8_A Glutathione S-transferase; schistosomiasis, detoxifying enzyme, prostaglandin D2 synthase, vaccine candidate; HET: GSH; 1.65A {Schistosoma haematobium} SCOP: a.45.1.1 c.47.1.5 PDB: 1oe7_A* 2c80_A* 2ca8_A* 2f8f_A* 2c8u_A 2caq_A* 2cai_A* 1u3i_A* | Back alignment and structure |
|---|
| >2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yv9_A Chloride intracellular channel EXC-4; chloride ION channel, CLIC, GST fold, metal transport; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A | Back alignment and structure |
|---|
| >4ecj_A Glutathione S-transferase; transferase-like protein, transcription regulation; HET: GSH; 1.76A {Pseudomonas aeruginosa} PDB: 4eci_A* | Back alignment and structure |
|---|
| >3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A | Back alignment and structure |
|---|
| >4id0_A Glutathione S-transferase-like protein YIBF; GST, enzyme function initiative, structural genomics; HET: GSF; 1.10A {Pseudomonas fluorescens} PDB: 4ibp_A* | Back alignment and structure |
|---|
| >1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A | Back alignment and structure |
|---|
| >1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2c4j_A Glutathione S-transferase MU 2; glutathione transferase, multigene family; HET: GSO; 1.35A {Homo sapiens} SCOP: a.45.1.1 c.47.1.5 PDB: 1xw5_A* 1ykc_A* 2ab6_A* 2gtu_A 3gtu_A 3gur_A* 1hna_A* 1hnb_A* 1hnc_A* 1xw6_A* 1xwk_A* 1yj6_A* 2f3m_A* 2dc5_A 1gtu_A 4gtu_A 6gsu_A* 6gsv_A* 6gsw_A* 2gst_A* ... | Back alignment and structure |
|---|
| >2x64_A Glutathione-S-transferase; detoxification enzyme; HET: GSH; 2.30A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A | Back alignment and structure |
|---|
| >1gsu_A GST, CGSTM1-1, class-MU glutathione S-transferase; detoxification enzyme, S-hexyl glutathione; HET: GTX; 1.94A {Gallus gallus} SCOP: a.45.1.1 c.47.1.5 PDB: 1c72_A* | Back alignment and structure |
|---|
| >3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A | Back alignment and structure |
|---|
| >2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4hz4_A Glutathione-S-transferase; enzyme function initiative; 1.62A {Actinobacillus pleuropneumoniae} | Back alignment and structure |
|---|
| >2fhe_A GST, glutathione S-transferase; transferase-substrate complex; HET: GSH; 2.30A {Fasciola hepatica} SCOP: a.45.1.1 c.47.1.5 PDB: 2wrt_A 1fhe_A* | Back alignment and structure |
|---|
| >1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A | Back alignment and structure |
|---|
| >1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A | Back alignment and structure |
|---|
| >3iso_A Putative glutathione transferase; GST; HET: GSH; 1.90A {Clonorchis sinensis} | Back alignment and structure |
|---|
| >3lsz_A Glutathione S-transferase; xenobiotic, biodegradative metabolism, PSI2, NYSGXRC, structural genomics, protein structure initiative; HET: GSH; 1.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} | Back alignment and structure |
|---|
| >3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3c8e_A YGHU, glutathione S-transferase homologue; glutathione transferase homologue, E. coli; HET: GSH; 1.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 | Back alignment and structure |
|---|
| >2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} | Back alignment and structure |
|---|
| >2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A | Back alignment and structure |
|---|
| >3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* | Back alignment and structure |
|---|
| >1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3uar_A Glutathione S-transferase; GSH binding site; HET: GSH; 2.60A {Methylococcus capsulatus} PDB: 3uap_A* | Back alignment and structure |
|---|
| >1dug_A Chimera of glutathione S-transferase-synthetic linker-C-terminal fibrinogen gamma...; gamma chain integrin fragment; HET: GSH; 1.80A {Schistosoma japonicum} SCOP: a.45.1.1 c.47.1.5 PDB: 1gne_A* 3qmz_T 1y6e_A 1m9a_A* 1gtb_A* 1gta_A* 1m99_A* 1m9b_A* 1ua5_A* 1u87_A* 1u88_A* 3crt_A* 3cru_A* 3d0z_A* | Back alignment and structure |
|---|
| >1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C | Back alignment and structure |
|---|
| >2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} | Back alignment and structure |
|---|
| >3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A | Back alignment and structure |
|---|
| >2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
| >1n2a_A Glutathione S-transferase; HET: GTS; 1.90A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 PDB: 1a0f_A* | Back alignment and structure |
|---|
| >3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} | Back alignment and structure |
|---|
| >1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A | Back alignment and structure |
|---|
| >3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} | Back alignment and structure |
|---|
| >2pvq_A Glutathione S-transferase; xenobiotics detoxification, H-site; HET: GSH; 1.80A {Ochrobactrum anthropi} PDB: 2nto_A* | Back alignment and structure |
|---|
| >2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A | Back alignment and structure |
|---|
| >3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} | Back alignment and structure |
|---|
| >3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1pmt_A PMGST, GST B1-1, glutathione transferase; glutathione-conjugating, A putative oxidoreduct; HET: GSH; 2.50A {Proteus mirabilis} SCOP: a.45.1.1 c.47.1.5 PDB: 2pmt_A* | Back alignment and structure |
|---|
| >2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A | Back alignment and structure |
|---|
| >2dsa_A Glutathione S-transferase; HET: GSH HPX; 2.10A {Burkholderia xenovorans} PDB: 2gdr_A* | Back alignment and structure |
|---|
| >2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A | Back alignment and structure |
|---|
| >2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3h1n_A Probable glutathione S-transferase; APC84167, bordetella bronchisepti structural genomics, PSI-2, protein structure initiative; 1.83A {Bordetella bronchiseptica RB50} | Back alignment and structure |
|---|
| >1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A | Back alignment and structure |
|---|
| >4gf0_A Glutathione S-transferase; GST, enzyme function initiative, EFI, structural genomics; HET: GSH; 1.75A {Sulfitobacter} | Back alignment and structure |
|---|
| >3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A | Back alignment and structure |
|---|
| >2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >1f2e_A Glutathione S-transferase; GST complexed with glutathione, thioredoxin superfamily fold transferase; HET: GSH; 2.30A {Sphingomonas paucimobilis} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} | Back alignment and structure |
|---|
| >3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 | Back alignment and structure |
|---|
| >3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A | Back alignment and structure |
|---|
| >3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* | Back alignment and structure |
|---|
| >3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1b8x_A Protein (AML-1B); nuclear matrix targeting signal protein, signal protein; 2.70A {Escherichia coli} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A | Back alignment and structure |
|---|
| >3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} | Back alignment and structure |
|---|
| >3ppu_A Glutathione-S-transferase; GST fold; HET: GSH; 2.30A {Phanerochaete chrysosporium} | Back alignment and structure |
|---|
| >4dvc_A Thiol:disulfide interchange protein DSBA; pilus assembly, oxidoreductase, thioredoxin fold, D disulfide bond, DSBB; HET: DMS; 1.20A {Vibrio cholerae} PDB: 2ijy_A 1bed_A | Back alignment and structure |
|---|
| >3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} | Back alignment and structure |
|---|
| >1bg5_A MAB, fusion protein of alpha-Na,K-ATPase with glutathione S-transferase; ankyrin binding, carrier crystallization, ION transport; 2.60A {Rattus norvegicus} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A | Back alignment and structure |
|---|
| >2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A | Back alignment and structure |
|---|
| >3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* | Back alignment and structure |
|---|
| >3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A | Back alignment and structure |
|---|
| >3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} | Back alignment and structure |
|---|
| >3ktb_A Arsenical resistance operon trans-acting represso; alpha-beta-alpha sandwich, helix-turn-helix, structural GENO PSI-2; 2.10A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A | Back alignment and structure |
|---|
| >2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} | Back alignment and structure |
|---|
| >3m1g_A Putative glutathione S-transferase; ECM4-like subfamily, GST_C family, structural genomics, PSI- protein structure initiative; 2.10A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 | Back alignment and structure |
|---|
| >3kgk_A Arsenical resistance operon trans-acting represso; alpha+beta, chaperone, DNA-binding, RE transcription, transcription regulation; 1.40A {Escherichia coli} PDB: 3mwh_A | Back alignment and structure |
|---|
| >3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A | Back alignment and structure |
|---|
| >3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A | Back alignment and structure |
|---|
| >2fno_A AGR_PAT_752P; thioredoxin fold, GST C-terminal domain-like fold, structura genomics, joint center for structural genomics, JCSG; 2.00A {Agrobacterium tumefaciens} SCOP: a.45.1.1 c.47.1.5 | Back alignment and structure |
|---|
| >3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A | Back alignment and structure |
|---|
| >2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A | Back alignment and structure |
|---|
| >3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} | Back alignment and structure |
|---|
| >3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} | Back alignment and structure |
|---|
| >1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 | Back alignment and structure |
|---|
| >3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* | Back alignment and structure |
|---|
| >1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A | Back alignment and structure |
|---|
| >4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A | Back alignment and structure |
|---|
| >1xg8_A Hypothetical protein SA0798; structural genomics, protein structure initative, MCSG, PSI, protein structure initiative; 2.10A {Staphylococcus aureus subsp} SCOP: c.47.1.17 | Back alignment and structure |
|---|
| >2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A | Back alignment and structure |
|---|
| >3trh_A Phosphoribosylaminoimidazole carboxylase carboxyltransferase subunit; purines, pyrimidines, nucleosides, nucleotides, lyase; 2.20A {Coxiella burnetii} | Back alignment and structure |
|---|
| >4gci_A Glutathione S-transferase; GST, enzyme function initiative, structural genomics; HET: GSH; 1.50A {Yersinia pestis} PDB: 4g9h_A* | Back alignment and structure |
|---|
| >3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A | Back alignment and structure |
|---|
| >3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 | Back alignment and structure |
|---|
| >1u11_A PURE (N5-carboxyaminoimidazole ribonucleotide MUT; acidophIle, protein stability, lyase; HET: CIT; 1.55A {Acetobacter aceti} SCOP: c.23.8.1 PDB: 2fwj_A* 2fw1_A* 2fwb_A 2fwa_A 2fw9_A 2fw7_A 2fw6_A 2fwp_A* 2fwi_A* 2fw8_A | Back alignment and structure |
|---|
| >3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* | Back alignment and structure |
|---|
| >3l4e_A Uncharacterized peptidase LMO0363; hypothetical protein LMO0363, csgid, similar to peptidase E, hydrolase, protease, serine protease; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 205 | ||||
| d1wika_ | 109 | c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (M | 3e-35 | |
| d1ktea_ | 105 | c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) | 2e-21 | |
| d1fova_ | 82 | c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) | 2e-21 | |
| d1t1va_ | 93 | c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [Tax | 1e-17 | |
| d1nm3a1 | 74 | c.47.1.1 (A:166-239) C-terminal, Grx domain of Hyb | 6e-16 | |
| d1egoa_ | 85 | c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) | 3e-14 | |
| d1abaa_ | 87 | c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) | 4e-14 | |
| d1h75a_ | 76 | c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Esch | 2e-12 | |
| d1r7ha_ | 74 | c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Cory | 1e-11 |
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 109 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: Thioltransferase domain: Thioredoxin-like protein 2 species: Mouse (Mus musculus) [TaxId: 10090]
Score = 118 bits (297), Expect = 3e-35
Identities = 37/100 (37%), Positives = 65/100 (65%)
Query: 30 DVQKSIDEMVKKSKVVVFMKGVPEAPRCGFSNAVVQILRMHDVPYDSHDVLKDESIRNGI 89
+ + K+ V++FMKG + +CGFS +++IL V Y++ D+L+DE +R G+
Sbjct: 3 SGSSGLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGL 62
Query: 90 KEYTSWPTIPQVFINGEFVGGCDILLKLHQSGELVEQLEK 129
K +++WPT PQ+++ G+ VGG DI+ +L +GEL+ L+
Sbjct: 63 KTFSNWPTYPQLYVRGDLVGGLDIVKELKDNGELLPILKG 102
|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 105 | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Length = 82 | Back information, alignment and structure |
|---|
| >d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 93 | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Length = 74 | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Length = 85 | Back information, alignment and structure |
|---|
| >d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} Length = 87 | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Length = 76 | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Length = 74 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 205 | |||
| d1wika_ | 109 | Thioredoxin-like protein 2 {Mouse (Mus musculus) [ | 99.96 | |
| d1ktea_ | 105 | Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr | 99.93 | |
| d1fova_ | 82 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 99.93 | |
| d1t1va_ | 93 | SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | 99.86 | |
| d1nm3a1 | 74 | C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus | 99.82 | |
| d1r7ha_ | 74 | Glutaredoxin-like NRDH-redoxin {Corynebacterium am | 99.79 | |
| d1egoa_ | 85 | Glutaredoxin (Grx, thioltransferase) {Escherichia | 99.78 | |
| d1h75a_ | 76 | Glutaredoxin-like NRDH-redoxin {Escherichia coli [ | 99.77 | |
| d1abaa_ | 87 | Glutaredoxin (Grx, thioltransferase) {Bacteriophag | 99.71 | |
| d1wjka_ | 100 | Thioredoxin-like structure containing protein C330 | 99.15 | |
| d1ttza_ | 75 | Hypothetical protein XCC2852 {Xanthomonas campestr | 98.98 | |
| d1hyua4 | 96 | Alkyl hydroperoxide reductase subunit F (AhpF), N- | 98.94 | |
| d1g7oa2 | 75 | Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | 98.75 | |
| d1gwca2 | 83 | Class tau GST {Aegilops tauschii, also known as Tr | 98.4 | |
| d1oyja2 | 84 | Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | 98.39 | |
| d1e6ba2 | 80 | Class zeta GST {Mouse-ear cress (Arabidopsis thali | 98.32 | |
| d1z9ha2 | 113 | Microsomal prostaglandin E synthase-2 {Crab-eating | 98.29 | |
| d1k0ma2 | 86 | Chloride intracellular channel 1 (clic1) {Human (H | 98.29 | |
| d1eema2 | 98 | Class omega GST {Human (Homo sapiens) [TaxId: 9606 | 98.28 | |
| d1v2aa2 | 83 | Class delta GST {Mosquito (Anopheles dirus b), iso | 98.27 | |
| d1aw9a2 | 81 | Class phi GST {Maize (Zea mays), type III [TaxId: | 98.15 | |
| d1k0da2 | 92 | Yeast prion protein ure2p, nitrogen regulation fra | 98.12 | |
| d1nhoa_ | 85 | MTH807, thioredoxin/glutaredoxin-like protein {Arc | 98.03 | |
| d1fw1a2 | 83 | Class zeta GST {Human (Homo sapiens) [TaxId: 9606] | 98.0 | |
| d1r5aa2 | 85 | Class delta GST {Mosquito (Anopheles dirus b), iso | 97.99 | |
| d1axda2 | 80 | Class phi GST {Maize (Zea mays), type I [TaxId: 45 | 97.98 | |
| d1ljra2 | 79 | Class theta GST {Human (Homo sapiens) [TaxId: 9606 | 97.93 | |
| d1a8la2 | 107 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 97.91 | |
| d1r26a_ | 113 | Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | 97.82 | |
| d1xfla_ | 114 | Thioredoxin {Thale cress (Arabidopsis thaliana) [T | 97.79 | |
| d1gnwa2 | 84 | Class phi GST {Mouse-ear cress (Arabidopsis thalia | 97.77 | |
| d1jlva2 | 84 | Class delta GST {Mosquito (Anopheles dirus b), iso | 97.73 | |
| d1ep7a_ | 112 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 97.65 | |
| d1fo5a_ | 85 | MJ0307, thioredoxin/glutaredoxin-like protein {Arc | 97.6 | |
| d1z3ea1 | 114 | Regulatory protein Spx {Bacillus subtilis [TaxId: | 97.58 | |
| d1ti3a_ | 113 | Thioredoxin {European aspen (Populus tremula), thi | 97.56 | |
| d1rw1a_ | 114 | Hypothetical protein PA3664 (YffB) {Pseudomonas ae | 97.49 | |
| d2ifqa1 | 105 | Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | 97.4 | |
| d2a2ra2 | 77 | Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | 97.36 | |
| d1syra_ | 103 | Thioredoxin {Malarial parasite (Plasmodium falcipa | 97.35 | |
| d1gh2a_ | 107 | Thioredoxin-like protein, N-terminal domain {Human | 97.34 | |
| d1zmaa1 | 115 | Bacterocin transport accessory protein Bta {Strept | 97.23 | |
| d1woua_ | 119 | Putative 42-9-9 protein (thioredoxin containing pr | 97.22 | |
| d2cvda2 | 74 | Class sigma GST {Human (Homo sapiens) [TaxId: 9606 | 97.1 | |
| d1dbya_ | 107 | Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 | 97.02 | |
| d1thxa_ | 108 | Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | 97.0 | |
| d1xwaa_ | 111 | Thioredoxin {Fruit fly (Drosophila melanogaster) [ | 96.97 | |
| d1nw2a_ | 105 | Thioredoxin {Alicyclobacillus acidocaldarius, form | 96.93 | |
| d1qgva_ | 137 | spliceosomal protein U5-15Kd {Human (Homo sapiens) | 96.91 | |
| d1f9ma_ | 112 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 96.76 | |
| d1j9ba_ | 138 | Arsenate reductase ArsC {Escherichia coli [TaxId: | 96.74 | |
| d1eeja1 | 156 | Disulfide bond isomerase, DsbC, C-terminal domain | 96.66 | |
| d1fb6a_ | 104 | Thioredoxin {Spinach (Spinacia oleracea), thioredo | 96.48 | |
| d2fwha1 | 117 | Thiol:disulfide interchange protein DsbD, C-termin | 96.47 | |
| d2trxa_ | 108 | Thioredoxin {Escherichia coli [TaxId: 562]} | 96.29 | |
| d1t3ba1 | 150 | Disulfide bond isomerase, DsbC, C-terminal domain | 96.28 | |
| d2gsqa2 | 75 | Class sigma GST {Squid (Ommastrephes sloani pacifi | 96.26 | |
| d1iloa_ | 77 | MTH985, a thioredoxin {Archaeon Methanobacterium t | 96.13 | |
| d2b5ea4 | 119 | Protein disulfide isomerase, PDI {Baker's yeast (S | 96.08 | |
| d1z6na1 | 166 | Hypothetical protein PA1234 {Pseudomonas aeruginos | 95.91 | |
| d1m0ua2 | 76 | Class sigma GST {Fruit fly (Drosophila melanogaste | 95.84 | |
| d1gula2 | 77 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 95.83 | |
| d2hfda1 | 132 | Hydrogenase-1 operon protein HyaE {Escherichia col | 95.74 | |
| d2es7a1 | 119 | Hydrogenase-1 operon protein HyaE {Salmonella typh | 95.34 | |
| d1b48a2 | 78 | Class alpha GST {Mouse (Mus musculus), (a1-4) [Tax | 95.31 | |
| d1tu7a2 | 77 | Class pi GST {Onchocerca volvulus [TaxId: 6282]} | 95.23 | |
| d1okta2 | 85 | Pf GST {Malarial parasite (Plasmodium falciparum) | 95.19 | |
| d2trcp_ | 217 | Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} | 95.02 | |
| d1tw9a2 | 77 | Class sigma GST {Heligmosomoides polygyrus [TaxId: | 94.69 | |
| d1n2aa2 | 80 | Class beta GST {Escherichia coli [TaxId: 562]} | 94.53 | |
| d2c4ja2 | 84 | Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | 94.32 | |
| d1k3ya2 | 79 | Class alpha GST {Human (Homo sapiens), (a1-1) [Tax | 94.11 | |
| d1z6ma1 | 172 | Hypothetical protein EF0770 {Enterococcus faecalis | 93.53 | |
| d1pmta2 | 80 | Class beta GST {Proteus mirabilis [TaxId: 584]} | 93.3 | |
| d1beda_ | 181 | Disulfide-bond formation facilitator (DsbA) {Vibri | 93.24 | |
| d2dlxa1 | 147 | UBX domain-containing protein 7 {Human (Homo sapie | 93.14 | |
| d1a8ya1 | 124 | Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax | 93.02 | |
| d1f2ea2 | 80 | Class beta GST {Sphingomonas paucimobilis [TaxId: | 92.72 | |
| d1v58a1 | 169 | Thiol:disulfide interchange protein DsbG, C-termin | 92.6 | |
| d1meka_ | 120 | Protein disulfide isomerase, PDI {Human (Homo sapi | 92.58 | |
| d1nhya2 | 75 | GST-like domain of elongation factor 1-gamma {Bake | 92.41 | |
| d1duga2 | 80 | Class alpha GST {Schistosoma japonicum [TaxId: 618 | 92.04 | |
| d1a8la1 | 119 | Protein disulfide isomerase, PDI {Archaeon Pyrococ | 92.04 | |
| d1z5ye1 | 136 | Thioredoxin-like protein CcmG (CycY, DsbE) {Escher | 91.59 | |
| d2b5ea1 | 140 | Protein disulfide isomerase, PDI {Baker's yeast (S | 91.08 | |
| d1zzoa1 | 134 | Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI | 90.63 | |
| d1lu4a_ | 134 | Soluble secreted antigen MPT53 {Mycobacterium tube | 89.71 | |
| d1xg8a_ | 111 | Hypothetical protein SA0798 {Staphylococcus aureus | 88.4 | |
| d1fvka_ | 188 | Disulfide-bond formation facilitator (DsbA) {Esche | 87.15 | |
| d1fhea2 | 80 | Class alpha GST {Fasciola hepatica [TaxId: 6192]} | 86.51 | |
| d2fnoa2 | 87 | Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobac | 86.06 | |
| d2obba1 | 122 | Hypothetical protein BT0820 {Bacteroides thetaiota | 85.45 | |
| d1i5ga_ | 144 | Tryparedoxin II {Crithidia fasciculata [TaxId: 565 | 85.38 | |
| d1o8xa_ | 144 | Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 | 85.22 | |
| d2c0ga2 | 122 | Windbeutel, N-terminal domain {Fruit fly (Drosophi | 84.59 | |
| d1sena_ | 135 | Thioredoxin-like protein p19, TLP19 {Human (Homo s | 83.79 | |
| d1o73a_ | 144 | Tryparedoxin I {Trypanosoma brucei brucei [TaxId: | 83.47 | |
| d1knga_ | 144 | Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr | 83.42 | |
| d1un2a_ | 195 | Disulfide-bond formation facilitator (DsbA) {Esche | 81.08 |
| >d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: Thioltransferase domain: Thioredoxin-like protein 2 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.96 E-value=1.7e-29 Score=189.78 Aligned_cols=103 Identities=36% Similarity=0.803 Sum_probs=98.2
Q ss_pred HHHHHHHhcCCcEEEEEeeCCCCCCChHHHHHHHHHHhCCCCeEEEEccCCHhHHHHHHHHhCCCCccEEeeCCeEeech
Q psy221 32 QKSIDEMVKKSKVVVFMKGVPEAPRCGFSNAVVQILRMHDVPYDSHDVLKDESIRNGIKEYTSWPTIPQVFINGEFVGGC 111 (205)
Q Consensus 32 ~~~l~~~~~~~~VvlYsk~~~~~~~Cp~C~~ak~lL~~~gV~~~e~DI~~d~~~~~eL~~~~g~~tvPqvFI~G~~IGG~ 111 (205)
+.++++++++++||||++++|..|.||||.+|+++|++++++|+++||+.+++.+++|.+.++++|+|||||+|++|||+
T Consensus 5 ~~~i~~~i~~~~VvvF~Kgt~~~p~Cp~c~~ak~lL~~~~i~~~~~~v~~~~~~~~~l~~~t~~~TvPqIFi~g~~IGG~ 84 (109)
T d1wika_ 5 SSGLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKTFSNWPTYPQLYVRGDLVGGL 84 (109)
T ss_dssp CCCHHHHHTTSSEEEEESSTTTCCCSSTHHHHHHHHHHTCSCEEEEESSSCHHHHHHHHHHHSCCSSCEEECSSSEEECH
T ss_pred HHHHHHHHhcCCEEEEeCCCCCCCCChHHHHHHHHHHhcCCCceEEEecccHHHHHHHHHhcCCCCCCeEEECCEEEcCH
Confidence 45689999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hHHHHHHhcccHHHHHhhcCCcc
Q psy221 112 DILLKLHQSGELVEQLEKGDQKR 134 (205)
Q Consensus 112 del~~l~e~GeL~~~L~~~~~~~ 134 (205)
||+++|+++|+|.++|++.+++.
T Consensus 85 ddl~~l~~~G~L~~lL~~~~~~~ 107 (109)
T d1wika_ 85 DIVKELKDNGELLPILKGESGPS 107 (109)
T ss_dssp HHHHHHHHHTCSHHHHHTCCSCS
T ss_pred HHHHHHHHCCCHHHHHHhcCCCC
Confidence 99999999999999999887643
|
| >d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t1va_ c.47.1.14 (A:) SH3BGRL3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} | Back information, alignment and structure |
|---|
| >d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1abaa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1g7oa2 c.47.1.5 (A:1-75) Glutaredoxin 2 {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gwca2 c.47.1.5 (A:4-86) Class tau GST {Aegilops tauschii, also known as Triticum tauschii [TaxId: 37682]} | Back information, alignment and structure |
|---|
| >d1oyja2 c.47.1.5 (A:2-85) Class tau GST {Rice (Oryza sativa) [TaxId: 4530]} | Back information, alignment and structure |
|---|
| >d1e6ba2 c.47.1.5 (A:8-87) Class zeta GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1z9ha2 c.47.1.5 (A:100-212) Microsomal prostaglandin E synthase-2 {Crab-eating macaque (Macaca fascicularis) [TaxId: 9541]} | Back information, alignment and structure |
|---|
| >d1k0ma2 c.47.1.5 (A:6-91) Chloride intracellular channel 1 (clic1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1eema2 c.47.1.5 (A:5-102) Class omega GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v2aa2 c.47.1.5 (A:1-83) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-6 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1aw9a2 c.47.1.5 (A:2-82) Class phi GST {Maize (Zea mays), type III [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1k0da2 c.47.1.5 (A:109-200) Yeast prion protein ure2p, nitrogen regulation fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1fw1a2 c.47.1.5 (A:5-87) Class zeta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r5aa2 c.47.1.5 (A:2-86) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-5 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1axda2 c.47.1.5 (A:1-80) Class phi GST {Maize (Zea mays), type I [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1ljra2 c.47.1.5 (A:1-79) Class theta GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1gnwa2 c.47.1.5 (A:2-85) Class phi GST {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1jlva2 c.47.1.5 (A:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]} | Back information, alignment and structure |
|---|
| >d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1z3ea1 c.47.1.12 (A:1-114) Regulatory protein Spx {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} | Back information, alignment and structure |
|---|
| >d1rw1a_ c.47.1.12 (A:) Hypothetical protein PA3664 (YffB) {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2a2ra2 c.47.1.5 (A:1-77) Class pi GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cvda2 c.47.1.5 (A:2-75) Class sigma GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} | Back information, alignment and structure |
|---|
| >d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} | Back information, alignment and structure |
|---|
| >d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2gsqa2 c.47.1.5 (A:1-75) Class sigma GST {Squid (Ommastrephes sloani pacificus) [TaxId: 6634]} | Back information, alignment and structure |
|---|
| >d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1m0ua2 c.47.1.5 (A:47-122) Class sigma GST {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1gula2 c.47.1.5 (A:4-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1b48a2 c.47.1.5 (A:2-79) Class alpha GST {Mouse (Mus musculus), (a1-4) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1tu7a2 c.47.1.5 (A:1-77) Class pi GST {Onchocerca volvulus [TaxId: 6282]} | Back information, alignment and structure |
|---|
| >d1okta2 c.47.1.5 (A:1-85) Pf GST {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1tw9a2 c.47.1.5 (A:1-77) Class sigma GST {Heligmosomoides polygyrus [TaxId: 6339]} | Back information, alignment and structure |
|---|
| >d1n2aa2 c.47.1.5 (A:1-80) Class beta GST {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2c4ja2 c.47.1.5 (A:2-85) Class mu GST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k3ya2 c.47.1.5 (A:2-80) Class alpha GST {Human (Homo sapiens), (a1-1) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1pmta2 c.47.1.5 (A:1-80) Class beta GST {Proteus mirabilis [TaxId: 584]} | Back information, alignment and structure |
|---|
| >d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1f2ea2 c.47.1.5 (A:1-80) Class beta GST {Sphingomonas paucimobilis [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nhya2 c.47.1.5 (A:1-75) GST-like domain of elongation factor 1-gamma {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1duga2 c.47.1.5 (A:1-80) Class alpha GST {Schistosoma japonicum [TaxId: 6182]} | Back information, alignment and structure |
|---|
| >d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xg8a_ c.47.1.17 (A:) Hypothetical protein SA0798 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1fhea2 c.47.1.5 (A:1-80) Class alpha GST {Fasciola hepatica [TaxId: 6192]} | Back information, alignment and structure |
|---|
| >d2fnoa2 c.47.1.5 (A:1-87) Hypothetical protein AGR_pAT_752p/Atu5508 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} | Back information, alignment and structure |
|---|
| >d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} | Back information, alignment and structure |
|---|
| >d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} | Back information, alignment and structure |
|---|
| >d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} | Back information, alignment and structure |
|---|
| >d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|