Psyllid ID: psy2283

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600----
YLYRVTVFISNSTASREHGGEVGKFSIEIHGTKGKTDDISLFKEQFYKPGAEHRQVVGGAGVGHITDVLFRWEHEISVNILTWRLEALIHVSSVLVESLEEKQTVVSFKSELTRQLLIKDDVNVIVNNWGAGSSPPYTQAVANIRLVGYMTAVLLNTLRREVGIRTEYVHLIGHSLGAHLSGYVGSTLRTVYNLKLGRITGLDPADPYFSGTESIVRLDPTDATFVDIVHTDAAPFVKGGLGMGEPIGHLDFYPNGGENQPGCDQGMFAFIHLERGSVVKGLRKYLGCDHIRSYEYFTESVNARCPFIAVECDTWDNFHAGNCFNCLRNNGLSCAKFGLNAVKHRNSQLQALGMSVYKPVYESKPSKYFLITGDKQPFCLHFFQALTHGGLQDTFARGMELHAKVTIFAEGCHGHLTKSLSSRFNLRDNACPQTYGIGLKEVWEVKPELHKPGPLDNKCYGEYGCYSLKYPWTNDARQLSQFPQDPSVMKPIYCLYTRHNPTECQPLEHKNPETIYNSFLIPSHRTFIISHGFLEDGERLWIKFYKPGAEHRQVVGGAGVGHITDVLFRWEHEISVNILTWRLEALIHVSSVLVESLEEKQTFS
ccEEEEEEEcccccccccccccEEEEEEEcccccccccccccccccccccccccEEEEccccccccccccccccccEEEEEccccccccccEEEEEccccccccccHHHHHHHHHHHccccEEEEEEcccccccccHHHHHHcHHHHHHHHHHHHHHHHHHHccccccEEEEEEEHHHHHHHHHHccccccccccccEEEEEccccccccccccccccccccccccEEEEcccccccccccccccccccEEcccccccccccccccccccEEccccccccccccccccccHHHHHHHHHHcccccccEEEEcccHHHHHccccccccccccccccccccccccccHHHHHHccccccccccccccEEEEEEcccccccccEEEEEEEEEEccccccccEEEEEEEEEEEEccccccEEEEccccccccccccccccccccEEEEcccccccccccccccccEEEEccccccccccccccccccccccccccEEEEEEcccccccEEEccccccccccccccccccEEEEEEccccccccHHHHHHHHHHHHcccccccccccEEEEEEEccccccccHHHHHHcccHHHHHHHHHHHHHHcccc
cHHHHHHHHHHHHccccccccccccccccccccccccccccEEEEEEcccccccEEEEccccHHHHHccccccccEEEEEEcEEEcccEEEEEEEEEccccccccHHHHHHHHHHHHHHccEEEEEEEcHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHEEEEEEEEEEcHHHHHHHHHHHHccccccEEEEEccEccccccccccccccHHHccEEEEEccccccHHcccccccccccEEEEccccccccccccccccHHHEEcHHHHHHHHHHHHHcHHHHHHHHHHHHHccccccEEEEcccHHHHHcccccccccccccccccccEEcccccccccccccEEcccccccccccEEEEEcccccccEEEEEEEEEEEcccEEEEEcEEEEEEEEEEEEEcccccccEEEEcEEEcccccccEEEEEEEEEEEEccHHcHHHHEEEEEEEcccccccHHHcccccccccccccccccEEEEEEEEEEccccccEEEEccccccccccccccccEEEEEEcccccccccHHHHHHHHHHHcccccccccEEcEEHHEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
YLYRVTVFIsnstasrehggevgkfsieihgtkgktddislfkeqfykpgaehrqvvggagvghiTDVLFRWEHEISVNILTWRLEALIHVSSVLVESLEEKQTVVSFKSELTRQLLIKDDVNVIVnnwgagssppytqAVANIRLVGYMTAVLLNTLRREVGIRTEYVHLIGHSLgahlsgyvgSTLRTVYNLklgritgldpadpyfsgtesivrldptdatfvdivhtdaapfvkgglgmgepighldfypnggenqpgcdqGMFAFIHLERGSVVKGLRKylgcdhirsyeyftesvnarcpfiavecdtwdnfhagncfnclrnnglscakfgLNAVKHRNSQLQALGmsvykpvyeskpskyflitgdkqpfCLHFFQAlthgglqdtFARGMELHAKVTIfaegchghltKSLSsrfnlrdnacpqtygiglkevwevkpelhkpgpldnkcygeygcyslkypwtndarqlsqfpqdpsvmkpiyclytrhnptecqplehknpetiynsflipshrtfiishgfledgERLWIKfykpgaehrqvvggagvghiTDVLFRWEHEISVNILTWRLEALIHVSSVLVESLEEKQTFS
YLYRVTvfisnstasrehggevgkfsIEIHGTKGKTDDISLFKEQFYKPGAEHRQVVGGAGVGHITDVLFRWEHEISVNILTWRLEALIHVSSVLVESLEEKQTvvsfkseltrqlliKDDVNVIVNNwgagssppYTQAVANIRLVGYMTAVLLNTLRREVGIRTEYVHLIGHSLGAHLSGYVGSTLRTVYNLKLGRITGLDPADPYFSGTESIVRLDPTDATFVDIVHTDAAPFVKGGLGMGEPIGHLDFYPNGGENQPGCDQGMFAFIHLERGSVVKGLRKYLGCDHIRSYEYFTESVNARCPFIAVECDTWDNFHAGNCFNCLRNNGLSCAKFGLNAVKHRNSQLQALGMSVYKPVYESKPSKYFLITGDKQPFCLHFFQALTHGGLQDTFARGMELHAKVTIFAEGCHGHLTKSLSSRFNLRDNACPQTYGIGLKEVWEVKPELHKPGPLDNKCYGEYGCYSLKYPWTNDARQLSQFPQDPSVMKPIYCLYTRHNPTECQPLEHKNPETIYNSFLIPSHRTFIISHGFLEDGERLWIKFYKPGAEHRQVVGGAGVGHITDVLFRWEHEISVNILTWRLEALIHVSSVLvesleekqtfs
YLYRVTVFISNSTASREHGGEVGKFSIEIHGTKGKTDDISLFKEQFYKPGAEHRQVVGGAGVGHITDVLFRWEHEISVNILTWRLEALIHVSSVLVESLEEKQTVVSFKSELTRQLLIKDDVNVIVNNWGAGSSPPYTQAVANIRLVGYMTAVLLNTLRREVGIRTEYVHLIGHSLGAHLSGYVGSTLRTVYNLKLGRITGLDPADPYFSGTESIVRLDPTDATFVDIVHTDAAPFVKGGLGMGEPIGHLDFYPNGGENQPGCDQGMFAFIHLERGSVVKGLRKYLGCDHIRSYEYFTESVNARCPFIAVECDTWDNFHAGNCFNCLRNNGLSCAKFGLNAVKHRNSQLQALGMSVYKPVYESKPSKYFLITGDKQPFCLHFFQALTHGGLQDTFARGMELHAKVTIFAEGCHGHLTKSLSSRFNLRDNACPQTYGIGLKEVWEVKPELHKPGPLDNKCYGEYGCYSLKYPWTNDARQLSQFPQDPSVMKPIYCLYTRHNPTECQPLEHKNPETIYNSFLIPSHRTFIISHGFLEDGERLWIKFYKPGAEHRQVVGGAGVGHITDVLFRWEHEISVNILTWRLEALIHVSSVLVESLEEKQTFS
**YRVTVFIS***********VGKFSIEIHGTKGKTDDISLFKEQFYKPGAEHRQVVGGAGVGHITDVLFRWEHEISVNILTWRLEALIHVSSVLVESLEEKQTVVSFKSELTRQLLIKDDVNVIVNNWGAGSSPPYTQAVANIRLVGYMTAVLLNTLRREVGIRTEYVHLIGHSLGAHLSGYVGSTLRTVYNLKLGRITGLDPADPYFSGTESIVRLDPTDATFVDIVHTDAAPFVKGGLGMGEPIGHLDFYPNGGENQPGCDQGMFAFIHLERGSVVKGLRKYLGCDHIRSYEYFTESVNARCPFIAVECDTWDNFHAGNCFNCLRNNGLSCAKFGLNAVKHRNSQLQALGMSVYKPVYESKPSKYFLITGDKQPFCLHFFQALTHGGLQDTFARGMELHAKVTIFAEGCHGHLTKSLSSRFNLRDNACPQTYGIGLKEVWEVKPELHKPGPLDNKCYGEYGCYSLKYPWTNDARQLSQFPQDPSVMKPIYCLYTRHNPTECQPLEHKNPETIYNSFLIPSHRTFIISHGFLEDGERLWIKFYKPGAEHRQVVGGAGVGHITDVLFRWEHEISVNILTWRLEALIHVSSVLVE*********
YLYRVTVFISNSTASREHGGEVGKFSIE************LFKEQFYKPGAEHRQVVGGAGVGHITDVLFRWEHEISVNILTWRLEALIHVSSVLVESLEEKQTVVSFKSELTRQLLIKDDVNVIVNNWGAGSSPPYTQAVANIRLVGYMTAVLLNTLRREVGIRTEYVHLIGHSLGAHLSGYVGSTLRTVYNLKLGRITGLDPADPYFSGTESIVRLDPTDATFVDIVHTDAAPFVKGGLGMGEPIGHLDFYPNGGENQPGCDQGMFAFIHLERGSVVKGLRKYLGCDHIRSYEYFTESVNARCPFIAVECDTWDNFHAGNCFNCLRNNGLSCAKFGLNAVKHRNSQLQALGMSV****YESKPSKYFLITGDKQPFCLHFFQALTHGGLQDTF**GMELHAKVTIFAEGCHG*************DNACPQTYGIGLKEVWEVKPELHKPGPLDNKCYGEYGCYSLKYPWTNDARQLSQFPQDPSVMKPIYCLYTRHNPTECQPLEHKNPETIYNSFLIPSHRTFIISHGFLEDGERLWIKFYKPGAEHRQVVGGAGVGHITDVLFRWEHEISVNILTWRLEALIHVSSVLVESLEE*****
YLYRVTVFISNSTASREHGGEVGKFSIEIHGTKGKTDDISLFKEQFYKPGAEHRQVVGGAGVGHITDVLFRWEHEISVNILTWRLEALIHVSSVLVESLEEKQTVVSFKSELTRQLLIKDDVNVIVNNWGAGSSPPYTQAVANIRLVGYMTAVLLNTLRREVGIRTEYVHLIGHSLGAHLSGYVGSTLRTVYNLKLGRITGLDPADPYFSGTESIVRLDPTDATFVDIVHTDAAPFVKGGLGMGEPIGHLDFYPNGGENQPGCDQGMFAFIHLERGSVVKGLRKYLGCDHIRSYEYFTESVNARCPFIAVECDTWDNFHAGNCFNCLRNNGLSCAKFGLNAVKHRNSQLQALGMSVYKPVYESKPSKYFLITGDKQPFCLHFFQALTHGGLQDTFARGMELHAKVTIFAEGCHGHLTKSLSSRFNLRDNACPQTYGIGLKEVWEVKPELHKPGPLDNKCYGEYGCYSLKYPWTNDARQLSQFPQDPSVMKPIYCLYTRHNPTECQPLEHKNPETIYNSFLIPSHRTFIISHGFLEDGERLWIKFYKPGAEHRQVVGGAGVGHITDVLFRWEHEISVNILTWRLEALIHVSSVLVE*********
YLYRVTVFISNSTASREHGGEVGKFSIEIHGTKGKTDDISLFKEQFYKPGAEHRQVVGGAGVGHITDVLFRWEHEISVNILTWRLEALIHVSSVLVESLEEKQTVVSFKSELTRQLLIKDDVNVIVNNWGAGSSPPYTQAVANIRLVGYMTAVLLNTLRREVGIRTEYVHLIGHSLGAHLSGYVGSTLRTVYNLKLGRITGLDPADPYFSGTESIVRLDPTDATFVDIVHTDAAPFVKGGLGMGEPIGHLDFYPNGGENQPGCDQGMFAFIHLERGSVVKGLRKYLGCDHIRSYEYFTESVNARCPFIAVECDTWDNFHAGNCFNCLRNNGLSCAKFGLNAVKHRNSQLQALGMSVYKPVYESKPSKYFLITGDKQPFCLHFFQALTHGGLQDTFARGMELHAKVTIFAEGCHGHLTKSLSSRFNLRDNACPQTYGIGLKEVWEVKPELHKPGPLDNKCYGEYGCYSLKYPWTNDARQLSQFPQDPSVMKPIYCLYTRHNPTECQPLEHKNPETIYNSFLIPSHRTFIISHGFLEDGERLWIKFYKPGAEHRQVVGGAGVGHITDVLFRWEHEISVNILTWRLEALIHVSSVLVESLEE*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
YLYRVTVFISNSTASREHGGEVGKFSIEIHGTKGKTDDISLFKEQFYKPGAEHRQVVGGAGVGHITDVLFRWEHEISVNILTWRLEALIHVSSVLVESLEEKQTVVSFKSELTRQLLIKDDVNVIVNNWGAGSSPPYTQAVANIRLVGYMTAVLLNTLRREVGIRTEYVHLIGHSLGAHLSGYVGSTLRTVYNLKLGRITGLDPADPYFSGTESIVRLDPTDATFVDIVHTDAAPFVKGGLGMGEPIGHLDFYPNGGENQPGCDQGMFAFIHLERGSVVKGLRKYLGCDHIRSYEYFTESVNARCPFIAVECDTWDNFHAGNCFNCLRNNGLSCAKFGLNAVKHRNSQLQALGMSVYKPVYESKPSKYFLITGDKQPFCLHFFQALTHGGLQDTFARGMELHAKVTIFAEGCHGHLTKSLSSRFNLRDNACPQTYGIGLKEVWEVKPELHKPGPLDNKCYGEYGCYSLKYPWTNDARQLSQFPQDPSVMKPIYCLYTRHNPTECQPLEHKNPETIYNSFLIPSHRTFIISHGFLEDGERLWIKFYKPGAEHRQVVGGAGVGHITDVLFRWEHEISVNILTWRLEALIHVSSVLVESLEEKQTFS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query604 2.2.26 [Sep-21-2011]
P27657465 Pancreatic triacylglycero yes N/A 0.420 0.546 0.402 1e-50
Q02157465 Pancreatic triacylglycero yes N/A 0.364 0.473 0.460 3e-50
Q64425457 Pancreatic triacylglycero N/A N/A 0.455 0.601 0.361 6e-49
Q6P8U6465 Pancreatic triacylglycero yes N/A 0.413 0.537 0.389 6e-49
O88354465 Pancreatic triacylglycero N/A N/A 0.415 0.539 0.395 1e-48
P00591450 Pancreatic triacylglycero yes N/A 0.350 0.471 0.435 2e-47
Q64424470 Pancreatic lipase-related N/A N/A 0.410 0.527 0.377 2e-47
P54318468 Pancreatic lipase-related no N/A 0.408 0.527 0.386 4e-47
Q5BKQ4473 Inactive pancreatic lipas no N/A 0.447 0.570 0.37 6e-47
P29183461 Pancreatic triacylglycero no N/A 0.355 0.466 0.425 8e-47
>sp|P27657|LIPP_RAT Pancreatic triacylglycerol lipase OS=Rattus norvegicus GN=Pnlip PE=1 SV=1 Back     alignment and function desciption
 Score =  201 bits (511), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 111/276 (40%), Positives = 159/276 (57%), Gaps = 22/276 (7%)

Query: 110 SELTRQLLIKDDVNVIVNNWGAGSSPPYTQAVANIRLVGYMTAVLLNTLRREVGIRTEYV 169
           S++ + +   + VN I  +W  GS   YTQA  N+R+VG   A+L+N L+ ++G   + V
Sbjct: 104 SDMCKNMFKVESVNCICVDWKGGSRATYTQATQNVRVVGAEVALLVNVLKSDLGHPPDNV 163

Query: 170 HLIGHSLGAHLSGYVGSTLRTVYNLKLGRITGLDPADPYFSGTESIVRLDPTDATFVDIV 229
           HLIGHSLG+H++G  G   RT     +GRITGLD A+PYF GT   VRLDPTDA FVD +
Sbjct: 164 HLIGHSLGSHVAGEAGK--RTFG--AIGRITGLDAAEPYFQGTPEEVRLDPTDAQFVDAI 219

Query: 230 HTDAAPFVKG-GLGMGEPIGHLDFYPNGGENQPGCDQGMFAFIHLERGSVVKGLRKYLGC 288
           HTDAAP +   G GM + +GHLDF+PNGG   PGC + + + I ++   + +G R +  C
Sbjct: 220 HTDAAPIIPNLGFGMSQTVGHLDFFPNGGMEMPGCQKNILSQI-VDIDGIWEGTRDFAAC 278

Query: 289 DHIRSYEYFTESVNARCPFIAVECDTWDNFHAGNCFNCLRNNGLSCAKFGLNAVKHRNSQ 348
           +H+RSY+Y+T+S+     F    C +++ F A  CF C       C + G  A K+    
Sbjct: 279 NHLRSYKYYTDSIVNPTGFSGFSCSSYNVFSANKCFPC---GSEGCPQMGHYADKYPGKT 335

Query: 349 LQALGMSVYKPVYESKPSKYFLITGDKQPFCLHFFQ 384
                    K +Y+    K++L TGDK  F    +Q
Sbjct: 336 ---------KELYQ----KFYLNTGDKSNFARWRYQ 358
Plays an important role in fat metabolism. It preferentially splits the esters of long-chain fatty acids at positions 1 and 3, producing mainly 2-monoacylglycerol and free fatty acids, and shows considerably higher activity against insoluble emulsified substrates than against soluble ones.
Rattus norvegicus (taxid: 10116)
EC: 3EC: .EC: 1EC: .EC: 1EC: .EC: 3
>sp|Q02157|LIPP_RABIT Pancreatic triacylglycerol lipase OS=Oryctolagus cuniculus GN=PNLIP PE=2 SV=1 Back     alignment and function description
>sp|Q64425|LIPP_MYOCO Pancreatic triacylglycerol lipase (Fragment) OS=Myocastor coypus GN=PNLIP PE=2 SV=1 Back     alignment and function description
>sp|Q6P8U6|LIPP_MOUSE Pancreatic triacylglycerol lipase OS=Mus musculus GN=Pnlip PE=1 SV=1 Back     alignment and function description
>sp|O88354|LIPP_SPETR Pancreatic triacylglycerol lipase OS=Spermophilus tridecemlineatus GN=PNLIP PE=1 SV=2 Back     alignment and function description
>sp|P00591|LIPP_PIG Pancreatic triacylglycerol lipase OS=Sus scrofa GN=PNLIP PE=1 SV=2 Back     alignment and function description
>sp|Q64424|LIPR2_MYOCO Pancreatic lipase-related protein 2 OS=Myocastor coypus GN=PNLIPRP2 PE=1 SV=1 Back     alignment and function description
>sp|P54318|LIPR2_RAT Pancreatic lipase-related protein 2 OS=Rattus norvegicus GN=Pnliprp2 PE=1 SV=1 Back     alignment and function description
>sp|Q5BKQ4|LIPR1_MOUSE Inactive pancreatic lipase-related protein 1 OS=Mus musculus GN=Pnliprp1 PE=2 SV=2 Back     alignment and function description
>sp|P29183|LIPP_HORSE Pancreatic triacylglycerol lipase (Fragment) OS=Equus caballus GN=PNLIP PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query604
328704872533 PREDICTED: pancreatic lipase-related pro 0.453 0.514 0.516 3e-83
383852577538 PREDICTED: pancreatic lipase-related pro 0.432 0.485 0.510 4e-79
307196197532 Pancreatic lipase-related protein 2 [Har 0.503 0.571 0.464 4e-79
340726560540 PREDICTED: pancreatic lipase-related pro 0.432 0.483 0.5 3e-77
336176042573 pancreatic lipase-related protein 2-like 0.445 0.469 0.487 6e-77
380023890566 PREDICTED: pancreatic lipase-related pro 0.433 0.462 0.494 2e-76
307189427534 Pancreatic lipase-related protein 2 [Cam 0.468 0.529 0.468 3e-76
350418306540 PREDICTED: pancreatic triacylglycerol li 0.432 0.483 0.493 4e-76
332027772499 Pancreatic lipase-related protein 2 [Acr 0.428 0.519 0.489 3e-75
345496424372 PREDICTED: pancreatic lipase-related pro 0.410 0.666 0.501 7e-75
>gi|328704872|ref|XP_001946842.2| PREDICTED: pancreatic lipase-related protein 2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  316 bits (809), Expect = 3e-83,   Method: Compositional matrix adjust.
 Identities = 145/281 (51%), Positives = 202/281 (71%), Gaps = 7/281 (2%)

Query: 111 ELTRQLLIKDDVNVIVNNWGAGSSPPYTQAVANIRLVGYMTAVLLNTLRREVGIRTEYVH 170
           E+ RQ+L + D NVI+ +W  GS  PYTQAVANIR+VG +TA L+N +R E+G+    VH
Sbjct: 132 EIARQILRRYDANVIIIDWEEGSGSPYTQAVANIRMVGRITAHLINVIRMELGLNVGNVH 191

Query: 171 LIGHSLGAHLSGYVGSTLRTVYNLKLGRITGLDPADPYFSGTESIVRLDPTDATFVDIVH 230
           LIGHSLG+HL GYVGS L+T + + +GRITGLDPA+P+FS T+ +VRLDP+DA +VDI+H
Sbjct: 192 LIGHSLGSHLCGYVGSVLKTNFGVTVGRITGLDPAEPHFSQTDPMVRLDPSDAMYVDIIH 251

Query: 231 TDAAPFVKGG---LGMGEPIGHLDFYPNGGENQPGCDQGMFAFIHLERGSVVKGLRKYLG 287
           TD+ PF+KGG   LGM  PIGHLDFYPNGGENQPGC+QGM  +I+ E GS  +G+R++L 
Sbjct: 252 TDSKPFIKGGELSLGMSVPIGHLDFYPNGGENQPGCNQGMMKYINRENGSFYQGMRRFLA 311

Query: 288 CDHIRSYEYFTESVNARCPFIAVECDTWDNFHAGNCFNCLRN---NGLSCAKFGLNAVKH 344
           CDH+R++EYF ESVN  C F+A+ECD+++ F +G CF+CL +   +G  CA+ G+ ++ H
Sbjct: 312 CDHVRAHEYFNESVNTLCNFVAIECDSYEEFLSGECFSCLSDTNPDGKICAEMGMRSLGH 371

Query: 345 RNSQLQALGMSVYKPVYESKPSKYFLITGDKQPFCLHFFQA 385
                  +  S+  P   S   + + +T  + PFC + ++ 
Sbjct: 372 WKKYAATIASSI-DPTNASPHIRLYSLTNGESPFCTYLYRV 411

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383852577|ref|XP_003701803.1| PREDICTED: pancreatic lipase-related protein 1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307196197|gb|EFN77854.1| Pancreatic lipase-related protein 2 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340726560|ref|XP_003401624.1| PREDICTED: pancreatic lipase-related protein 2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|336176042|ref|NP_001229505.1| pancreatic lipase-related protein 2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380023890|ref|XP_003695742.1| PREDICTED: pancreatic lipase-related protein 2-like, partial [Apis florea] Back     alignment and taxonomy information
>gi|307189427|gb|EFN73837.1| Pancreatic lipase-related protein 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|350418306|ref|XP_003491818.1| PREDICTED: pancreatic triacylglycerol lipase-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332027772|gb|EGI67839.1| Pancreatic lipase-related protein 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345496424|ref|XP_001603209.2| PREDICTED: pancreatic lipase-related protein 2-like, partial [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query604
FB|FBgn0029831540 CG5966 [Drosophila melanogaste 0.448 0.501 0.444 3.7e-68
RGD|3360465 Pnlip "pancreatic lipase" [Rat 0.437 0.567 0.400 5.8e-50
RGD|620793468 Pnliprp2 "pancreatic lipase-re 0.394 0.508 0.392 1.6e-49
UNIPROTKB|G3V8A7465 Pnlip "Pancreatic triacylglyce 0.375 0.488 0.432 4.1e-49
MGI|MGI:97722465 Pnlip "pancreatic lipase" [Mus 0.437 0.567 0.386 6.7e-49
UNIPROTKB|F1S4T9444 PNLIP "Pancreatic triacylglyce 0.350 0.477 0.435 5.4e-47
UNIPROTKB|P00591450 PNLIP "Pancreatic triacylglyce 0.350 0.471 0.435 6.9e-47
UNIPROTKB|E2R0H1360 PNLIP "Uncharacterized protein 0.347 0.583 0.430 8.8e-47
UNIPROTKB|Q17RR3467 PNLIPRP3 "Pancreatic lipase-re 0.413 0.535 0.386 1.8e-46
UNIPROTKB|F5H1V6468 PNLIPRP2 "Pancreatic lipase-re 0.370 0.478 0.416 6.2e-46
FB|FBgn0029831 CG5966 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 627 (225.8 bits), Expect = 3.7e-68, Sum P(2) = 3.7e-68
 Identities = 125/281 (44%), Positives = 186/281 (66%)

Query:   123 NVIVNNWGAGSSPPYTQAVANIRLVGYMTAVLLNTLRREVGI-RTEYVHLIGHSLGAHLS 181
             +V++ +WG G+SPPY QAVANIRLVG +TA +++ L  E+ +   + VH+IGHSLGAHLS
Sbjct:   146 SVVLIDWGGGASPPYVQAVANIRLVGAITAHVVHMLYEELRLPNLDNVHIIGHSLGAHLS 205

Query:   182 GYVGSTLRTVYNLKLGRITGLDPADPYFSGTESIVRLDPTDATFVDIVHTDAAPFVKGGL 241
             GY G  L+  + LK  RITGLDPA P F+ T+ IVRLD TDA FVDIVHTDA P +KGGL
Sbjct:   206 GYAGYHLQHDFGLKPARITGLDPAAPLFTDTDPIVRLDKTDAHFVDIVHTDANPLMKGGL 265

Query:   242 GMGEPIGHLDFYPNGGENQPGCDQGMFAFIHLERGSVVKGLRKYLGCDHIRSYEYFTESV 301
             G+   +GH+DF+PNGG + PGC++  F  + +++ ++   ++++LGC+HIRS +YFTES+
Sbjct:   266 GINMRLGHVDFFPNGGFDNPGCNK-KFQDV-VKKKTLFLTMQEFLGCNHIRSQQYFTESI 323

Query:   302 NARCPFIAVECDTWDNFHAGNCFNCLRNNGLSCAKFGLNAVKHRNSQLQALGMSVYKPVY 361
              ++CPF+ + CD++++F    C +C    G +C + G ++ +    Q+  LG        
Sbjct:   324 GSQCPFLGITCDSFESFKDTKCTSC-EEPGHTCLRMGYHSQEDYQEQVD-LGQLQQG--- 378

Query:   362 ESKPSKYFLITGDKQPFC-LHFFQALTHGGLQDTFARGMEL 401
                P  ++L TGD +PFC LH+   +   G  ++   G E+
Sbjct:   379 -DSPGVFYLWTGDSKPFCRLHYRITVRVSGHDESTLHGGEV 418
GO:0004806 "triglyceride lipase activity" evidence=ISS
GO:0006629 "lipid metabolic process" evidence=IEA
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
RGD|3360 Pnlip "pancreatic lipase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|620793 Pnliprp2 "pancreatic lipase-related protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V8A7 Pnlip "Pancreatic triacylglycerol lipase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:97722 Pnlip "pancreatic lipase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1S4T9 PNLIP "Pancreatic triacylglycerol lipase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P00591 PNLIP "Pancreatic triacylglycerol lipase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2R0H1 PNLIP "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q17RR3 PNLIPRP3 "Pancreatic lipase-related protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5H1V6 PNLIPRP2 "Pancreatic lipase-related protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query604
cd00707275 cd00707, Pancreat_lipase_like, Pancreatic lipase-l 2e-87
pfam00151329 pfam00151, Lipase, Lipase 6e-78
TIGR03230442 TIGR03230, lipo_lipase, lipoprotein lipase 3e-41
cd00741153 cd00741, Lipase, Lipase 5e-23
cd00707 275 cd00707, Pancreat_lipase_like, Pancreatic lipase-l 3e-09
pfam00151 329 pfam00151, Lipase, Lipase 1e-05
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 2e-05
cd01759113 cd01759, PLAT_PL, PLAT/LH2 domain of pancreatic tr 6e-04
cd01755120 cd01755, PLAT_lipase, PLAT/ LH2 domain present in 0.001
>gnl|CDD|238363 cd00707, Pancreat_lipase_like, Pancreatic lipase-like enzymes Back     alignment and domain information 
 Score =  272 bits (697), Expect = 2e-87
 Identities = 110/265 (41%), Positives = 142/265 (53%), Gaps = 44/265 (16%)

Query: 110 SELTRQLLIKDDVNVIVNNWGAGSSPPYTQAVANIRLVGYMTAVLLNTLRREVGIRTEYV 169
           S+L +  L + D NVIV +WG G++P Y QAV N R+VG   A  L+ L    G+  E V
Sbjct: 55  SDLRKAYLSRGDYNVIVVDWGRGANPNYPQAVNNTRVVGAELAKFLDFLVDNTGLSLENV 114

Query: 170 HLIGHSLGAHLSGYVGSTLRTVYNLKLGRITGLDPADPYFSGTESIVRLDPTDATFVDIV 229
           HLIGHSLGAH++G+ G  L      KLGRITGLDPA P FSG +   RLDP+DA FVD++
Sbjct: 115 HLIGHSLGAHVAGFAGKRLNG----KLGRITGLDPAGPLFSGADPEDRLDPSDAQFVDVI 170

Query: 230 HTDAAPFVKGGLGMGEPIGHLDFYPNGGENQPGCDQGMFAFIHLERGSVVKGLRKYLGCD 289
           HTD      G LG  +PIGH DFYPNGG +QPGC                     ++ C 
Sbjct: 171 HTDG-----GLLGFSQPIGHADFYPNGGRDQPGCP-------------KDILSSDFVACS 212

Query: 290 HIRSYEYFTESVNARCPFIAVECDTWDNFHAGNCFNCLRNNGLSCAKFGLNAVKHRNSQL 349
           H R+  YF ES+ + C F+A  C ++D F AG CF C    G  C + G +A + R    
Sbjct: 213 HQRAVHYFAESILSPCGFVAYPCSSYDEFLAGKCFPC----GSGCVRMGYHADRFR---- 264

Query: 350 QALGMSVYKPVYESKPSKYFLITGD 374
                         +  K++L T  
Sbjct: 265 --------------REGKFYLKTNA 275

Lipases are esterases that can hydrolyze long-chain acyl-triglycerides into di- and monoglycerides, glycerol, and free fatty acids at a water/lipid interface. A typical feature of lipases is "interfacial activation," the process of becoming active at the lipid/water interface, although several examples of lipases have been identified that do not undergo interfacial activation . The active site of a lipase contains a catalytic triad consisting of Ser - His - Asp/Glu, but unlike most serine proteases, the active site is buried inside the structure. A "lid" or "flap" covers the active site, making it inaccessible to solvent and substrates. The lid opens during the process of interfacial activation, allowing the lipid substrate access to the active site. Length = 275
>gnl|CDD|215752 pfam00151, Lipase, Lipase Back     alignment and domain information
>gnl|CDD|132274 TIGR03230, lipo_lipase, lipoprotein lipase Back     alignment and domain information
>gnl|CDD|238382 cd00741, Lipase, Lipase Back     alignment and domain information
>gnl|CDD|238363 cd00707, Pancreat_lipase_like, Pancreatic lipase-like enzymes Back     alignment and domain information
>gnl|CDD|215752 pfam00151, Lipase, Lipase Back     alignment and domain information
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|238857 cd01759, PLAT_PL, PLAT/LH2 domain of pancreatic triglyceride lipase Back     alignment and domain information
>gnl|CDD|238853 cd01755, PLAT_lipase, PLAT/ LH2 domain present in connection with a lipase domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 604
TIGR03230442 lipo_lipase lipoprotein lipase. Members of this pr 100.0
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 100.0
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 100.0
KOG2415|consensus 621 99.96
PF00151 331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 99.8
TIGR03230 442 lipo_lipase lipoprotein lipase. Members of this pr 99.28
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 99.21
cd00707 275 Pancreat_lipase_like Pancreatic lipase-like enzyme 99.21
PRK00870302 haloalkane dehalogenase; Provisional 98.77
PLN02824294 hydrolase, alpha/beta fold family protein 98.74
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 98.66
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 98.66
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 98.61
PLN02298330 hydrolase, alpha/beta fold family protein 98.56
PRK10673255 acyl-CoA esterase; Provisional 98.55
PLN02965255 Probable pheophorbidase 98.54
PRK03592295 haloalkane dehalogenase; Provisional 98.54
PLN02679360 hydrolase, alpha/beta fold family protein 98.5
PLN02578354 hydrolase 98.47
PLN02385349 hydrolase; alpha/beta fold family protein 98.45
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 98.45
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 98.44
PRK03204286 haloalkane dehalogenase; Provisional 98.41
PHA02857276 monoglyceride lipase; Provisional 98.39
PRK10349256 carboxylesterase BioH; Provisional 98.38
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 98.37
PLN02894402 hydrolase, alpha/beta fold family protein 98.37
TIGR03611257 RutD pyrimidine utilization protein D. This protei 98.37
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 98.37
PLN02211273 methyl indole-3-acetate methyltransferase 98.37
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 98.34
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 98.34
PRK10749330 lysophospholipase L2; Provisional 98.34
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 98.33
PLN03084383 alpha/beta hydrolase fold protein; Provisional 98.28
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 98.26
PLN00021313 chlorophyllase 98.23
PRK06489360 hypothetical protein; Provisional 98.22
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 98.22
PLN02511388 hydrolase 98.21
PRK11071190 esterase YqiA; Provisional 98.21
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 98.18
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 98.12
KOG4409|consensus365 98.06
PRK08775343 homoserine O-acetyltransferase; Provisional 98.05
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 98.01
PRK10566249 esterase; Provisional 98.0
PRK10162318 acetyl esterase; Provisional 97.98
PF07859211 Abhydrolase_3: alpha/beta hydrolase fold A web pag 97.9
PLN02652395 hydrolase; alpha/beta fold family protein 97.89
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 97.85
PRK10985324 putative hydrolase; Provisional 97.85
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 97.84
PRK11460232 putative hydrolase; Provisional 97.83
KOG4178|consensus322 97.83
COG2267298 PldB Lysophospholipase [Lipid metabolism] 97.81
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 97.79
PRK05855582 short chain dehydrogenase; Validated 97.77
COG0429345 Predicted hydrolase of the alpha/beta-hydrolase fo 97.76
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 97.74
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 97.74
KOG2564|consensus343 97.73
PRK07581339 hypothetical protein; Validated 97.73
PRK00175379 metX homoserine O-acetyltransferase; Provisional 97.73
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 97.73
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 97.67
PRK05077414 frsA fermentation/respiration switch protein; Revi 97.67
PLN02442283 S-formylglutathione hydrolase 97.58
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 97.56
KOG1454|consensus326 97.51
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 97.47
PRK13604307 luxD acyl transferase; Provisional 97.43
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 97.43
KOG2382|consensus315 97.27
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 97.25
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 97.23
cd01759113 PLAT_PL PLAT/LH2 domain of pancreatic triglyceride 97.22
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 97.19
cd01758137 PLAT_LPL PLAT/ LH2 domain present in lipoprotein l 97.07
COG0657312 Aes Esterase/lipase [Lipid metabolism] 97.07
PF01738218 DLH: Dienelactone hydrolase family; InterPro: IPR0 97.01
PLN02872395 triacylglycerol lipase 97.0
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 96.91
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 96.85
PRK07868 994 acyl-CoA synthetase; Validated 96.73
cd01755120 PLAT_lipase PLAT/ LH2 domain present in connection 96.7
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 96.69
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 96.68
PF07224307 Chlorophyllase: Chlorophyllase; InterPro: IPR01082 96.55
PF12740259 Chlorophyllase2: Chlorophyllase enzyme; InterPro: 96.5
KOG1455|consensus313 96.45
COG4782377 Uncharacterized protein conserved in bacteria [Fun 96.45
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 96.33
TIGR00976550 /NonD putative hydrolase, CocE/NonD family. This m 96.27
COG0400207 Predicted esterase [General function prediction on 96.2
KOG4627|consensus270 96.19
PF06057192 VirJ: Bacterial virulence protein (VirJ); InterPro 96.18
PF10230266 DUF2305: Uncharacterised conserved protein (DUF230 96.02
PRK06765389 homoserine O-acetyltransferase; Provisional 96.01
cd01759113 PLAT_PL PLAT/LH2 domain of pancreatic triglyceride 95.6
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 95.36
PF05728187 UPF0227: Uncharacterised protein family (UPF0227); 95.36
PRK102521296 entF enterobactin synthase subunit F; Provisional 95.33
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 95.31
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 95.3
PLN02733440 phosphatidylcholine-sterol O-acyltransferase 95.1
PF03403379 PAF-AH_p_II: Platelet-activating factor acetylhydr 95.07
KOG1515|consensus336 95.03
PF00756251 Esterase: Putative esterase; InterPro: IPR000801 T 94.75
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 94.71
COG1647243 Esterase/lipase [General function prediction only] 94.7
cd01758137 PLAT_LPL PLAT/ LH2 domain present in lipoprotein l 94.58
KOG1838|consensus409 94.28
cd01755120 PLAT_lipase PLAT/ LH2 domain present in connection 94.03
KOG1552|consensus258 93.9
PF10503220 Esterase_phd: Esterase PHB depolymerase 93.81
PF05677365 DUF818: Chlamydia CHLPS protein (DUF818); InterPro 93.64
PF06342297 DUF1057: Alpha/beta hydrolase of unknown function 93.63
PF02450389 LCAT: Lecithin:cholesterol acyltransferase; InterP 93.54
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 93.14
PF08538303 DUF1749: Protein of unknown function (DUF1749); In 93.08
COG3319257 Thioesterase domains of type I polyketide synthase 93.03
KOG2112|consensus206 92.91
COG3208244 GrsT Predicted thioesterase involved in non-riboso 92.9
smart00824212 PKS_TE Thioesterase. Peptide synthetases are invol 92.88
COG0412236 Dienelactone hydrolase and related enzymes [Second 92.73
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 92.6
PLN02408365 phospholipase A1 92.28
COG1075336 LipA Predicted acetyltransferases and hydrolases w 91.69
TIGR01839560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 91.65
PF06500411 DUF1100: Alpha/beta hydrolase of unknown function 91.39
PRK10439411 enterobactin/ferric enterobactin esterase; Provisi 91.16
COG0627316 Predicted esterase [General function prediction on 90.9
cd00312493 Esterase_lipase Esterases and lipases (includes fu 90.84
PLN02753531 triacylglycerol lipase 90.42
TIGR01849406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 90.16
KOG4391|consensus300 89.99
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 89.74
PF05277345 DUF726: Protein of unknown function (DUF726); Inte 89.4
PTZ00472462 serine carboxypeptidase (CBP1); Provisional 89.18
PLN02802509 triacylglycerol lipase 89.13
PF08840213 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C term 89.09
PF1214679 Hydrolase_4: Putative lysophospholipase; InterPro: 88.76
PLN02454414 triacylglycerol lipase 88.6
COG1506620 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-pept 88.42
PRK04940180 hypothetical protein; Provisional 88.4
PLN02847633 triacylglycerol lipase 87.61
PF09752348 DUF2048: Uncharacterized conserved protein (DUF204 87.39
PF12715390 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8 87.2
COG3509312 LpqC Poly(3-hydroxybutyrate) depolymerase [Seconda 86.64
PLN02719518 triacylglycerol lipase 86.57
PLN02324415 triacylglycerol lipase 86.31
PLN02571413 triacylglycerol lipase 85.24
KOG3724|consensus 973 84.87
COG4757281 Predicted alpha/beta hydrolase [General function p 84.73
PRK10015429 oxidoreductase; Provisional 83.99
PLN00413479 triacylglycerol lipase 83.87
PF05448320 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR0 83.81
COG3946456 VirJ Type IV secretory pathway, VirJ component [In 83.38
KOG4372|consensus405 83.15
PLN02761527 lipase class 3 family protein 82.52
PLN02633314 palmitoyl protein thioesterase family protein 81.83
PLN02310405 triacylglycerol lipase 81.79
PF02089279 Palm_thioest: Palmitoyl protein thioesterase; Inte 80.95
PF08237225 PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum 80.83
PF03583290 LIP: Secretory lipase ; InterPro: IPR005152 This e 80.7
PF10340374 DUF2424: Protein of unknown function (DUF2424); In 80.25
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information 
Probab=100.00  E-value=1.1e-79  Score=666.25  Aligned_cols=397  Identities=26%  Similarity=0.432  Sum_probs=324.1

Q ss_pred             hhhhcCC-CCcc-ceeeecCccccccccccccCCcceeeEEecccccccceeeeeeeccccCCCccchHHHHHHHHhcCC
Q psy2283          43 KEQFYKP-GAEH-RQVVGGAGVGHITDVLFRWEHEISVNILTWRLEALIHVSSVLVESLEEKQTVVSFKSELTRQLLIKD  120 (604)
Q Consensus        43 ~~~~~~~-~~~~-~q~~~~~~~~~i~~s~f~~~~~~~v~ihgW~~~~~i~~s~vl~hg~~~~~~~~~W~~~~~~all~~~  120 (604)
                      ++.+|++ ++.+ .|.+...+...|.+++||++.|+.|+||||.+..                ..++|+..|+++|+.++
T Consensus         8 ~F~L~Tr~n~~~~~~~l~~~~~~si~~s~Fn~~~ptvIlIHG~~~s~----------------~~~~w~~~l~~al~~~~   71 (442)
T TIGR03230         8 KFSLRTPEEPDDDTCYIVPGQPDSIADCNFNHETKTFIVIHGWTVTG----------------MFESWVPKLVAALYERE   71 (442)
T ss_pred             EEEEEecCCCCCCceEEecCChhhhhhcCcCCCCCeEEEECCCCcCC----------------cchhhHHHHHHHHHhcc
Confidence            4567777 5666 3577777888999999999999999999998621                13579999999988765


Q ss_pred             -CcEEEEEcCCCCCCchHHHHHHhHHHHHHHHHHHHHHHHHhhCCCccceEEEEeehHHHHHHHhhhhcchhcCCceeeE
Q psy2283         121 -DVNVIVNNWGAGSSPPYTQAVANIRLVGYMTAVLLNTLRREVGIRTEYVHLIGHSLGAHLSGYVGSTLRTVYNLKLGRI  199 (604)
Q Consensus       121 -d~NVI~VDW~~~a~~~Y~~a~~n~~~Vg~~la~~i~~L~~~~g~~~~~vhlIGhSLGAHiAG~aG~~l~~~~~~~v~rI  199 (604)
                       ++|||+|||.+++.+.|.+++.|++.||+.||+||+.|.+..+++++++|||||||||||||++|+++    +++|+||
T Consensus        72 ~d~nVI~VDw~g~g~s~y~~a~~~t~~vg~~la~lI~~L~~~~gl~l~~VhLIGHSLGAhIAg~ag~~~----p~rV~rI  147 (442)
T TIGR03230        72 PSANVIVVDWLSRAQQHYPTSAAYTKLVGKDVAKFVNWMQEEFNYPWDNVHLLGYSLGAHVAGIAGSLT----KHKVNRI  147 (442)
T ss_pred             CCCEEEEEECCCcCCCCCccccccHHHHHHHHHHHHHHHHHhhCCCCCcEEEEEECHHHHHHHHHHHhC----CcceeEE
Confidence             79999999999998889999999999999999999999888889999999999999999999999985    7899999


Q ss_pred             eccCCCCCCCCCCCccccCCCCCCCcEEEEEcCCCccccCCCCCCccccceeeecCCCCCCCCCCCccccccccccccee
Q psy2283         200 TGLDPADPYFSGTESIVRLDPTDATFVDIVHTDAAPFVKGGLGMGEPIGHLDFYPNGGENQPGCDQGMFAFIHLERGSVV  279 (604)
Q Consensus       200 tgLDPAgP~F~~~~~~~rLd~sDA~fVdvIHT~~~~~~~~glG~~~~~GH~DFYpNGG~~QPGC~~~~~~~~~~~~~~~~  279 (604)
                      ||||||+|+|+..++..||||+||+||||||||++.++.+++|+.+|+||+|||||||..||||.....  +....+..+
T Consensus       148 tgLDPAgP~F~~~~~~~rLd~~DA~fVdVIHTd~~~~~~~~lG~~~piGh~DFYPNGG~~QPGC~~~~~--~~~~~~~~~  225 (442)
T TIGR03230       148 TGLDPAGPTFEYADAPSTLSPDDADFVDVLHTNTRGSPDRSIGIQRPVGHIDIYPNGGTFQPGCDIQET--LLVIAEKGL  225 (442)
T ss_pred             EEEcCCCCcccccccccccCCCCCCeEEEEEecCCccccccccccccccceEeccCCCCCCCCCCcccc--ccccccccc
Confidence            999999999999999999999999999999999986555789999999999999999999999986321  111122336


Q ss_pred             ccccccCCCchhhhHHHHHhhccCC-CCceEeecCCHhhhhcCCCcCccCCCCCcccccCccccccchHHHHHhcccccc
Q psy2283         280 KGLRKYLGCDHIRSYEYFTESVNAR-CPFIAVECDTWDNFHAGNCFNCLRNNGLSCAKFGLNAVKHRNSQLQALGMSVYK  358 (604)
Q Consensus       280 ~g~~~~~~CsH~Rs~~yy~eSi~~~-~~F~a~~C~sy~~f~~g~C~~c~~~~~~~c~~mG~~a~~~~~~~ae~lgv~i~~  358 (604)
                      .++.++++|||.||++||+|||.++ |+|+|++|+||++|++|.|++|.   ..+|+.|||++++.+             
T Consensus       226 ~~~~~~~~CsH~Ra~~~f~eSi~~~~~~f~a~~C~s~~~f~~g~C~~c~---~~~c~~mG~~~~~~~-------------  289 (442)
T TIGR03230       226 GNMDQLVKCSHERSIHLFIDSLLNEENPSMAYRCSSKEAFNKGLCLSCR---KNRCNKLGYEINKVR-------------  289 (442)
T ss_pred             cccCcCccchhHHHHHHHHHHhcccCCCeeeEECCCHHHHhcCCCCCCC---CCCCceeCccccccc-------------
Confidence            7778889999999999999999764 89999999999999999999995   356999999999851             


Q ss_pred             CcccCCCceEEEecCCCCCccccccccccCCCccccccccceeeeEEEEEEccccCccccchhccccccCCCCCccccCc
Q psy2283         359 PVYESKPSKYFLITGDKQPFCLHFFQALTHGGLQDTFARGMELHAKVTIFAEGCHGHLTKSLSSRFNLRDNACPQTYGIG  438 (604)
Q Consensus       359 ~~~~~~~~~~Yl~Tgd~~Pf~~~~~~~~~~g~~~~~~~~g~~l~ak~ti~aeg~~g~l~~~~~~~~~l~~~~~~q~y~~G  438 (604)
                         ...+++|||.|++.+|||+                    +||+++|..       +.+-...               
T Consensus       290 ---~~~~g~~yl~T~~~~Pf~~--------------------~~y~v~v~~-------~~~~~~~---------------  324 (442)
T TIGR03230       290 ---TKRSSKMYLKTREMMPYKV--------------------FHYQVKVHF-------FGKTSLS---------------  324 (442)
T ss_pred             ---cCCceEEEEEeCCCCCceE--------------------EEEEEEEEE-------ecccccc---------------
Confidence               1236889999999999999                    999999966       2111000               


Q ss_pred             ceEeeeeCCCCCCCCCCCCCCCcccceeeecCCCCCCCcccccCCCCCCCCCceEEeecCCCCCCceeecCCCCCCcccC
Q psy2283         439 LKEVWEVKPELHKPGPLDNKCYGEYGCYSLKYPWTNDARQLSQFPQDPSVMKPIYCLYTRHNPTECQPLEHKNPETIYNS  518 (604)
Q Consensus       439 ~ke~w~i~~~~~~~gpl~~~~yg~lGCFs~~~p~~~~~rp~~~lP~sP~~i~~~F~LYTR~N~~~~q~L~~~d~~si~~S  518 (604)
                                            +--|-|.+.+..+                        +.+..                
T Consensus       325 ----------------------~~~~~~~~~l~g~------------------------~~~~~----------------  342 (442)
T TIGR03230       325 ----------------------HTDQPMKISLYGT------------------------HGEKE----------------  342 (442)
T ss_pred             ----------------------ccCCcEEEEEEcC------------------------CCCcc----------------
Confidence                                  0012333222211                        11111                


Q ss_pred             CCCCCCCEEEEEecccCCCcccccccccCCCceeeeec-ccccCCceEEEEEeecCCcccccceEEEE-EEEEEeEEEee
Q psy2283         519 FLIPSHRTFIISHGFLEDGERLWIKFYKPGAEHRQVVG-GAGVGHITDVLFRWEHEISVNILTWRLEA-LIHVSSVLVES  596 (604)
Q Consensus       519 ~Fn~srpT~~IIHGf~~~g~~~W~~~l~~~~~~~~~~~-~~~v~~~n~v~vdW~~~~~~~~~~w~~~~-~~~~~~~~~~~  596 (604)
                            ...|.            ...|+++.+|+.+++ ..++||+..|.+.|++ ..+|+++|-.+. ++++++|+|++
T Consensus       343 ------~~~~~------------~~~~~~~~t~~~~i~~~~~~g~~~~v~~~w~~-~~~~~~~~~~~~~~~~~~~i~v~~  403 (442)
T TIGR03230       343 ------NIPFT------------LPEVSTNKTYSFLITTDVDIGELLMVKLKWEK-DTYISWSDWWSSPGFHIRKLRIKS  403 (442)
T ss_pred             ------ceEEe------------eeeecCCCeEEEEEecccCCCceEEEEEEEeC-CCcccchhhhcCCceeEEEEEEEe
Confidence                  11110            235889999999998 8999999999999977 456777765556 99999999999


Q ss_pred             ccccccC
Q psy2283         597 LEEKQTF  603 (604)
Q Consensus       597 ~~~~~~~  603 (604)
                      .|..+.+
T Consensus       404 ge~~~~~  410 (442)
T TIGR03230       404 GETQSKV  410 (442)
T ss_pred             CCCccEE
Confidence            9998754

Members of this protein family are lipoprotein lipase (EC 3.1.1.34), a eukaryotic triacylglycerol lipase active in plasma and similar to pancreatic and hepatic triacylglycerol lipases (EC 3.1.1.3). It is also called clearing factor. It cleaves chylomicron and VLDL triacylglycerols; it also has phospholipase A-1 activity.
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>KOG4409|consensus Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PRK10162 acetyl esterase; Provisional Back     alignment and domain information
>PF07859 Abhydrolase_3: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>KOG4178|consensus Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>COG0429 Predicted hydrolase of the alpha/beta-hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>KOG2564|consensus Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>KOG1454|consensus Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>KOG2382|consensus Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>cd01759 PLAT_PL PLAT/LH2 domain of pancreatic triglyceride lipase Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>cd01758 PLAT_LPL PLAT/ LH2 domain present in lipoprotein lipase (LPL) Back     alignment and domain information
>COG0657 Aes Esterase/lipase [Lipid metabolism] Back     alignment and domain information
>PF01738 DLH: Dienelactone hydrolase family; InterPro: IPR002925 Dienelactone hydrolases play a crucial role in chlorocatechol degradation via the modified ortho cleavage pathway Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>cd01755 PLAT_lipase PLAT/ LH2 domain present in connection with a lipase domain Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>PF07224 Chlorophyllase: Chlorophyllase; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>PF12740 Chlorophyllase2: Chlorophyllase enzyme; InterPro: IPR010821 This family consists of several chlorophyllase proteins (3 Back     alignment and domain information
>KOG1455|consensus Back     alignment and domain information
>COG4782 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>TIGR00976 /NonD putative hydrolase, CocE/NonD family Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>KOG4627|consensus Back     alignment and domain information
>PF06057 VirJ: Bacterial virulence protein (VirJ); InterPro: IPR010333 This entry contains several bacterial VirJ virulence proteins Back     alignment and domain information
>PF10230 DUF2305: Uncharacterised conserved protein (DUF2305); InterPro: IPR019363 This entry contains proteins that have no known function Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>cd01759 PLAT_PL PLAT/LH2 domain of pancreatic triglyceride lipase Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PF05728 UPF0227: Uncharacterised protein family (UPF0227); InterPro: IPR008886 Despite being classed as uncharacterised proteins, the members of this family are almost certainly enzymes in that they contain a domain distantly related to IPR000073 from INTERPRO Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PF03403 PAF-AH_p_II: Platelet-activating factor acetylhydrolase, isoform II; PDB: 3F98_B 3F97_B 3D59_A 3F96_A 3D5E_B 3F9C_A Back     alignment and domain information
>KOG1515|consensus Back     alignment and domain information
>PF00756 Esterase: Putative esterase; InterPro: IPR000801 This family contains several seemingly unrelated proteins, including human esterase D; mycobacterial antigen 85, which is responsible for the high affinity of mycobacteria to fibronectin; Corynebacterium glutamicum major secreted protein PS1; and hypothetical proteins from Escherichia coli, yeast, mycobacteria and Haemophilus influenzae Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>cd01758 PLAT_LPL PLAT/ LH2 domain present in lipoprotein lipase (LPL) Back     alignment and domain information
>KOG1838|consensus Back     alignment and domain information
>cd01755 PLAT_lipase PLAT/ LH2 domain present in connection with a lipase domain Back     alignment and domain information
>KOG1552|consensus Back     alignment and domain information
>PF10503 Esterase_phd: Esterase PHB depolymerase Back     alignment and domain information
>PF05677 DUF818: Chlamydia CHLPS protein (DUF818); InterPro: IPR008536 This family of unknown function includes several Chlamydia CHLPS proteins and Legionella SidB proteins Back     alignment and domain information
>PF06342 DUF1057: Alpha/beta hydrolase of unknown function (DUF1057); InterPro: IPR010463 This entry consists of proteins of unknown function which have an alpha/beta hydrolase fold Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PF08538 DUF1749: Protein of unknown function (DUF1749); InterPro: IPR013744 This is a plant and fungal family of unknown function Back     alignment and domain information
>COG3319 Thioesterase domains of type I polyketide synthases or non-ribosomal peptide synthetases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG2112|consensus Back     alignment and domain information
>COG3208 GrsT Predicted thioesterase involved in non-ribosomal peptide biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>smart00824 PKS_TE Thioesterase Back     alignment and domain information
>COG0412 Dienelactone hydrolase and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>PF06500 DUF1100: Alpha/beta hydrolase of unknown function (DUF1100); InterPro: IPR010520 Proteins in this entry display esterase activity toward pNP-butyrate [] Back     alignment and domain information
>PRK10439 enterobactin/ferric enterobactin esterase; Provisional Back     alignment and domain information
>COG0627 Predicted esterase [General function prediction only] Back     alignment and domain information
>cd00312 Esterase_lipase Esterases and lipases (includes fungal lipases, cholinesterases, etc Back     alignment and domain information
>PLN02753 triacylglycerol lipase Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>KOG4391|consensus Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins Back     alignment and domain information
>PTZ00472 serine carboxypeptidase (CBP1); Provisional Back     alignment and domain information
>PLN02802 triacylglycerol lipase Back     alignment and domain information
>PF08840 BAAT_C: BAAT / Acyl-CoA thioester hydrolase C terminal; InterPro: IPR014940 Acyl-CoA thioesterases are a group of enzymes that catalyse the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH Back     alignment and domain information
>PF12146 Hydrolase_4: Putative lysophospholipase; InterPro: IPR022742 This domain is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>PLN02454 triacylglycerol lipase Back     alignment and domain information
>COG1506 DAP2 Dipeptidyl aminopeptidases/acylaminoacyl-peptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04940 hypothetical protein; Provisional Back     alignment and domain information
>PLN02847 triacylglycerol lipase Back     alignment and domain information
>PF09752 DUF2048: Uncharacterized conserved protein (DUF2048); InterPro: IPR019149 This family of proteins has no known function Back     alignment and domain information
>PF12715 Abhydrolase_7: Abhydrolase family; PDB: 3NUZ_C 3G8Y_A Back     alignment and domain information
>COG3509 LpqC Poly(3-hydroxybutyrate) depolymerase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02719 triacylglycerol lipase Back     alignment and domain information
>PLN02324 triacylglycerol lipase Back     alignment and domain information
>PLN02571 triacylglycerol lipase Back     alignment and domain information
>KOG3724|consensus Back     alignment and domain information
>COG4757 Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>PF05448 AXE1: Acetyl xylan esterase (AXE1); InterPro: IPR008391 This family consists of several bacterial acetyl xylan esterase proteins Back     alignment and domain information
>COG3946 VirJ Type IV secretory pathway, VirJ component [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4372|consensus Back     alignment and domain information
>PLN02761 lipase class 3 family protein Back     alignment and domain information
>PLN02633 palmitoyl protein thioesterase family protein Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children Back     alignment and domain information
>PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) Back     alignment and domain information
>PF03583 LIP: Secretory lipase ; InterPro: IPR005152 This entry represents a family of secreted lipases Back     alignment and domain information
>PF10340 DUF2424: Protein of unknown function (DUF2424); InterPro: IPR019436 Sterol homeostasis in eukaryotic cells relies on the reciprocal interconversion of free sterols and steryl esters Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query604
1w52_X452 Crystal Structure Of A Proteolyzed Form Of Pancreat 6e-52
1w52_X 452 Crystal Structure Of A Proteolyzed Form Of Pancreat 5e-07
1eth_A448 Triacylglycerol LipaseCOLIPASE COMPLEX Length = 448 1e-48
1eth_A 448 Triacylglycerol LipaseCOLIPASE COMPLEX Length = 448 4e-06
1bu8_A452 Rat Pancreatic Lipase Related Protein 2 Length = 45 2e-48
1bu8_A 452 Rat Pancreatic Lipase Related Protein 2 Length = 45 5e-09
1hpl_A449 Horse Pancreatic Lipase. The Crystal Structure At 2 5e-48
1hpl_A 449 Horse Pancreatic Lipase. The Crystal Structure At 2 5e-07
1rp1_A450 Dog Pancreatic Lipase Related Protein 1 Length = 45 2e-47
1rp1_A 450 Dog Pancreatic Lipase Related Protein 1 Length = 45 1e-08
1lpa_B449 Interfacial Activation Of The Lipase-Procolipase Co 3e-47
1lpa_B 449 Interfacial Activation Of The Lipase-Procolipase Co 9e-06
2ppl_A485 Human Pancreatic Lipase-Related Protein 1 Length = 5e-47
2ppl_A 485 Human Pancreatic Lipase-Related Protein 1 Length = 2e-08
2pvs_A452 Structure Of Human Pancreatic Lipase Related Protei 3e-45
2pvs_A 452 Structure Of Human Pancreatic Lipase Related Protei 5e-08
2oxe_A466 Structure Of The Human Pancreatic Lipase-Related Pr 4e-45
2oxe_A 466 Structure Of The Human Pancreatic Lipase-Related Pr 5e-08
1gpl_A432 Rp2 Lipase Length = 432 1e-43
1gpl_A 432 Rp2 Lipase Length = 432 7e-07
2gmh_A 584 Structure Of Porcine Electron Transfer Flavoprotein 1e-20
>pdb|1W52|X Chain X, Crystal Structure Of A Proteolyzed Form Of Pancreatic Lipase Related Protein 2 From Horse Length = 452 Back     alignment and structure 
Iteration: 1

 Score =  202 bits (513), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 100/241 (41%), Positives = 148/241 (61%), Gaps = 11/241 (4%)
Query: 107 SFKSELTRQLLIKDDVNVIVNNWGAGSSPPYTQAVANIRLVGYMTAVLLNTLRREVGIRT 166
           S+ S++ +++L  +  N I  +W +G+   YTQAV NIR+VG  TA L+  L  E+    
Sbjct: 86  SWPSDMCKKILQVETTNCISVDWSSGAKAEYTQAVQNIRIVGAETAYLIQQLLTELSYNP 145
Query: 167 EYVHLIGHSLGAHLSGYVGSTLRTVYNLKLGRITGLDPADPYFSGTESIVRLDPTDATFV 226
           E VH+IGHSLGAH +G  G  L      ++GR+TGLDPA+P F      VRLDP+DA FV
Sbjct: 146 ENVHIIGHSLGAHTAGEAGRRLEG----RVGRVTGLDPAEPCFQDASEEVRLDPSDAQFV 201
Query: 227 DIVHTDAAPFVKG-GLGMGEPIGHLDFYPNGGENQPGCDQGMFA-FIHLERGSVVKGLRK 284
           D++HTDA+P +   G GM + +GH+DF+PNGG+  PGC +  F+ FI +    + +G + 
Sbjct: 202 DVIHTDASPMLPSLGFGMSQKVGHMDFFPNGGKQMPGCKRSSFSTFIDIN--GIWQGAQD 259
Query: 285 YLGCDHIRSYEYFTESVNARCPFIAVECDTWDNFHAGNCFNCLRNNGLSCAKFGLNAVKH 344
           YL C+H++S+EY++ S+     F+A  CD++D F    CF C       C K G  A ++
Sbjct: 260 YLACNHLKSFEYYSSSILNPDGFLAYPCDSYDKFQENGCFPCPAGG---CPKMGHYADQY 316
Query: 345 R 345
           +
Sbjct: 317 K 317
>pdb|1W52|X Chain X, Crystal Structure Of A Proteolyzed Form Of Pancreatic Lipase Related Protein 2 From Horse Length = 452 Back     alignment and structure
>pdb|1ETH|A Chain A, Triacylglycerol LipaseCOLIPASE COMPLEX Length = 448 Back     alignment and structure
>pdb|1ETH|A Chain A, Triacylglycerol LipaseCOLIPASE COMPLEX Length = 448 Back     alignment and structure
>pdb|1BU8|A Chain A, Rat Pancreatic Lipase Related Protein 2 Length = 452 Back     alignment and structure
>pdb|1BU8|A Chain A, Rat Pancreatic Lipase Related Protein 2 Length = 452 Back     alignment and structure
>pdb|1HPL|A Chain A, Horse Pancreatic Lipase. The Crystal Structure At 2.3 Angstroms Resolution Length = 449 Back     alignment and structure
>pdb|1HPL|A Chain A, Horse Pancreatic Lipase. The Crystal Structure At 2.3 Angstroms Resolution Length = 449 Back     alignment and structure
>pdb|1RP1|A Chain A, Dog Pancreatic Lipase Related Protein 1 Length = 450 Back     alignment and structure
>pdb|1RP1|A Chain A, Dog Pancreatic Lipase Related Protein 1 Length = 450 Back     alignment and structure
>pdb|1LPA|B Chain B, Interfacial Activation Of The Lipase-Procolipase Complex By Mixed Micelles Revealed By X-Ray Crystallography Length = 449 Back     alignment and structure
>pdb|1LPA|B Chain B, Interfacial Activation Of The Lipase-Procolipase Complex By Mixed Micelles Revealed By X-Ray Crystallography Length = 449 Back     alignment and structure
>pdb|2PPL|A Chain A, Human Pancreatic Lipase-Related Protein 1 Length = 485 Back     alignment and structure
>pdb|2PPL|A Chain A, Human Pancreatic Lipase-Related Protein 1 Length = 485 Back     alignment and structure
>pdb|2PVS|A Chain A, Structure Of Human Pancreatic Lipase Related Protein 2 Mutant N336q Length = 452 Back     alignment and structure
>pdb|2PVS|A Chain A, Structure Of Human Pancreatic Lipase Related Protein 2 Mutant N336q Length = 452 Back     alignment and structure
>pdb|2OXE|A Chain A, Structure Of The Human Pancreatic Lipase-Related Protein 2 Length = 466 Back     alignment and structure
>pdb|2OXE|A Chain A, Structure Of The Human Pancreatic Lipase-Related Protein 2 Length = 466 Back     alignment and structure
>pdb|1GPL|A Chain A, Rp2 Lipase Length = 432 Back     alignment and structure
>pdb|1GPL|A Chain A, Rp2 Lipase Length = 432 Back     alignment and structure
>pdb|2GMH|A Chain A, Structure Of Porcine Electron Transfer Flavoprotein- Ubiquinone Oxidoreductase In Complexed With Ubiquinone Length = 584 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query604
1w52_X452 Pancreatic lipase related protein 2; detergent, cl 3e-87
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 4e-18
1w52_X452 Pancreatic lipase related protein 2; detergent, cl 2e-08
1hpl_A449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 4e-86
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 1e-17
1hpl_A449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 1e-06
1bu8_A452 Protein (pancreatic lipase related protein 2); hyd 2e-84
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 4e-19
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 2e-81
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 8e-20
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 3e-07
1rp1_A450 Pancreatic lipase related protein 1; hydrolase, li 2e-80
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 3e-19
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 3e-19
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
3atr_A 453 Conserved archaeal protein; saturating double bond 3e-04
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Length = 452 Back     alignment and structure
 Score =  277 bits (710), Expect = 3e-87
 Identities = 102/277 (36%), Positives = 152/277 (54%), Gaps = 22/277 (7%)

Query: 110 SELTRQLLIKDDVNVIVNNWGAGSSPPYTQAVANIRLVGYMTAVLLNTLRREVGIRTEYV 169
           S++ +++L  +  N I  +W +G+   YTQAV NIR+VG  TA L+  L  E+    E V
Sbjct: 89  SDMCKKILQVETTNCISVDWSSGAKAEYTQAVQNIRIVGAETAYLIQQLLTELSYNPENV 148

Query: 170 HLIGHSLGAHLSGYVGSTLRTVYNLKLGRITGLDPADPYFSGTESIVRLDPTDATFVDIV 229
           H+IGHSLGAH +G  G  L      ++GR+TGLDPA+P F      VRLDP+DA FVD++
Sbjct: 149 HIIGHSLGAHTAGEAGRRL----EGRVGRVTGLDPAEPCFQDASEEVRLDPSDAQFVDVI 204

Query: 230 HTDAAPFVKG-GLGMGEPIGHLDFYPNGGENQPGCDQGMFAFIHLERGSVVKGLRKYLGC 288
           HTDA+P +   G GM + +GH+DF+PNGG+  PGC +  F+      G   +G + YL C
Sbjct: 205 HTDASPMLPSLGFGMSQKVGHMDFFPNGGKQMPGCKRSSFSTFIDINGI-WQGAQDYLAC 263

Query: 289 DHIRSYEYFTESVNARCPFIAVECDTWDNFHAGNCFNCLRNNGLSCAKFGLNAVKHRNSQ 348
           +H++S+EY++ S+     F+A  CD++D F    CF C       C K G  A +++   
Sbjct: 264 NHLKSFEYYSSSILNPDGFLAYPCDSYDKFQENGCFPCPAG---GCPKMGHYADQYKEKT 320

Query: 349 LQALGMSVYKPVYESKPSKYFLITGDKQPFCLHFFQA 385
                              +FL TG+   +    ++ 
Sbjct: 321 SAVEQ-------------TFFLNTGESGDYTSWRYRV 344
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Length = 452 Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Length = 452 Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Length = 449 Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Length = 449 Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Length = 449 Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Length = 452 Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Length = 452 Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Length = 432 Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Length = 432 Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Length = 432 Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Length = 450 Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Length = 450 Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Length = 584 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query604
1rp1_A450 Pancreatic lipase related protein 1; hydrolase, li 100.0
1hpl_A449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 100.0
1bu8_A452 Protein (pancreatic lipase related protein 2); hyd 100.0
1w52_X452 Pancreatic lipase related protein 2; detergent, cl 100.0
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 100.0
1rp1_A 450 Pancreatic lipase related protein 1; hydrolase, li 99.79
1hpl_A 449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 99.76
1w52_X 452 Pancreatic lipase related protein 2; detergent, cl 99.72
1bu8_A 452 Protein (pancreatic lipase related protein 2); hyd 99.7
1gpl_A 432 RP2 lipase; serine esterase, hydrolase, lipid degr 99.63
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 98.91
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 98.89
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 98.87
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 98.86
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 98.86
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 98.84
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 98.83
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 98.83
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 98.83
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 98.82
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 98.82
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 98.81
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 98.81
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 98.79
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 98.79
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 98.79
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 98.79
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 98.78
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 98.78
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 98.78
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 98.78
1iup_A282 META-cleavage product hydrolase; aromatic compound 98.78
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 98.77
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 98.77
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 98.76
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 98.76
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 98.76
3llc_A270 Putative hydrolase; structural genomics, joint cen 98.76
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 98.76
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 98.75
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 98.75
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 98.73
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 98.73
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 98.71
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 98.69
1r3d_A264 Conserved hypothetical protein VC1974; structural 98.68
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 98.68
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 98.68
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 98.68
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 98.67
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 98.67
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 98.67
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 98.67
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 98.67
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 98.66
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 98.66
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 98.66
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 98.65
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 98.65
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 98.65
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 98.65
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 98.64
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 98.63
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 98.63
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 98.63
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 98.62
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 98.61
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 98.61
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 98.61
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 98.61
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 98.6
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 98.6
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 98.59
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 98.58
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 98.57
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 98.55
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 98.55
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 98.54
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 98.54
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 98.54
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 98.54
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 98.54
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 98.54
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 98.54
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 98.54
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 98.53
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 98.52
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 98.52
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 98.51
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 98.51
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 98.5
3h04_A275 Uncharacterized protein; protein with unknown func 98.47
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 98.46
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 98.43
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 98.43
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 98.42
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 98.42
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 98.41
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 97.78
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 98.4
1vkh_A273 Putative serine hydrolase; structural genomics, jo 98.4
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 98.4
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 98.39
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 98.39
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 98.38
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 98.38
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 98.38
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 98.38
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 98.37
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 98.37
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 98.37
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 98.36
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 98.36
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 98.36
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 98.35
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 98.35
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 98.35
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 98.34
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 98.34
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 98.33
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 98.33
4fle_A202 Esterase; structural genomics, PSI-biology, northe 98.32
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 98.32
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 98.31
2gmh_A 584 Electron transfer flavoprotein-ubiquinone oxidored 98.31
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 98.31
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 98.31
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 98.29
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 98.29
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 98.29
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 98.28
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 98.28
3vdx_A456 Designed 16NM tetrahedral protein CAGE containing 98.27
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 98.26
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 98.26
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 98.26
3bjr_A283 Putative carboxylesterase; structural genomics, jo 98.26
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 98.26
3lp5_A250 Putative cell surface hydrolase; structural genom 98.25
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 98.24
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 98.24
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 98.22
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 98.22
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 98.22
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 98.21
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 98.2
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 98.19
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 98.19
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 98.19
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 98.18
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 98.17
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 98.17
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 98.17
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 98.14
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 98.13
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 98.11
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 98.11
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 98.1
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 98.1
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 98.07
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 98.07
3ain_A323 303AA long hypothetical esterase; carboxylesterase 98.04
3d59_A383 Platelet-activating factor acetylhydrolase; secret 98.03
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 98.01
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 97.99
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 97.97
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 97.96
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 97.96
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 97.95
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 97.95
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 97.95
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 97.94
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 97.93
3tej_A329 Enterobactin synthase component F; nonribosomal pe 97.93
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 97.93
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 97.9
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 97.89
2zyr_A484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 97.89
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 97.89
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 97.88
1kez_A300 Erythronolide synthase; polyketide synthase, modul 97.86
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 97.86
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 97.86
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 97.83
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 97.83
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 97.78
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 97.78
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 97.77
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 97.76
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 97.76
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 97.74
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 97.72
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 97.72
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 97.71
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 97.7
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 97.7
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 97.67
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 97.66
2dsn_A387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 97.64
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 97.63
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 97.63
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 97.62
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 97.6
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 97.59
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 97.55
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 97.53
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 97.47
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 97.45
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 97.44
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 97.42
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 97.34
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 97.3
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 97.29
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 97.28
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 97.26
3n2z_B446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 97.17
3nuz_A398 Putative acetyl xylan esterase; structural genomic 97.03
4hvt_A711 Ritya.17583.B, post-proline cleaving enzyme; ssgci 97.03
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.0
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 96.87
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 96.6
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 96.48
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 96.38
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 96.37
4f21_A246 Carboxylesterase/phospholipase family protein; str 96.14
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 96.01
4ao6_A259 Esterase; hydrolase, thermo label; 1.60A {Unidenti 95.84
1mpx_A615 Alpha-amino acid ester hydrolase; alpha/beta hydro 95.7
3i2k_A587 Cocaine esterase; alpha/beta hydrolase, hydrolase; 95.52
1qe3_A489 PNB esterase, para-nitrobenzyl esterase; alpha-bet 95.44
2ogt_A498 Thermostable carboxylesterase EST50; alpha/beta hy 95.18
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 94.85
3iii_A560 COCE/NOND family hydrolase; structural genomics, c 94.67
1p0i_A529 Cholinesterase; serine hydrolase, butyrate, hydrol 94.35
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 94.32
2ha2_A543 ACHE, acetylcholinesterase; hydrolase fold, serine 94.1
3guu_A462 Lipase A; protein structure, hydrolase; HET: 1PE; 93.8
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 93.71
2fj0_A551 JuvenIle hormone esterase; manduca sexta, alpha-be 93.69
1ea5_A537 ACHE, acetylcholinesterase; hydrolase, serine hydr 93.6
2b9v_A652 Alpha-amino acid ester hydrolase; catalytic triad, 93.47
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 93.47
1lns_A763 X-prolyl dipeptidyl aminopetidase; alpha beta hydr 93.34
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 93.16
2h7c_A542 Liver carboxylesterase 1; enzyme, cholesteryl este 92.92
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 92.74
4fol_A299 FGH, S-formylglutathione hydrolase; D-type esteras 92.71
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 92.44
1thg_A544 Lipase; hydrolase(carboxylic esterase); HET: NAG N 92.2
1llf_A534 Lipase 3; candida cylindracea cholesterol esterase 92.0
1dx4_A585 ACHE, acetylcholinesterase; hydrolase, serine este 91.73
1ukc_A522 ESTA, esterase; fungi, A/B hydrolase fold, acetylc 91.64
1g66_A207 Acetyl xylan esterase II; serine hydrolase, acetyl 91.21
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 91.0
1qoz_A207 AXE, acetyl xylan esterase; hydrolase, xylan degra 90.41
3bix_A574 Neuroligin-1, neuroligin I; esterase domain, alpha 89.9
1whs_A255 Serine carboxypeptidase II; HET: NAG FUC; 2.00A {T 89.67
1ivy_A452 Human protective protein; carboxypeptidase, serine 89.16
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 87.92
3aja_A302 Putative uncharacterized protein; alpha-beta hydro 84.46
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 83.97
2bce_A579 Cholesterol esterase; hydrolase, serine esterase, 83.77
2czq_A205 Cutinase-like protein; alpha/beta hydrolase fold, 82.25
3p2m_A 330 Possible hydrolase; alpha/beta hydrolase superfami 80.97
3pic_A375 CIP2; alpha/beta hydrolase fold, glucuronoyl ester 80.2
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
Probab=100.00  E-value=4.6e-68  Score=580.14  Aligned_cols=391  Identities=34%  Similarity=0.580  Sum_probs=320.2

Q ss_pred             hhhhcCC-CCccceeeecCccccccccccccCCcceeeEEecccccccceeeeeeeccccCCCccchHHHHHHHHhcCCC
Q psy2283          43 KEQFYKP-GAEHRQVVGGAGVGHITDVLFRWEHEISVNILTWRLEALIHVSSVLVESLEEKQTVVSFKSELTRQLLIKDD  121 (604)
Q Consensus        43 ~~~~~~~-~~~~~q~~~~~~~~~i~~s~f~~~~~~~v~ihgW~~~~~i~~s~vl~hg~~~~~~~~~W~~~~~~all~~~d  121 (604)
                      ++.+|+. +++..|.+...+...|..+.|+++.|+.|.||||.+.                 +...|...|+++|+.+++
T Consensus        38 ~f~l~t~~n~~~~~~l~~~~~~~~~~s~f~~~~p~vvliHG~~~s-----------------~~~~w~~~l~~~ll~~~~  100 (450)
T 1rp1_A           38 RFLLYTNKNPNNFQTLLPSDPSTIGASNFQTDKKTRFIIHGFIDK-----------------GEENWLLDMCKNMFKVEE  100 (450)
T ss_dssp             EEEEECSSSSSSCEEECTTCTHHHHTSCCCTTSEEEEEECCCCCT-----------------TCTTHHHHHHHHHTTTCC
T ss_pred             EEEEECCCCCCCceEeccCChhhhhccCcCCCCCeEEEEccCCCC-----------------CCcchHHHHHHHHHhcCC
Confidence            5567887 6888899987777889999999999999999999863                 234799889999998889


Q ss_pred             cEEEEEcCCCCCCchHHHHHHhHHHHHHHHHHHHHHHHHhhCCCccceEEEEeehHHHHHHHhhhhcchhcCCceeeEec
Q psy2283         122 VNVIVNNWGAGSSPPYTQAVANIRLVGYMTAVLLNTLRREVGIRTEYVHLIGHSLGAHLSGYVGSTLRTVYNLKLGRITG  201 (604)
Q Consensus       122 ~NVI~VDW~~~a~~~Y~~a~~n~~~Vg~~la~~i~~L~~~~g~~~~~vhlIGhSLGAHiAG~aG~~l~~~~~~~v~rItg  201 (604)
                      +|||+|||++++.+.|.+++.+++.+|+.|+.+|+.|.++.|++.+++||||||||||||+++|+++    ++ |+||++
T Consensus       101 ~~VI~vD~~g~g~s~y~~~~~~~~~~a~~l~~ll~~L~~~~g~~~~~v~LVGhSlGg~vA~~~a~~~----p~-v~~iv~  175 (450)
T 1rp1_A          101 VNCICVDWKKGSQTSYTQAANNVRVVGAQVAQMLSMLSANYSYSPSQVQLIGHSLGAHVAGEAGSRT----PG-LGRITG  175 (450)
T ss_dssp             EEEEEEECHHHHSSCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCGGGEEEEEETHHHHHHHHHHHTS----TT-CCEEEE
T ss_pred             eEEEEEeCccccCCcchHHHHHHHHHHHHHHHHHHHHHHhcCCChhhEEEEEECHhHHHHHHHHHhc----CC-cccccc
Confidence            9999999999887789999999999999999999999877888999999999999999999999996    55 999999


Q ss_pred             cCCCCCCCCCCCccccCCCCCCCcEEEEEcCCCcccc-CCCCCCccccceeeecCCCCCCCCCCCcccccccccccceec
Q psy2283         202 LDPADPYFSGTESIVRLDPTDATFVDIVHTDAAPFVK-GGLGMGEPIGHLDFYPNGGENQPGCDQGMFAFIHLERGSVVK  280 (604)
Q Consensus       202 LDPAgP~F~~~~~~~rLd~sDA~fVdvIHT~~~~~~~-~glG~~~~~GH~DFYpNGG~~QPGC~~~~~~~~~~~~~~~~~  280 (604)
                      ||||+|+|...++..||+++||+|||+||||++.+++ +|+|+.+|+||+|||||||..||||..+....+ .+.+++|+
T Consensus       176 Ldpa~p~f~~~~~~~rl~~~DA~~Vd~Iht~~~~~~~~~~~G~~~~~Gh~dfypNgG~~QPgC~~~~~~~~-~d~~~~~~  254 (450)
T 1rp1_A          176 LDPVEASFQGTPEEVRLDPTDADFVDVIHTDAAPLIPFLGFGTSQQMGHLDFFPNGGEEMPGCKKNALSQI-VDLDGIWE  254 (450)
T ss_dssp             ESCCCTTTTTSCTTTSCCGGGSSEEEEECSCCSCHHHHCCCSCCSCCSSEEEEETTTTCCTTCCCCCCCSC-CCHHHHHT
T ss_pred             cCcccccccCCCchhccChhhcchhheeeccccccccccccCcCCcccceEeccCCCCCCCCCCccccccc-cccccccc
Confidence            9999999998888999999999999999999986655 589999999999999999999999987544333 23446788


Q ss_pred             cccccCCCchhhhHHHHHhhccCCCCceEeecCCHhhhhcCCCcCccCCCCCcccccCccccccchHHHHHhccccccCc
Q psy2283         281 GLRKYLGCDHIRSYEYFTESVNARCPFIAVECDTWDNFHAGNCFNCLRNNGLSCAKFGLNAVKHRNSQLQALGMSVYKPV  360 (604)
Q Consensus       281 g~~~~~~CsH~Rs~~yy~eSi~~~~~F~a~~C~sy~~f~~g~C~~c~~~~~~~c~~mG~~a~~~~~~~ae~lgv~i~~~~  360 (604)
                      ++.++++|||.||++||+|||.++++|+|++|.||++|+++.|.+|.   ...|+.|||++++...+.            
T Consensus       255 ~~~~~~~CsH~ra~~~f~eSi~~~~~f~a~~C~s~~~~~~~~C~~~~---~~~~~~mG~~~~~~~~~~------------  319 (450)
T 1rp1_A          255 GTRDFVACNHLRSYKYYSESILNPDGFASYPCASYRAFESNKCFPCP---DQGCPQMGHYADKFAVKT------------  319 (450)
T ss_dssp             TCSCCCCHHHHHHHHHHHHHHHCTTTTBCEECSCHHHHHTTCSCSCC---TTCCCBSSGGGGGCC---------------
T ss_pred             ccccccccCchhHHHHHHHHhccCCCceeeeCCCHHHHhCCCccCCC---CCcccccCccCccccccc------------
Confidence            88899999999999999999999999999999999999999999994   245999999998752100            


Q ss_pred             ccCCCceEEEecCCCCCccccccccccCCCccccccccceeeeEEEEEEccccCccccchhccccccCCCCCccccCcce
Q psy2283         361 YESKPSKYFLITGDKQPFCLHFFQALTHGGLQDTFARGMELHAKVTIFAEGCHGHLTKSLSSRFNLRDNACPQTYGIGLK  440 (604)
Q Consensus       361 ~~~~~~~~Yl~Tgd~~Pf~~~~~~~~~~g~~~~~~~~g~~l~ak~ti~aeg~~g~l~~~~~~~~~l~~~~~~q~y~~G~k  440 (604)
                       ....++|||.|++.+|||+                    .+++++|..-+ .        ..                 
T Consensus       320 -~~~~g~~yl~T~~~~Pf~~--------------------~~Y~VtV~~~~-~--------~t-----------------  352 (450)
T 1rp1_A          320 -SDETQKYFLNTGDSSNFAR--------------------WRYGVSITLSG-K--------RA-----------------  352 (450)
T ss_dssp             -----CEEEECCCSSSCCCC--------------------EEEEEEEEEEE-S--------CE-----------------
T ss_pred             -cccceeEEecccccCCccc--------------------ceeEEEEEEcC-C--------ce-----------------
Confidence             0126789999999999999                    99999997722 0        00                 


Q ss_pred             EeeeeCCCCCCCCCCCCCCCcccceeeecCCCCCCCcccccCCCCCCCCCceEEeecCCCCCCceeecCCCCCCcccCCC
Q psy2283         441 EVWEVKPELHKPGPLDNKCYGEYGCYSLKYPWTNDARQLSQFPQDPSVMKPIYCLYTRHNPTECQPLEHKNPETIYNSFL  520 (604)
Q Consensus       441 e~w~i~~~~~~~gpl~~~~yg~lGCFs~~~p~~~~~rp~~~lP~sP~~i~~~F~LYTR~N~~~~q~L~~~d~~si~~S~F  520 (604)
                                            -|-++..+..+.+                        +. .                 
T Consensus       353 ----------------------~g~i~v~L~G~~g------------------------~s-~-----------------  368 (450)
T 1rp1_A          353 ----------------------TGQAKVALFGSKG------------------------NT-H-----------------  368 (450)
T ss_dssp             ----------------------EEEEEEEEEETTE------------------------EC-C-----------------
T ss_pred             ----------------------eEEEEEEEEcCCC------------------------Cc-c-----------------
Confidence                                  1333322222110                        11 0                 


Q ss_pred             CCCCCEEEEEecccCCCcccccccccCCCceeeeec-ccccCCceEEEEEeecCCcccccceEEEEEEEEEeEEEeeccc
Q psy2283         521 IPSHRTFIISHGFLEDGERLWIKFYKPGAEHRQVVG-GAGVGHITDVLFRWEHEISVNILTWRLEALIHVSSVLVESLEE  599 (604)
Q Consensus       521 n~srpT~~IIHGf~~~g~~~W~~~l~~~~~~~~~~~-~~~v~~~n~v~vdW~~~~~~~~~~w~~~~~~~~~~~~~~~~~~  599 (604)
                          +.. |.++           .+++|.+|+.+++ ..++|+++.|.+.|+.. ..||+    ..++||++|+|+++|.
T Consensus       369 ----~~~-l~~~-----------~~~~g~t~s~li~~~~dlG~l~~v~~~W~~~-~~~~~----~p~~~i~~I~V~~~e~  427 (450)
T 1rp1_A          369 ----QFN-IFKG-----------ILKPGSTHSNEFDAKLDVGTIEKVKFLWNNN-VVNPT----FPKVGAAKITVQKGEE  427 (450)
T ss_dssp             ----CEE-EEEE-----------EECTTCEEEEEEEESSCCSSEEEEEEEEEEC---CTT----CCCEEEEEEEEEETTC
T ss_pred             ----eEE-eccc-----------ccCCCCEEEEEEECCCCCCCceEEEEEEECC-CCCCC----CCeEEEEEEEEEeCCC
Confidence                111 1121           4788999999998 79999999999999974 44544    4588899999999999


Q ss_pred             cccC
Q psy2283         600 KQTF  603 (604)
Q Consensus       600 ~~~~  603 (604)
                      .+++
T Consensus       428 ~~~~  431 (450)
T 1rp1_A          428 KTVH  431 (450)
T ss_dssp             SSCE
T ss_pred             CCeE
Confidence            8754
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>3nuz_A Putative acetyl xylan esterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; 2.30A {Bacteroides fragilis} Back     alignment and structure
>4hvt_A Ritya.17583.B, post-proline cleaving enzyme; ssgcid, structural genomics, S structural genomics center for infectious disease; 1.70A {Rickettsia typhi} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>4ao6_A Esterase; hydrolase, thermo label; 1.60A {Unidentified} PDB: 4ao7_A 4ao8_A Back     alignment and structure
>1mpx_A Alpha-amino acid ester hydrolase; alpha/beta hydrolase, jellyroll, selenomethionine; 1.90A {Xanthomonas citri} SCOP: b.18.1.13 c.69.1.21 Back     alignment and structure
>3i2k_A Cocaine esterase; alpha/beta hydrolase, hydrolase; HET: DBC GOL; 1.51A {Rhodococcus SP} PDB: 3i2j_A* 3puh_A 3i2h_A* 3i2i_A* 3i2g_A* 3ida_A* 3i2f_A* 3pui_A 1ju3_A 1ju4_A 1l7q_A 1l7r_A Back     alignment and structure
>1qe3_A PNB esterase, para-nitrobenzyl esterase; alpha-beta hydrolase directed evolution; 1.50A {Bacillus subtilis} SCOP: c.69.1.1 PDB: 1c7j_A 1c7i_A Back     alignment and structure
>2ogt_A Thermostable carboxylesterase EST50; alpha/beta hydrolase, hydrolase; 1.58A {Geobacillus stearothermophilus} PDB: 2ogs_A Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>3iii_A COCE/NOND family hydrolase; structural genomics, center for structural genomi infectious diseases, csgid; HET: MSE PLM; 1.95A {Staphylococcus aureus subsp} PDB: 3ib3_A* Back     alignment and structure
>1p0i_A Cholinesterase; serine hydrolase, butyrate, hydrolase; HET: NAG FUC MES; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 1p0m_A* 1p0p_A* 1p0q_A* 1xlu_A* 1xlv_A* 1xlw_A* 2wsl_A* 2pm8_A* 3djy_A* 3dkk_A* 2wij_A* 2wif_A* 2wik_A* 2y1k_A* 2j4c_A* 2xmb_A* 2xmc_A* 2xmd_A* 2xmg_A* 2wig_A* ... Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>2ha2_A ACHE, acetylcholinesterase; hydrolase fold, serine esterase, homod glycosylated protein, hydrolase; HET: NAG FUC SCK SCU P6G; 2.05A {Mus musculus} SCOP: c.69.1.1 PDB: 1j07_A* 1mah_A* 1j06_A* 1n5r_A* 2gyv_A* 2gyw_A* 2h9y_A* 2ha0_A* 2gyu_A* 2ha3_A* 2wls_A* 4a23_A* 2c0q_A* 2jey_A* 2jgm_A* 2whr_A* 2c0p_A* 1ku6_A* 1q84_A* 1q83_A* ... Back     alignment and structure
>3guu_A Lipase A; protein structure, hydrolase; HET: 1PE; 2.10A {Candida antarctica} PDB: 2veo_A* Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>2fj0_A JuvenIle hormone esterase; manduca sexta, alpha-beta hydrolase; HET: TFC; 2.70A {Trichoplusia NI} Back     alignment and structure
>1ea5_A ACHE, acetylcholinesterase; hydrolase, serine hydrolase, neurotransmitter cleavage, catalytic triad, alpha/beta hydrolase; HET: NAG; 1.80A {Torpedo californica} SCOP: c.69.1.1 PDB: 1ax9_A* 1amn_A* 1cfj_A* 1fss_A* 1gpk_A* 1gpn_A* 1oce_A* 1qid_A 1qie_A 1qif_A 1qig_A 1qih_A 1qii_A 1qij_A 1qik_A 1qim_A 1qti_A* 1vot_A* 1vxo_A* 1vxr_A* ... Back     alignment and structure
>2b9v_A Alpha-amino acid ester hydrolase; catalytic triad, alpha/beta-hydrolase; 2.00A {Acetobacter pasteurianus} SCOP: b.18.1.13 c.69.1.21 PDB: 2b4k_A 1nx9_A* 1ryy_A Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>1lns_A X-prolyl dipeptidyl aminopetidase; alpha beta hydrolase fold; 2.20A {Lactococcus lactis} SCOP: a.40.2.1 b.18.1.13 c.69.1.21 Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>2h7c_A Liver carboxylesterase 1; enzyme, cholesteryl esterase, hydrolase; HET: NAG NDG SIA COA; 2.00A {Homo sapiens} SCOP: c.69.1.1 PDB: 2dqy_A* 2dr0_A* 2dqz_A* 1mx1_A* 1mx5_A* 1mx9_A* 4ab1_A* 1ya4_A* 1yah_A* 1yaj_A* 1ya8_A* 2hrr_A* 2hrq_A* 3k9b_A* 1k4y_A* Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>4fol_A FGH, S-formylglutathione hydrolase; D-type esterase, oxidation sensor motif, esterase activity activation, esterase activity inhibition; 2.07A {Saccharomyces cerevisiae} PDB: 1pv1_A 3c6b_A* 4flm_A* Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>1thg_A Lipase; hydrolase(carboxylic esterase); HET: NAG NDG; 1.80A {Galactomyces geotrichum} SCOP: c.69.1.17 Back     alignment and structure
>1llf_A Lipase 3; candida cylindracea cholesterol esterase, sterol ester acylh hydrolase; HET: NAG F23; 1.40A {Candida cylindracea} SCOP: c.69.1.17 PDB: 1cle_A* 1lpm_A* 1lpn_A* 1lpo_A* 1lpp_A* 1lps_A* 1crl_A* 1trh_A* 3rar_A* 1gz7_A* Back     alignment and structure
>1dx4_A ACHE, acetylcholinesterase; hydrolase, serine esterase, synapse, membrane, nerve, muscle neurotransmitter degradation, glycoprotein; HET: NAG MAN BMA 760; 2.70A {Drosophila melanogaster} SCOP: c.69.1.1 PDB: 1qo9_A* 1qon_A* Back     alignment and structure
>1ukc_A ESTA, esterase; fungi, A/B hydrolase fold, acetylcholinesterase, H; HET: NAG MAN; 2.10A {Aspergillus niger} SCOP: c.69.1.17 Back     alignment and structure
>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 Back     alignment and structure
>3bix_A Neuroligin-1, neuroligin I; esterase domain, alpha-beta hydrolase, cell adhesion, cell J glycoprotein, membrane, postsynaptic cell membrane; HET: NAG; 1.80A {Rattus norvegicus} PDB: 3biw_A* 3b3q_A* 3be8_A* 2wqz_A* 2xb6_A* 2vh8_A 3bl8_A* Back     alignment and structure
>1whs_A Serine carboxypeptidase II; HET: NAG FUC; 2.00A {Triticum aestivum} SCOP: c.69.1.5 PDB: 1bcs_A* 1bcr_A* 1wht_A* 3sc2_A* Back     alignment and structure
>1ivy_A Human protective protein; carboxypeptidase, serine carboxypeptidase, protective protei glycoprotein, zymogen; HET: NAG NDG; 2.20A {Homo sapiens} SCOP: c.69.1.5 Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>3aja_A Putative uncharacterized protein; alpha-beta hydrolase, serine esterase, cutinase, lipase, HYD; 2.90A {Mycobacterium smegmatis} Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>2bce_A Cholesterol esterase; hydrolase, serine esterase, lipase; 1.60A {Bos taurus} SCOP: c.69.1.1 PDB: 1akn_A* 1aql_A* 1f6w_A 1jmy_A Back     alignment and structure
>2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3pic_A CIP2; alpha/beta hydrolase fold, glucuronoyl esterase, carbohydrat esterase family 15 (CE-15), N-linked glycosylation, secrete hydrolase; HET: NAG; 1.90A {Hypocrea jecorina} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 604
d1bu8a2338 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal 5e-73
d1bu8a2 338 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal 8e-19
d1rp1a2337 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal 3e-71
d1rp1a2 337 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal 1e-18
d1gpla1112 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal 4e-07
d2gmha299 d.16.1.8 (A:237-335) Electron transfer flavoprotei 3e-06
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 4e-06
d1rp1a1113 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal 8e-06
d1bu8a1114 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal 2e-04
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 338 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Pancreatic lipase, N-terminal domain
domain: Pancreatic lipase, N-terminal domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score =  235 bits (601), Expect = 5e-73
 Identities = 101/269 (37%), Positives = 143/269 (53%), Gaps = 22/269 (8%)

Query: 111 ELTRQLLIKDDVNVIVNNWGAGSSPPYTQAVANIRLVGYMTAVLLNTLRREVGIRTEYVH 170
           ++ +++   + VN I  +W  GS   YTQA  N R+VG   A L+  L  E+G   E VH
Sbjct: 90  DMCKKMFQVEKVNCICVDWRRGSRTEYTQASYNTRVVGAEIAFLVQVLSTEMGYSPENVH 149

Query: 171 LIGHSLGAHLSGYVGSTLRTVYNLKLGRITGLDPADPYFSGTESIVRLDPTDATFVDIVH 230
           LIGHSLGAH+ G  G  L       +GRITGLDPA+P F G    VRLDP+DA FVD++H
Sbjct: 150 LIGHSLGAHVVGEAGRRL----EGHVGRITGLDPAEPCFQGLPEEVRLDPSDAMFVDVIH 205

Query: 231 TDAAPFVKG-GLGMGEPIGHLDFYPNGGENQPGCDQGMFAFIHLERGSVVKGLRKYLGCD 289
           TD+AP +   G GM + +GHLDF+PNGG+  PGC + + + I    G + +G + ++ C+
Sbjct: 206 TDSAPIIPYLGFGMSQKVGHLDFFPNGGKEMPGCQKNILSTIVDING-IWEGTQNFVACN 264

Query: 290 HIRSYEYFTESVNARCPFIAVECDTWDNFHAGNCFNCLRNNGLSCAKFGLNAVKHRNSQL 349
           H+RSY+Y+  S+     F+   C +++ F   +CF C       C K G  A +      
Sbjct: 265 HLRSYKYYASSILNPDGFLGYPCSSYEKFQQNDCFPCPEE---GCPKMGHYADQFEGKTA 321

Query: 350 QALGMSVYKPVYESKPSKYFLITGDKQPF 378
                              +L TGD   F
Sbjct: 322 TVEQ-------------TVYLNTGDSGNF 337
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 338 Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Length = 337 Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Length = 337 Back     information, alignment and structure
>d1gpla1 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal domain {Guinea pig (Cavia porcellus) [TaxId: 10141]} Length = 112 Back     information, alignment and structure
>d2gmha2 d.16.1.8 (A:237-335) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 99 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d1rp1a1 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Length = 113 Back     information, alignment and structure
>d1bu8a1 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 114 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query604
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 100.0
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 100.0
d1rp1a2 337 Pancreatic lipase, N-terminal domain {Dog (Canis f 99.93
d1bu8a2 338 Pancreatic lipase, N-terminal domain {Rat (Rattus 99.92
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.95
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 98.93
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 98.89
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 98.87
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 98.82
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 98.81
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 98.81
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 98.8
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 98.79
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 98.79
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 98.78
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 98.77
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 98.76
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 98.75
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 98.74
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 98.73
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 98.62
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 98.6
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 98.59
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 98.59
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 98.57
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 98.53
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 98.52
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 98.51
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 98.43
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 98.4
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 98.4
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 98.38
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 98.36
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 98.26
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 98.2
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 98.07
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 98.0
d2dsta1122 Hypothetical protein TTHA1544 {Thermus thermophilu 97.93
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 97.93
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 97.92
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 97.88
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 97.85
d1qo7a_394 Bacterial epoxide hydrolase {Aspergillus niger [Ta 97.83
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 97.83
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 97.78
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 97.78
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 97.77
d1vkha_263 Putative serine hydrolase Ydr428c {Baker's yeast ( 97.74
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 97.69
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 97.64
d2gmha299 Electron transfer flavoprotein-ubiquinone oxidored 97.54
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 97.53
d1jfra_260 Lipase {Streptomyces exfoliatus [TaxId: 1905]} 97.51
d1r88a_267 Antigen pt51/mpb51 {Mycobacterium tuberculosis [Ta 97.47
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 97.46
d2pbla1261 Uncharacterized protein TM1040_2492 {Silicibacter 97.45
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 97.44
d1jjia_311 Carboxylesterase {Archaeon Archaeoglobus fulgidus 97.39
d1lzla_317 Heroin esterase {Rhodococcus sp. [TaxId: 1831]} 97.33
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 97.28
d2bgra2258 Dipeptidyl peptidase IV/CD26, C-terminal domain {P 97.09
d1u4na_308 Carboxylesterase {Alicyclobacillus acidocaldarius 97.07
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 97.01
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 97.0
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 96.98
d2hu7a2260 Acylamino-acid-releasing enzyme, C-terminal donain 96.83
d1l7aa_318 Cephalosporin C deacetylase {Bacillus subtilis [Ta 96.64
d1ku0a_388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 96.61
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 96.07
d1dina_233 Dienelactone hydrolase {Pseudomonas sp., B13 [TaxI 95.87
d1vlqa_322 Acetyl xylan esterase TM0077 {Thermotoga maritima 95.76
d1jkma_358 Carboxylesterase {Bacillus subtilis, brefeldin A e 95.42
d2i3da1218 Hypothetical protein Atu1826 {Agrobacterium tumefa 94.6
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 94.58
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 94.53
d1gpla1112 Pancreatic lipase, C-terminal domain {Guinea pig ( 94.45
d1qlwa_318 A novel bacterial esterase {Alcaligenes sp. [TaxId 93.9
d1rp1a1113 Pancreatic lipase, C-terminal domain {Dog (Canis f 93.75
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 93.27
d1pv1a_299 Hypothetical esterase YJL068C {Baker's yeast (Sacc 93.23
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 93.15
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 93.08
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 92.83
d2gzsa1265 Enterobactin and salmochelin hydrolase IroE {Esche 92.78
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 92.39
d1bu8a1114 Pancreatic lipase, C-terminal domain {Rat (Rattus 91.92
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 91.34
d1ju3a2347 Bacterial cocaine esterase N-terminal domain {Rhod 91.09
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 90.74
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 90.18
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 88.99
d1mpxa2381 Alpha-amino acid ester hydrolase {Xanthomonas citr 87.35
d1qe3a_483 Thermophilic para-nitrobenzyl esterase (PNB estera 86.44
d1uxoa_ 186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 86.25
d2b9va2385 Alpha-amino acid ester hydrolase {Acetobacter past 84.01
d1qoza_207 Acetylxylan esterase {Trichoderma reesei [TaxId: 5 83.2
d1ukca_517 Esterase EstA {Aspergillus niger [TaxId: 5061]} 81.87
d1g66a_207 Acetylxylan esterase {Penicillium purpurogenum [Ta 81.15
d1rp1a1113 Pancreatic lipase, C-terminal domain {Dog (Canis f 80.45
d1llfa_534 Type-B carboxylesterase/lipase {Candida cylindrace 80.38
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Pancreatic lipase, N-terminal domain
domain: Pancreatic lipase, N-terminal domain
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=100.00  E-value=2.8e-80  Score=648.24  Aligned_cols=299  Identities=35%  Similarity=0.669  Sum_probs=268.4

Q ss_pred             hhhhcCC-CCccceeeecCccccccccccccCCcceeeEEecccccccceeeeeeeccccCCCccchHHHHHHHHhcCCC
Q psy2283          43 KEQFYKP-GAEHRQVVGGAGVGHITDVLFRWEHEISVNILTWRLEALIHVSSVLVESLEEKQTVVSFKSELTRQLLIKDD  121 (604)
Q Consensus        43 ~~~~~~~-~~~~~q~~~~~~~~~i~~s~f~~~~~~~v~ihgW~~~~~i~~s~vl~hg~~~~~~~~~W~~~~~~all~~~d  121 (604)
                      ++.+|+. +++.+|.+...+...+.+++||+++||+|+||||.+.                 ++..|+..|++|||+++|
T Consensus        38 ~f~LyTr~n~~~~~~l~~~~~~~l~~s~f~~~~pt~iiiHG~~~~-----------------~~~~~~~~~~~a~l~~~d  100 (338)
T d1bu8a2          38 RFLLYTNENPNNYQKISATEPDTIKFSNFQLDRKTRFIVHGFIDK-----------------GEDGWLLDMCKKMFQVEK  100 (338)
T ss_dssp             EEEEEETTEEEEEEEECSSSTHHHHTSCCCTTSEEEEEECCSCCT-----------------TCTTHHHHHHHHHHTTCC
T ss_pred             EEEEEeCCCCCCceEecCCChhhHhhccCCCCCceEEEeCcccCC-----------------CCcccHHHHHHHHHhcCC
Confidence            4567777 6888999999999999999999999999999999963                 356899999999999999


Q ss_pred             cEEEEEcCCCCCCchHHHHHHhHHHHHHHHHHHHHHHHHhhCCCccceEEEEeehHHHHHHHhhhhcchhcCCceeeEec
Q psy2283         122 VNVIVNNWGAGSSPPYTQAVANIRLVGYMTAVLLNTLRREVGIRTEYVHLIGHSLGAHLSGYVGSTLRTVYNLKLGRITG  201 (604)
Q Consensus       122 ~NVI~VDW~~~a~~~Y~~a~~n~~~Vg~~la~~i~~L~~~~g~~~~~vhlIGhSLGAHiAG~aG~~l~~~~~~~v~rItg  201 (604)
                      +|||+|||+.+|...|.+|+.|++.||++||+||+.|.++.|++++++|||||||||||||+||+++    .++|+||||
T Consensus       101 ~NVi~VDW~~~a~~~Y~~a~~n~~~Vg~~ia~~i~~l~~~~g~~~~~vhlIGhSLGAhiaG~ag~~l----~~kigrItg  176 (338)
T d1bu8a2         101 VNCICVDWRRGSRTEYTQASYNTRVVGAEIAFLVQVLSTEMGYSPENVHLIGHSLGAHVVGEAGRRL----EGHVGRITG  176 (338)
T ss_dssp             EEEEEEECHHHHSSCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCGGGEEEEEETHHHHHHHHHHHHT----TTCSSEEEE
T ss_pred             ceEEEEechhhcccchHHHHHhHHHHHHHHHHHHHHHHHhcCCCcceeEEEeccHHHHHHHHHHHhh----ccccccccc
Confidence            9999999999998889999999999999999999999888899999999999999999999999997    568999999


Q ss_pred             cCCCCCCCCCCCccccCCCCCCCcEEEEEcCCCcccc-CCCCCCccccceeeecCCCCCCCCCCCcccccccccccceec
Q psy2283         202 LDPADPYFSGTESIVRLDPTDATFVDIVHTDAAPFVK-GGLGMGEPIGHLDFYPNGGENQPGCDQGMFAFIHLERGSVVK  280 (604)
Q Consensus       202 LDPAgP~F~~~~~~~rLd~sDA~fVdvIHT~~~~~~~-~glG~~~~~GH~DFYpNGG~~QPGC~~~~~~~~~~~~~~~~~  280 (604)
                      ||||+|+|+..+++.|||++||+||||||||++.+.. +|+|+.+|+||+|||||||+.||||..++...+ .+...++.
T Consensus       177 LDPA~P~F~~~~~~~rLd~~DA~fVdVIHT~~g~l~~~~~~G~~~p~GhvDFYpNGG~~QPgC~~~~~~~~-~~~~~~~~  255 (338)
T d1bu8a2         177 LDPAEPCFQGLPEEVRLDPSDAMFVDVIHTDSAPIIPYLGFGMSQKVGHLDFFPNGGKEMPGCQKNILSTI-VDINGIWE  255 (338)
T ss_dssp             ESCBCTTTTTSCGGGSCCGGGSSSEEEECSCCSCHHHHCCCBCCSCCSSEEEEETTSSCCTTCCCCCCCSC-CCHHHHHT
T ss_pred             cccCcCcccCCchhcCcCcccCCeEEEEEeCCccccccccCCccCCcCCeeeccCCCccCCCCCcchhhcc-cccccccc
Confidence            9999999999999999999999999999999998654 689999999999999999999999998654333 23344567


Q ss_pred             cccccCCCchhhhHHHHHhhccCCCCceEeecCCHhhhhcCCCcCccCCCCCcccccCccccccchHHHHHhccccccCc
Q psy2283         281 GLRKYLGCDHIRSYEYFTESVNARCPFIAVECDTWDNFHAGNCFNCLRNNGLSCAKFGLNAVKHRNSQLQALGMSVYKPV  360 (604)
Q Consensus       281 g~~~~~~CsH~Rs~~yy~eSi~~~~~F~a~~C~sy~~f~~g~C~~c~~~~~~~c~~mG~~a~~~~~~~ae~lgv~i~~~~  360 (604)
                      ++...+.|||.||++||+|||.++|+|+|++|+||++|+++.|.+|.   ...|+.|||++++..             +.
T Consensus       256 ~~~~~~~CsH~ra~~yf~ESI~~~~~F~a~~C~s~~~~~~g~C~~c~---~~~~~~MG~~a~~~~-------------~~  319 (338)
T d1bu8a2         256 GTQNFVACNHLRSYKYYASSILNPDGFLGYPCSSYEKFQQNDCFPCP---EEGCPKMGHYADQFE-------------GK  319 (338)
T ss_dssp             TSSCCCCHHHHHHHHHHHHHHHCGGGCBCEECSCHHHHHTTCSCSCC---TTCCCBSSGGGGGCT-------------TT
T ss_pred             ccccccccchHHHHHHHHHHhcCCCCceeeeCCCHHHHHhCCCCCCC---CCCCCccCccccccc-------------CC
Confidence            77888999999999999999999999999999999999999999995   357999999998851             11


Q ss_pred             ccCCCceEEEecCCCCCcc
Q psy2283         361 YESKPSKYFLITGDKQPFC  379 (604)
Q Consensus       361 ~~~~~~~~Yl~Tgd~~Pf~  379 (604)
                      .....++|||.|++..||+
T Consensus       320 ~~~~~G~yyl~T~~~~Pfa  338 (338)
T d1bu8a2         320 TATVEQTVYLNTGDSGNFT  338 (338)
T ss_dssp             TSSSSEEEEECCCSSTTCC
T ss_pred             CCCcceEEEEecCCCCcCC
Confidence            0135789999999999995
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1qo7a_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vkha_ c.69.1.32 (A:) Putative serine hydrolase Ydr428c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d2gmha2 d.16.1.8 (A:237-335) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1jfra_ c.69.1.16 (A:) Lipase {Streptomyces exfoliatus [TaxId: 1905]} Back     information, alignment and structure
>d1r88a_ c.69.1.3 (A:) Antigen pt51/mpb51 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2pbla1 c.69.1.2 (A:1-261) Uncharacterized protein TM1040_2492 {Silicibacter sp. tm1040 [TaxId: 292414]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1jjia_ c.69.1.2 (A:) Carboxylesterase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1lzla_ c.69.1.2 (A:) Heroin esterase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2bgra2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1u4na_ c.69.1.2 (A:) Carboxylesterase {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1l7aa_ c.69.1.25 (A:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1dina_ c.69.1.9 (A:) Dienelactone hydrolase {Pseudomonas sp., B13 [TaxId: 306]} Back     information, alignment and structure
>d1vlqa_ c.69.1.25 (A:) Acetyl xylan esterase TM0077 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jkma_ c.69.1.2 (A:) Carboxylesterase {Bacillus subtilis, brefeldin A esterase [TaxId: 1423]} Back     information, alignment and structure
>d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1gpla1 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal domain {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1rp1a1 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1pv1a_ c.69.1.34 (A:) Hypothetical esterase YJL068C {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d2gzsa1 c.69.1.38 (A:41-305) Enterobactin and salmochelin hydrolase IroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1bu8a1 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1ju3a2 c.69.1.21 (A:5-351) Bacterial cocaine esterase N-terminal domain {Rhodococcus sp. mb1 [TaxId: 51612]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d1mpxa2 c.69.1.21 (A:24-404) Alpha-amino acid ester hydrolase {Xanthomonas citri [TaxId: 346]} Back     information, alignment and structure
>d1qe3a_ c.69.1.1 (A:) Thermophilic para-nitrobenzyl esterase (PNB esterase) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2b9va2 c.69.1.21 (A:50-434) Alpha-amino acid ester hydrolase {Acetobacter pasteurianus [TaxId: 438]} Back     information, alignment and structure
>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1ukca_ c.69.1.17 (A:) Esterase EstA {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} Back     information, alignment and structure
>d1rp1a1 b.12.1.2 (A:337-449) Pancreatic lipase, C-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1llfa_ c.69.1.17 (A:) Type-B carboxylesterase/lipase {Candida cylindracea, cholesterol esterase [TaxId: 44322]} Back     information, alignment and structure