Psyllid ID: psy2296

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------21
MSKKKGLSVEEKRTGLLELFHEKEEFFQLKLIIELEKLAPKEKGIISQSVKEILQSLVDDGLVESEKIGTSTYFWSFPNKASDRVDCKLEKITAEIEDVTKELAQNNEALEKSMVGRGDSKNREDFLQEVGNISKELELINKELEKYKNNDPDTLKLIENTAQRAKEAANRWTDNLFSLKSWCKNKFGLEETALNKHFSIPEEMDYID
ccccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHcccccccccccHHHHHHHHHHccccccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccccccc
ccccccccHHHHHHHHHHHHHcccccEEcccHHHHHHHccHHccccHHHHHHHHHHHHccccEcEEEcccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHccccccccccc
mskkkglsvEEKRTGLLELFHEKEEFFQLKLIIELEklapkekgIISQSVKEILQSLVDdglvesekigtstyfwsfpnkasdrvdcKLEKITAEIEDVTKELAQNNEALEKsmvgrgdsknREDFLQEVGNISKELELINKELEkyknndpdTLKLIENTAQRAKEAANRWTDNLFSLKSWCKnkfgleetalnkhfsipeemdyid
mskkkglsveekrtgllelfhekEEFFQLKLIIELEKLAPKEKGIISQSVKEILQSLVDDGLVESEKIgtstyfwsfpnkasdrvDCKLEKITAEIEDVTKELAqnnealeksmvgrgdsknREDFLQEVGNISKELELINKELekyknndpdtLKLIENTAQRAKEAANRWTDNLFSLKSWCKNKFGLeetalnkhfsipeemdyid
MSKKKGLSVEEKRTGllelfhekeeffqlklIIELEKLAPKEKGIISQSVKEILQSLVDDGLVESEKIGTSTYFWSFPNKASDRVDCKLEKITAEIEDVTKELAQNNEALEKSMVGRGDSKNREDFLQEVGNISkelelinkelekyknnDPDTLKLIENTAQRAKEAANRWTDNLFSLKSWCKNKFGLEETALNKHFSIPEEMDYID
**************GLLELFHEKEEFFQLKLIIELEKLAPKEKGIISQSVKEILQSLVDDGLVESEKIGTSTYFWSFPNKASDRVDCKLEKITAEIE**********************************************************************AANRWTDNLFSLKSWCKNKFGLEETALNKHF**********
****************LELFHEKEEFFQLKLII***************SVKEILQSLVDDGLVESEKIGTSTYFWSFPNKASDRV******************************************************************P**LKLIENTAQRAKEAANRWTDNLFSLKSWCKNKFGLEETALNKHFSIPEEMDYID
*********EEKRTGLLELFHEKEEFFQLKLIIELEKLAPKEKGIISQSVKEILQSLVDDGLVESEKIGTSTYFWSFPNKASDRVDCKLEKITAEIEDVTKELAQNNEALEKSMVGRGDSKNREDFLQEVGNISKELELINKELEKYKNNDPDTLKLIENTAQRAKEAANRWTDNLFSLKSWCKNKFGLEETALNKHFSIPEEMDYID
*******SVEEKRTGLLELFHEKEEFFQLKLIIELEKLAPKEKGIISQSVKEILQSLVDDGLVESEKIGTSTYFWSFPNKASDRVDCKLEKITAEIEDVTKELAQNNEALEKSMVGRGDSKNREDFLQEVGNISKELELINKELEKYKNNDPDTLKLIENTAQRAKEAANRWTDNLFSLKSWCKNKFGLEETALNKHFSIPEEMDYID
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKKKGLSVEEKRTGLLELFHEKEEFFQLKLIIELEKLAPKEKGIISQSVKEILQSLVDDGLVESEKIGTSTYFWSFPNKAxxxxxxxxxxxxxxxxxxxxxxxxxxxxLEKSMVGRGDSKNREDFLQExxxxxxxxxxxxxxxxxxxxxDPDTxxxxxxxxxxxxxxxxxxxxxLFSLKSWCKNKFGLEETALNKHFSIPEEMDYID
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query208 2.2.26 [Sep-21-2011]
Q5XGY9205 Meiotic nuclear division N/A N/A 0.985 1.0 0.519 7e-56
Q32L19205 Meiotic nuclear division yes N/A 0.985 1.0 0.495 1e-54
Q9BWT6205 Meiotic nuclear division yes N/A 0.985 1.0 0.490 4e-54
Q8K396205 Meiotic nuclear division yes N/A 0.985 1.0 0.490 1e-53
Q8GYD2230 Meiotic nuclear division yes N/A 0.980 0.886 0.421 5e-41
Q6DC61220 Meiotic nuclear division yes N/A 0.836 0.790 0.446 1e-36
Q09739210 Meiotic coiled-coil prote yes N/A 0.942 0.933 0.370 8e-28
Q54E86221 Meiotic nuclear division yes N/A 0.951 0.895 0.287 3e-16
P53102219 Meiotic nuclear division yes N/A 0.956 0.908 0.314 5e-16
>sp|Q5XGY9|MND1_XENLA Meiotic nuclear division protein 1 homolog OS=Xenopus laevis GN=mnd1 PE=2 SV=1 Back     alignment and function desciption
 Score =  216 bits (551), Expect = 7e-56,   Method: Compositional matrix adjust.
 Identities = 108/208 (51%), Positives = 151/208 (72%), Gaps = 3/208 (1%)

Query: 1   MSKKKGLSVEEKRTGLLELFHEKEEFFQLKLIIELEKLAPKEKGIISQSVKEILQSLVDD 60
           MSKK+GLSVEEKRT ++E+F E ++ FQLK   +LEK+APKEKGI S SVKEILQSLVDD
Sbjct: 1   MSKKRGLSVEEKRTRMMEIFFETKDVFQLK---DLEKIAPKEKGITSMSVKEILQSLVDD 57

Query: 61  GLVESEKIGTSTYFWSFPNKASDRVDCKLEKITAEIEDVTKELAQNNEALEKSMVGRGDS 120
           G+V+SE+IGTS YFW+FP+KA      KLE + A+  +V ++     + ++K+ VGR D+
Sbjct: 58  GMVDSERIGTSNYFWAFPSKALHARKRKLETLEAQFTEVKQKKESLQQCVDKAKVGRQDT 117

Query: 121 KNREDFLQEVGNISKELELINKELEKYKNNDPDTLKLIENTAQRAKEAANRWTDNLFSLK 180
           + R   ++E+ ++    E +  +LEKYK  DPD ++ I  + + AK+A NRWTDN+F++K
Sbjct: 118 EERSKLVEELASLRHRKEELCADLEKYKECDPDVVEEIRQSNKVAKDAVNRWTDNIFAVK 177

Query: 181 SWCKNKFGLEETALNKHFSIPEEMDYID 208
           SW K KFG EE  ++K+F IPE+ DYID
Sbjct: 178 SWAKKKFGFEERQIDKNFGIPEDFDYID 205
Required for proper homologous chromosome pairing and efficient cross-over and intragenic recombination during meiosis. Stimulates both dmc1- and rad51-mediated homologous strand assimilation, which is required for the resolution of meiotic double-strand breaks.
Xenopus laevis (taxid: 8355)
>sp|Q32L19|MND1_BOVIN Meiotic nuclear division protein 1 homolog OS=Bos taurus GN=MND1 PE=2 SV=1 Back     alignment and function description
>sp|Q9BWT6|MND1_HUMAN Meiotic nuclear division protein 1 homolog OS=Homo sapiens GN=MND1 PE=1 SV=1 Back     alignment and function description
>sp|Q8K396|MND1_MOUSE Meiotic nuclear division protein 1 homolog OS=Mus musculus GN=Mnd1 PE=1 SV=1 Back     alignment and function description
>sp|Q8GYD2|MND1_ARATH Meiotic nuclear division protein 1 homolog OS=Arabidopsis thaliana GN=MND1 PE=1 SV=1 Back     alignment and function description
>sp|Q6DC61|MND1_DANRE Meiotic nuclear division protein 1 homolog OS=Danio rerio GN=mnd1 PE=2 SV=1 Back     alignment and function description
>sp|Q09739|MCP7_SCHPO Meiotic coiled-coil protein 7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mcp7 PE=1 SV=1 Back     alignment and function description
>sp|Q54E86|MND1_DICDI Meiotic nuclear division protein 1 homolog OS=Dictyostelium discoideum GN=mnd1 PE=3 SV=1 Back     alignment and function description
>sp|P53102|MND1_YEAST Meiotic nuclear division protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MND1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
156402283205 predicted protein [Nematostella vectensi 0.985 1.0 0.528 3e-56
346470677204 hypothetical protein [Amblyomma maculatu 0.980 1.0 0.516 6e-56
147905528205 meiotic nuclear division protein 1 homol 0.985 1.0 0.519 3e-54
226372540205 Meiotic nuclear division protein 1 homol 0.985 1.0 0.514 6e-54
62751486205 meiotic nuclear divisions 1 homolog [Xen 0.985 1.0 0.524 7e-54
126331473275 PREDICTED: meiotic nuclear division prot 0.985 0.745 0.504 4e-53
296478799205 TPA: meiotic nuclear division protein 1 0.985 1.0 0.495 6e-53
84000421205 meiotic nuclear division protein 1 homol 0.985 1.0 0.495 6e-53
354474612205 PREDICTED: meiotic nuclear division prot 0.985 1.0 0.5 1e-52
384475779205 meiotic nuclear division protein 1 homol 0.985 1.0 0.495 2e-52
>gi|156402283|ref|XP_001639520.1| predicted protein [Nematostella vectensis] gi|156226649|gb|EDO47457.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
 Score =  223 bits (569), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 110/208 (52%), Positives = 155/208 (74%), Gaps = 3/208 (1%)

Query: 1   MSKKKGLSVEEKRTGLLELFHEKEEFFQLKLIIELEKLAPKEKGIISQSVKEILQSLVDD 60
           MSKK+GLS +EKR  L ELF EK++FFQLK   ELEK+APKEKGI S SVKE+LQSLVDD
Sbjct: 1   MSKKRGLSHDEKRHRLQELFFEKKDFFQLK---ELEKIAPKEKGITSMSVKEVLQSLVDD 57

Query: 61  GLVESEKIGTSTYFWSFPNKASDRVDCKLEKITAEIEDVTKELAQNNEALEKSMVGRGDS 120
           GLV++EKIGTS YFWS+P+KA      K+++++  + D  K+++ +++ ++++ VGR +S
Sbjct: 58  GLVDTEKIGTSVYFWSYPSKAMHTRKRKIDELSTAVADYEKKISSSSKQIKQANVGREES 117

Query: 121 KNREDFLQEVGNISKELELINKELEKYKNNDPDTLKLIENTAQRAKEAANRWTDNLFSLK 180
           +NRE  LQ++ +  +    +  ELE Y+  DPD L  ++     AKEAANRWTDN+F++K
Sbjct: 118 ENRESLLQQLADKEELCHKLEAELETYRECDPDVLDKLQQETAVAKEAANRWTDNVFAIK 177

Query: 181 SWCKNKFGLEETALNKHFSIPEEMDYID 208
           SWCKNKF +EE  ++K+F IPE+ DY+D
Sbjct: 178 SWCKNKFNVEEQMIDKNFGIPEDFDYLD 205

Source: Nematostella vectensis

Species: Nematostella vectensis

Genus: Nematostella

Family: Edwardsiidae

Order: Actiniaria

Class: Anthozoa

Phylum: Cnidaria

Superkingdom: Eukaryota
>gi|346470677|gb|AEO35183.1| hypothetical protein [Amblyomma maculatum] Back     alignment and taxonomy information
>gi|147905528|ref|NP_001088280.1| meiotic nuclear division protein 1 homolog [Xenopus laevis] gi|82180373|sp|Q5XGY9.1|MND1_XENLA RecName: Full=Meiotic nuclear division protein 1 homolog gi|54038440|gb|AAH84288.1| Mnd1 protein [Xenopus laevis] Back     alignment and taxonomy information
>gi|226372540|gb|ACO51895.1| Meiotic nuclear division protein 1 homolog [Rana catesbeiana] Back     alignment and taxonomy information
>gi|62751486|ref|NP_001015849.1| meiotic nuclear divisions 1 homolog [Xenopus (Silurana) tropicalis] gi|58477461|gb|AAH90139.1| MGC97859 protein [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|126331473|ref|XP_001375880.1| PREDICTED: meiotic nuclear division protein 1 homolog [Monodelphis domestica] Back     alignment and taxonomy information
>gi|296478799|tpg|DAA20914.1| TPA: meiotic nuclear division protein 1 homolog [Bos taurus] Back     alignment and taxonomy information
>gi|84000421|ref|NP_001033312.1| meiotic nuclear division protein 1 homolog [Bos taurus] gi|122138693|sp|Q32L19.1|MND1_BOVIN RecName: Full=Meiotic nuclear division protein 1 homolog gi|81674353|gb|AAI09807.1| Meiotic nuclear divisions 1 homolog (S. cerevisiae) [Bos taurus] Back     alignment and taxonomy information
>gi|354474612|ref|XP_003499524.1| PREDICTED: meiotic nuclear division protein 1 homolog [Cricetulus griseus] Back     alignment and taxonomy information
>gi|384475779|ref|NP_001245035.1| meiotic nuclear division protein 1 homolog [Macaca mulatta] gi|402870663|ref|XP_003899326.1| PREDICTED: meiotic nuclear division protein 1 homolog [Papio anubis] gi|383422075|gb|AFH34251.1| meiotic nuclear division protein 1 homolog [Macaca mulatta] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query208
UNIPROTKB|Q32L19205 MND1 "Meiotic nuclear division 0.985 1.0 0.437 7.3e-43
MGI|MGI:1924165205 Mnd1 "meiotic nuclear division 0.985 1.0 0.437 3.2e-42
UNIPROTKB|Q9BWT6205 MND1 "Meiotic nuclear division 0.985 1.0 0.427 6.6e-42
TAIR|locus:2119881230 ATMND1 "AT4G29170" [Arabidopsi 0.980 0.886 0.374 4.7e-32
ZFIN|ZDB-GENE-040801-116220 mnd1 "meiotic nuclear division 0.836 0.790 0.384 1.7e-27
POMBASE|SPAC13A11.03210 mcp7 "meiosis specific coiled- 0.942 0.933 0.312 7e-22
DICTYBASE|DDB_G0291750221 mnd1 "meiotic nuclear division 0.971 0.914 0.246 4.1e-17
SGD|S000003151219 MND1 "Protein required for rec 0.951 0.904 0.287 1.1e-14
ASPGD|ASPL0000049737221 AN1843 [Emericella nidulans (t 0.745 0.701 0.203 2.2e-08
CGD|CAL0006029201 orf19.6142 [Candida albicans ( 0.451 0.467 0.31 3e-06
UNIPROTKB|Q32L19 MND1 "Meiotic nuclear division protein 1 homolog" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 453 (164.5 bits), Expect = 7.3e-43, P = 7.3e-43
 Identities = 91/208 (43%), Positives = 130/208 (62%)

Query:     1 MSKKKGLSVEEKRTGXXXXXXXXXXXXXXXXIIELEKLAPKEKGIISQSVKEILQSLVDD 60
             MSKKKGLS EEKRT                 + ++EK+APKEKGI + SVKE+LQSLVDD
Sbjct:     1 MSKKKGLSAEEKRT---RMMEIFYETKDVFQLKDMEKIAPKEKGITTMSVKEVLQSLVDD 57

Query:    61 GLVESEKIGTSTYFWSFPNKASDRVDCKLEKITAEIEDVTKELAQNNEALEKSMVGRGDS 120
             G+V+ E+IGTS Y+W+FP+KA      KLE + +++ +  ++ A   +++EK+ VGR ++
Sbjct:    58 GMVDCERIGTSNYYWAFPSKALHARKRKLEVLDSQLSEGNQKYANLQKSIEKAKVGRHET 117

Query:   121 KNREDFLQEVGNISXXXXXXXXXXXXXXXXDPDTLKLIENTAQRAKEAANRWTDNLFSLK 180
             + R    +E+ ++                 DP  ++ I    Q AKEAANRWTDN+F++K
Sbjct:   118 EERTMLAKELSSLRDQREQLKAEVEKYRECDPQVVEEIRQANQVAKEAANRWTDNIFAIK 177

Query:   181 SWCKNKFGLEETALNKHFSIPEEMDYID 208
             SW K KFG EE  ++K+F IPE+ DYID
Sbjct:   178 SWAKRKFGFEENKIDKNFGIPEDFDYID 205
GO:0005634 "nucleus" evidence=IEA
GO:0007126 "meiosis" evidence=IEA
GO:0006310 "DNA recombination" evidence=IEA
GO:0003677 "DNA binding" evidence=IEA
MGI|MGI:1924165 Mnd1 "meiotic nuclear divisions 1 homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BWT6 MND1 "Meiotic nuclear division protein 1 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
TAIR|locus:2119881 ATMND1 "AT4G29170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-116 mnd1 "meiotic nuclear divisions 1 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
POMBASE|SPAC13A11.03 mcp7 "meiosis specific coiled-coil protein Mcp7" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0291750 mnd1 "meiotic nuclear division protein 1" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
SGD|S000003151 MND1 "Protein required for recombination and meiotic nuclear division" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
ASPGD|ASPL0000049737 AN1843 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
CGD|CAL0006029 orf19.6142 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q32L19MND1_BOVINNo assigned EC number0.49510.98551.0yesN/A
Q6DC61MND1_DANRENo assigned EC number0.44630.83650.7909yesN/A
Q5XGY9MND1_XENLANo assigned EC number0.51920.98551.0N/AN/A
Q8K396MND1_MOUSENo assigned EC number0.49030.98551.0yesN/A
Q9BWT6MND1_HUMANNo assigned EC number0.49030.98551.0yesN/A
Q09739MCP7_SCHPONo assigned EC number0.37070.94230.9333yesN/A
P53102MND1_YEASTNo assigned EC number0.31450.95670.9086yesN/A
Q54E86MND1_DICDINo assigned EC number0.28700.95190.8959yesN/A
Q8GYD2MND1_ARATHNo assigned EC number0.42180.98070.8869yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
pfam03962188 pfam03962, Mnd1, Mnd1 family 3e-63
COG5124209 COG5124, COG5124, Protein predicted to be involved 7e-35
>gnl|CDD|202833 pfam03962, Mnd1, Mnd1 family Back     alignment and domain information 
 Score =  193 bits (494), Expect = 3e-63
 Identities = 98/191 (51%), Positives = 139/191 (72%), Gaps = 3/191 (1%)

Query: 16  LLELFHEKEEFFQLKLIIELEKLAPKEKGIISQSVKEILQSLVDDGLVESEKIGTSTYFW 75
           +LE+F E + F+ LK   ELEKLAPK KGI S SVKE+LQSLVDDGLV +EKIGTS Y+W
Sbjct: 1   ILEIFQETKTFYTLK---ELEKLAPKVKGISSMSVKEVLQSLVDDGLVRTEKIGTSNYYW 57

Query: 76  SFPNKASDRVDCKLEKITAEIEDVTKELAQNNEALEKSMVGRGDSKNREDFLQEVGNISK 135
           SFP++A +++  +LEK+  E+E++ + +A+    +EK   GR +++ R + L+E+  + K
Sbjct: 58  SFPSQALNKLKTRLEKLKKELEELKQRIAELQAQIEKLKKGREETEERTELLEELKQLEK 117

Query: 136 ELELINKELEKYKNNDPDTLKLIENTAQRAKEAANRWTDNLFSLKSWCKNKFGLEETALN 195
           EL+ +  ELEKY+ NDP+ ++ ++   + AKEAANRWTDN+FSLKS+   KFGL+E  L 
Sbjct: 118 ELKKLKAELEKYEKNDPERIEKLKEETKVAKEAANRWTDNIFSLKSYLSKKFGLDEAQLR 177

Query: 196 KHFSIPEEMDY 206
           K F IPE+ DY
Sbjct: 178 KEFGIPEDFDY 188

This family of proteins includes MND1 from S. cerevisiae. The mnd1 protein forms a complex with hop2 to promote homologous chromosome pairing and meiotic double-strand break repair. Length = 188
>gnl|CDD|227453 COG5124, COG5124, Protein predicted to be involved in meiotic recombination [Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 208
PF03962188 Mnd1: Mnd1 family; InterPro: IPR005647 This family 100.0
KOG3433|consensus203 100.0
COG5124209 Protein predicted to be involved in meiotic recomb 100.0
PF07106169 TBPIP: Tat binding protein 1(TBP-1)-interacting pr 98.6
KOG4603|consensus201 97.27
PF0867967 DsrD: Dissimilatory sulfite reductase D (DsrD); In 96.45
KOG3433|consensus203 96.18
PF03965115 Penicillinase_R: Penicillinase repressor; InterPro 95.84
PF0470362 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. 95.8
PF02002105 TFIIE_alpha: TFIIE alpha subunit; InterPro: IPR024 94.93
PRK06266178 transcription initiation factor E subunit alpha; V 94.3
cd0009078 HTH_ARSR Arsenical Resistance Operon Repressor and 94.26
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 93.99
PF09789 319 DUF2353: Uncharacterized coiled-coil protein (DUF2 93.59
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Op 93.52
cd07153116 Fur_like Ferric uptake regulator(Fur) and related 93.48
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 93.42
PF01475120 FUR: Ferric uptake regulator family; InterPro: IPR 93.02
TIGR02698130 CopY_TcrY copper transport repressor, CopY/TcrY fa 92.86
COG1777217 Predicted transcriptional regulators [Transcriptio 92.67
COG2433 652 Uncharacterized conserved protein [Function unknow 91.64
TIGR00373158 conserved hypothetical protein TIGR00373. This fam 91.61
COG1675176 TFA1 Transcription initiation factor IIE, alpha su 91.48
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 90.83
PF0197868 TrmB: Sugar-specific transcriptional regulator Trm 90.49
PF02403108 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal dom 90.22
PF1284061 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ 90.11
KOG0250|consensus 1074 89.85
PF0933952 HTH_IclR: IclR helix-turn-helix domain; InterPro: 89.66
PF1373055 HTH_36: Helix-turn-helix domain 89.48
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 89.28
TIGR02702203 SufR_cyano iron-sulfur cluster biosynthesis transc 88.72
PF0146678 Skp1: Skp1 family, dimerisation domain; InterPro: 88.65
PF15556252 Zwint: ZW10 interactor 88.54
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 88.25
smart00531147 TFIIE Transcription initiation factor IIE. 88.23
smart0034691 HTH_ICLR helix_turn_helix isocitrate lyase regulat 88.12
PF06476115 DUF1090: Protein of unknown function (DUF1090); In 88.07
PF0706183 Swi5: Swi5; InterPro: IPR010760 This entry represe 87.81
PF05158 327 RNA_pol_Rpc34: RNA polymerase Rpc34 subunit; Inter 87.72
COG0735145 Fur Fe2+/Zn2+ uptake regulation proteins [Inorgani 87.69
PF06160 560 EzrA: Septation ring formation regulator, EzrA ; I 87.66
PRK02224 880 chromosome segregation protein; Provisional 87.58
PRK11637 428 AmiB activator; Provisional 87.16
PRK09462148 fur ferric uptake regulator; Provisional 86.89
PF0500879 V-SNARE: Vesicle transport v-SNARE protein N-termi 86.49
PF13851201 GAS: Growth-arrest specific micro-tubule binding 85.63
COG3883 265 Uncharacterized protein conserved in bacteria [Fun 85.01
PRK10141117 DNA-binding transcriptional repressor ArsR; Provis 84.36
PRK04778 569 septation ring formation regulator EzrA; Provision 83.99
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. T 83.68
PRK06474178 hypothetical protein; Provisional 82.84
PF10146 230 zf-C4H2: Zinc finger-containing protein ; InterPro 82.68
PF1359184 MerR_2: MerR HTH family regulatory protein 82.66
KOG0972|consensus384 82.59
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repr 82.49
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 82.21
PF05557722 MAD: Mitotic checkpoint protein; InterPro: IPR0086 81.86
PRK11639169 zinc uptake transcriptional repressor; Provisional 81.63
PRK11637 428 AmiB activator; Provisional 81.55
cd0476691 HTH_HspR Helix-Turn-Helix DNA binding domain of th 81.12
PRK05431 425 seryl-tRNA synthetase; Provisional 81.1
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 80.99
PF1518885 CCDC-167: Coiled-coil domain-containing protein 16 80.56
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 80.56
COG4477 570 EzrA Negative regulator of septation ring formatio 80.32
PRK10884206 SH3 domain-containing protein; Provisional 80.3
PHA00738108 putative HTH transcription regulator 80.27
smart00347101 HTH_MARR helix_turn_helix multiple antibiotic resi 80.16
>PF03962 Mnd1: Mnd1 family; InterPro: IPR005647 This family of proteins includes meiotic nuclear division protein 1 (MND1) from Saccharomyces cerevisiae (Baker's yeast) Back     alignment and domain information 
Probab=100.00  E-value=1.3e-73  Score=478.54  Aligned_cols=188  Identities=54%  Similarity=0.946  Sum_probs=187.0

Q ss_pred             HHHHhhhccchhhhcchHHHHhhcccccCCccchHHHHHHHhhhcCcccccccccceeEeeccchhhHHHHHHHHHHHHH
Q psy2296          16 LLELFHEKEEFFQLKLIIELEKLAPKEKGIISQSVKEILQSLVDDGLVESEKIGTSTYFWSFPNKASDRVDCKLEKITAE   95 (208)
Q Consensus        16 il~~f~~~~~~f~lK~~~ElEK~~pK~~GI~~~~VKdvlq~LVDDglV~~EKiGtsN~YWsFps~~~~~~~~~~~~l~~~   95 (208)
                      ||+|||++++|||||   ||||+|||+|||++|+||||||+|||||||++||||||||||||||++.+.+++.+++|+++
T Consensus         1 il~~f~e~~~~y~lK---ELEK~~pK~~gI~~~~VKdvlq~LvDDglV~~EKiGssn~YWsFps~~~~~~~~~~~~l~~~   77 (188)
T PF03962_consen    1 ILEIFHESKDFYTLK---ELEKLAPKEKGIVSMSVKDVLQSLVDDGLVHVEKIGSSNYYWSFPSQAKQKRQNKLEKLQKE   77 (188)
T ss_pred             ChHHHhhcCCcccHH---HHHHHcccccCCchhhHHHHHHHHhccccchhhhccCeeEEEecChHHHHHHHHHHHHHHHH
Confidence            689999999999999   99999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHhccCCCChhHHHHHHHHHHHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHHHHhhhhhh
Q psy2296          96 IEDVTKELAQNNEALEKSMVGRGDSKNREDFLQEVGNISKELELINKELEKYKNNDPDTLKLIENTAQRAKEAANRWTDN  175 (208)
Q Consensus        96 i~~~~~~i~~l~~~ie~~~~~r~~~~eR~~ll~~l~~L~~~~~~l~~el~~~~~~Dp~~i~~~~~~~~~~k~aanrwTDN  175 (208)
                      ++.++.++.++++.|+.++.+|+++++|+.+|+++++|+.++++|+++|++|..+||+.|+++++++..+++||||||||
T Consensus        78 ~~~~~~~i~~l~~~i~~~~~~r~~~~eR~~~l~~l~~l~~~~~~l~~el~~~~~~Dp~~i~~~~~~~~~~~~~anrwTDN  157 (188)
T PF03962_consen   78 IEELEKKIEELEEKIEEAKKGREESEEREELLEELEELKKELKELKKELEKYSENDPEKIEKLKEEIKIAKEAANRWTDN  157 (188)
T ss_pred             HHHHHHHHHHHHHHHHHHHhcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHhhcCCCHHHHhhhcCCCCCCcc
Q psy2296         176 LFSLKSWCKNKFGLEETALNKHFSIPEEMDY  206 (208)
Q Consensus       176 I~~l~~~~~~k~~~~~~~i~~~f~Ip~d~dy  206 (208)
                      ||+|++||+++|||++++|+++||||+||||
T Consensus       158 I~~l~~~~~~k~~~~~~~i~k~f~Ip~d~dy  188 (188)
T PF03962_consen  158 IFSLKSYLKKKFGMDEEDIRKEFGIPEDFDY  188 (188)
T ss_pred             HHHHHHHHHHhcCCCHHHHHHHcCCccccCC
Confidence            9999999999999999999999999999998

The mnd1 protein forms a complex with hop2 to promote homologous chromosome pairing and meiotic double-strand break repair [].
>KOG3433|consensus Back     alignment and domain information
>COG5124 Protein predicted to be involved in meiotic recombination [Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>PF07106 TBPIP: Tat binding protein 1(TBP-1)-interacting protein (TBPIP); InterPro: IPR010776 This family consists of several eukaryotic TBP-1 interacting protein (TBPIP) sequences Back     alignment and domain information
>KOG4603|consensus Back     alignment and domain information
>PF08679 DsrD: Dissimilatory sulfite reductase D (DsrD); InterPro: IPR014793 The structure of the dissimilatory sulphite reductase D (DsrD) protein has shown it to contain a winged-helix motif similar to those found in DNA binding proteins [] Back     alignment and domain information
>KOG3433|consensus Back     alignment and domain information
>PF03965 Penicillinase_R: Penicillinase repressor; InterPro: IPR005650 Proteins in this entry are transcriptional regulators found in a variety of bacteria and a small number of archaea Back     alignment and domain information
>PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A Back     alignment and domain information
>PF02002 TFIIE_alpha: TFIIE alpha subunit; InterPro: IPR024550 The general transcription factor TFIIE has an essential role in eukaryotic transcription initiation, together with RNA polymerase II and other general factors Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>cd00090 HTH_ARSR Arsenical Resistance Operon Repressor and similar prokaryotic, metal regulated homodimeric repressors Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>cd07153 Fur_like Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>PF01475 FUR: Ferric uptake regulator family; InterPro: IPR002481 The Ferric uptake regulator (FUR) family includes metal ion uptake regulator proteins Back     alignment and domain information
>TIGR02698 CopY_TcrY copper transport repressor, CopY/TcrY family Back     alignment and domain information
>COG1777 Predicted transcriptional regulators [Transcription] Back     alignment and domain information
>COG2433 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00373 conserved hypothetical protein TIGR00373 Back     alignment and domain information
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis Back     alignment and domain information
>PF02403 Seryl_tRNA_N: Seryl-tRNA synthetase N-terminal domain; InterPro: IPR015866 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B Back     alignment and domain information
>KOG0250|consensus Back     alignment and domain information
>PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>PF13730 HTH_36: Helix-turn-helix domain Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>TIGR02702 SufR_cyano iron-sulfur cluster biosynthesis transcriptional regulator SufR Back     alignment and domain information
>PF01466 Skp1: Skp1 family, dimerisation domain; InterPro: IPR016072 SKP1 (together with SKP2) was identified as an essential component of the cyclin A-CDK2 S phase kinase complex [] Back     alignment and domain information
>PF15556 Zwint: ZW10 interactor Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>smart00531 TFIIE Transcription initiation factor IIE Back     alignment and domain information
>smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation Back     alignment and domain information
>PF06476 DUF1090: Protein of unknown function (DUF1090); InterPro: IPR009468 This family consists of several bacterial proteins of unknown function and is known as YqjC in Escherichia coli Back     alignment and domain information
>PF07061 Swi5: Swi5; InterPro: IPR010760 This entry represents Swi5 and is involved in meiotic DNA repair synthesis and meiotic joint molecule formation [] Back     alignment and domain information
>PF05158 RNA_pol_Rpc34: RNA polymerase Rpc34 subunit; InterPro: IPR007832 The family comprises a subunit specific to RNA Pol III, the tRNA specific polymerase Back     alignment and domain information
>COG0735 Fur Fe2+/Zn2+ uptake regulation proteins [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PRK09462 fur ferric uptake regulator; Provisional Back     alignment and domain information
>PF05008 V-SNARE: Vesicle transport v-SNARE protein N-terminus; InterPro: IPR007705 V-SNARE proteins are required for protein traffic between eukaryotic organelles Back     alignment and domain information
>PF13851 GAS: Growth-arrest specific micro-tubule binding Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10141 DNA-binding transcriptional repressor ArsR; Provisional Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD Back     alignment and domain information
>PRK06474 hypothetical protein; Provisional Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13591 MerR_2: MerR HTH family regulatory protein Back     alignment and domain information
>KOG0972|consensus Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF05557 MAD: Mitotic checkpoint protein; InterPro: IPR008672 This family consists of several eukaryotic mitotic checkpoint (Mitotic arrest deficient or MAD) proteins Back     alignment and domain information
>PRK11639 zinc uptake transcriptional repressor; Provisional Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>cd04766 HTH_HspR Helix-Turn-Helix DNA binding domain of the HspR transcription regulator Back     alignment and domain information
>PRK05431 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PF15188 CCDC-167: Coiled-coil domain-containing protein 167 Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PHA00738 putative HTH transcription regulator Back     alignment and domain information
>smart00347 HTH_MARR helix_turn_helix multiple antibiotic resistance protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query208
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-05
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 55.2 bits (132), Expect = 3e-09
 Identities = 41/271 (15%), Positives = 80/271 (29%), Gaps = 85/271 (31%)

Query: 2   SKKKGLSVEEKRTGLLELFHEKEEFFQLKLIIELEKLAPKEK--------GIISQSVKE- 52
           +    +S++     L     E +      L    + L P+E          II++S+++ 
Sbjct: 284 ATTTHISLDHHSMTLTP--DEVKSLLLKYLDCRPQDL-PREVLTTNPRRLSIIAESIRDG 340

Query: 53  -----------------ILQSLVDDGLVESEKIGTSTYFWS---FPN--KASDRVDCKL- 89
                            I++S ++  L  +E       F     FP        +   + 
Sbjct: 341 LATWDNWKHVNCDKLTTIIESSLNV-LEPAE---YRKMFDRLSVFPPSAHIPTILLSLIW 396

Query: 90  -EKITAEIEDVTKELAQNNEALEKSMVGRGDSKNRE----D-FLQEVGNISKELELINKE 143
            + I +++  V  +L +       S+V +   K         +L+    +  E  L    
Sbjct: 397 FDVIKSDVMVVVNKLHK------YSLVEK-QPKESTISIPSIYLELKVKLENEYALHRSI 449

Query: 144 LEKY---KNNDPDTLKLIEN-------------TAQRAKEAANRWTDNLFSLK----SWC 183
           ++ Y   K  D D L                    +  +         LF +      + 
Sbjct: 450 VDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLKNIEHPER------MTLFRMVFLDFRFL 503

Query: 184 KNKFGLEETALNKHFSIPEEM-------DYI 207
           + K   + TA N   SI   +        YI
Sbjct: 504 EQKIRHDSTAWNASGSILNTLQQLKFYKPYI 534
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
1p6r_A82 Penicillinase repressor; transcription regulation, 97.1
2fu4_A83 Ferric uptake regulation protein; DNA binding doma 96.28
2g9w_A138 Conserved hypothetical protein; DNA-binding domain 96.17
1ucr_A78 Protein DSVD; dissimilatory sulfite reductase D, D 95.8
2oqg_A114 Possible transcriptional regulator, ARSR family P; 95.6
2xub_A534 DNA-directed RNA polymerase III subunit RPC3; tran 95.17
1sd4_A126 Penicillinase repressor; BLAI, MECI, methicillin, 94.79
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 94.74
1okr_A123 MECI, methicillin resistance regulatory protein ME 94.65
3jth_A98 Transcription activator HLYU; transcription factor 94.59
2k4b_A99 Transcriptional regulator; DNA binding protein, wi 94.56
1q1h_A110 TFE, transcription factor E, TFE; TFIIE, transcrip 94.52
1ku9_A152 Hypothetical protein MJ223; putative transcription 94.36
2o03_A131 Probable zinc uptake regulation protein FURB; DNA- 93.98
3pqk_A102 Biofilm growth-associated repressor; helix-turn-he 93.71
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 93.57
2lw1_A89 ABC transporter ATP-binding protein UUP; ABC REG s 93.3
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 93.17
3mwm_A139 ZUR, putative metal uptake regulation protein; FUR 93.01
2fe3_A145 Peroxide operon regulator; oxidative stress regula 92.92
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 92.8
2kko_A108 Possible transcriptional regulatory protein (possi 91.73
3viq_B85 Mating-type switching protein SWI5; recombination 91.33
1mzb_A136 Ferric uptake regulation protein; ferric uptake re 91.27
1sfx_A109 Conserved hypothetical protein AF2008; structural 91.15
2w57_A150 Ferric uptake regulation protein; gene regulation, 91.09
3f6o_A118 Probable transcriptional regulator, ARSR family pr 90.85
2xig_A150 Ferric uptake regulation protein; hpfur, transcrip 90.83
1xmk_A79 Double-stranded RNA-specific adenosine deaminase; 90.47
1y0u_A96 Arsenical resistance operon repressor, putative; s 90.18
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transc 89.67
1go4_E100 MAD1 (mitotic arrest deficient)-like 1; mitotic sp 89.65
1ub9_A100 Hypothetical protein PH1061; helix-turn-helix moti 89.34
2jsc_A118 Transcriptional regulator RV1994C/MT2050; cadmium, 89.01
3g3z_A145 NMB1585, transcriptional regulator, MARR family; t 88.89
3deu_A166 Transcriptional regulator SLYA; MARR, WING-helix, 88.37
1oyi_A82 Double-stranded RNA-binding protein; (alpha+beta) 88.36
4aik_A151 Transcriptional regulator SLYA; transcription, tra 88.36
2p4w_A202 Transcriptional regulatory protein ARSR family; ar 88.28
1u2w_A122 CADC repressor, cadmium efflux system accessory pr 88.21
3f6v_A151 Possible transcriptional regulator, ARSR family pr 88.08
1tbx_A99 ORF F-93, hypothetical 11.0 kDa protein; sulfolobu 88.01
2qlz_A232 Transcription factor PF0095; 2.50A {Pyrococcus fur 87.27
3nmd_A72 CGMP dependent protein kinase; leucine zipper, coi 87.09
3tgn_A146 ADC operon repressor ADCR; helix-turn-helix, trans 87.07
3v7d_A169 Suppressor of kinetochore protein 1; WD 40 domain, 87.04
3eyy_A145 Putative iron uptake regulatory protein; NUR, nick 86.93
3cuq_B218 Vacuolar protein-sorting-associated protein 36; ES 86.46
3cuq_A234 Vacuolar-sorting protein SNF8; ESCRT, MBV, VPS, nu 86.39
2ast_A159 S-phase kinase-associated protein 1A; SCF-substrat 85.98
1fs1_B141 SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, le 85.97
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 85.5
3bpv_A138 Transcriptional regulator; MARR, DNA binding, tran 85.46
1qbj_A81 Protein (double-stranded RNA specific adenosine D 85.31
3bj6_A152 Transcriptional regulator, MARR family; helix-turn 85.3
4ets_A162 Ferric uptake regulation protein; metal binding pr 84.42
1r1t_A122 Transcriptional repressor SMTB; zinc, transcriptio 84.26
1u5t_A233 Appears to BE functionally related to SNF7; SNF8P; 84.18
3r0a_A123 Putative transcriptional regulator; structural gen 83.67
2qc0_A373 Uncharacterized protein; NP_719793.1, uncharacteri 83.06
3onj_A97 T-snare VTI1; helix, HABC, protein transport; 1.92 83.06
2a61_A145 Transcriptional regulator TM0710; APC4350, MCSG, m 82.85
2dk8_A81 DNA-directed RNA polymerase III 39 kDa polypeptide 82.36
4hbl_A149 Transcriptional regulator, MARR family; HTH, trans 82.29
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 81.61
1s3j_A155 YUSO protein; structural genomics, MARR transcript 81.59
2gxg_A146 146AA long hypothetical transcriptional regulator; 81.55
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 81.49
3f3x_A144 Transcriptional regulator, MARR family, putative; 81.28
2v4h_A110 NF-kappa-B essential modulator; transcription, met 81.19
4abx_A175 DNA repair protein RECN; DNA binding protein, ATP 80.68
2xvc_A59 ESCRT-III, SSO0910; cell cycle, cell division, cyt 80.62
3fm5_A150 Transcriptional regulator; MCSG, PF04017, PSI, MAR 80.35
3u2r_A168 Regulatory protein MARR; structural genomics, PSI- 80.2
3na7_A 256 HP0958; flagellar biogenesis, flagellum export, C4 80.11
>1p6r_A Penicillinase repressor; transcription regulation, DNA-binding, winged helix protein, bacterial resistance to antibiotics; NMR {Bacillus licheniformis} SCOP: a.4.5.39 PDB: 2p7c_B Back     alignment and structure
Probab=97.10  E-value=0.00093  Score=46.67  Aligned_cols=74  Identities=16%  Similarity=0.216  Sum_probs=62.2

Q ss_pred             CCCCCCCCHHHHHHHHHHHhhhccchhhhcchHHHHhhcccccCCccchHHHHHHHhhhcCcccccccccceeEeeccch
Q psy2296           1 MSKKKGLSVEEKRTGLLELFHEKEEFFQLKLIIELEKLAPKEKGIISQSVKEILQSLVDDGLVESEKIGTSTYFWSFPNK   80 (208)
Q Consensus         1 MskkkglS~eEKr~~il~~f~~~~~~f~lK~~~ElEK~~pK~~GI~~~~VKdvlq~LVDDglV~~EKiGtsN~YWsFps~   80 (208)
                      |++-.|||..+  ..+|.++.. ...-+..   ||-.......|+.+-||--+|..|++.|+|...+.|-..+|....+.
T Consensus         1 m~~~~~lt~~e--~~vL~~L~~-~~~~t~~---ei~~~l~~~~~~s~~Tv~~~l~rL~~kGlv~r~~~gr~~~y~~~~~~   74 (82)
T 1p6r_A            1 MKKIPQISDAE--LEVMKVIWK-HSSINTN---EVIKELSKTSTWSPKTIQTMLLRLIKKGALNHHKEGRVFVYTPNIDE   74 (82)
T ss_dssp             CCCCCCCCHHH--HHHHHHHHT-SSSEEHH---HHHHHHHHHSCCCHHHHHHHHHHHHHTTSEEEEEETTEEEEEESCSS
T ss_pred             CCccCCCCHHH--HHHHHHHHc-CCCCCHH---HHHHHHhhcCCccHHHHHHHHHHHHHCCCeEEEecCCEEEEEeecCH
Confidence            76667899876  568888887 5567999   99988876568999999999999999999999999998888765554
>2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} Back     alignment and structure
>2g9w_A Conserved hypothetical protein; DNA-binding domain, bacterial transcription repressor, DNA B protein; 1.80A {Mycobacterium tuberculosis} SCOP: a.4.5.39 Back     alignment and structure
>1ucr_A Protein DSVD; dissimilatory sulfite reductase D, DNA binding motif, sulfate-reducing bacteria, winged-helix motif, unknown function; 1.20A {Desulfovibrio vulgaris} SCOP: a.4.5.45 PDB: 1wq2_A Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>2xub_A DNA-directed RNA polymerase III subunit RPC3; transcription, winged helix; 2.80A {Homo sapiens} PDB: 2xv4_S Back     alignment and structure
>1sd4_A Penicillinase repressor; BLAI, MECI, methicillin, B-lactam, DNA binding PR; 2.00A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1xsd_A Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>1okr_A MECI, methicillin resistance regulatory protein MECI; bacterial antibiotic resistance, MECI protein, transcriptional regulatory element; 2.4A {Staphylococcus aureus} SCOP: a.4.5.39 PDB: 1sax_A 1sd7_A 2d45_A 1sd6_A Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>2k4b_A Transcriptional regulator; DNA binding protein, winged helix; NMR {Lactococcus lactis subsp} Back     alignment and structure
>1q1h_A TFE, transcription factor E, TFE; TFIIE, transcription initiation, preinitiation complex, RNA polymerase II, transcription bubble; 2.90A {Sulfolobus solfataricus} SCOP: a.4.5.41 Back     alignment and structure
>1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 Back     alignment and structure
>2o03_A Probable zinc uptake regulation protein FURB; DNA-binding, helix-turn-helix, zinc binding, GE regulation; 2.70A {Mycobacterium tuberculosis} Back     alignment and structure
>3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>2lw1_A ABC transporter ATP-binding protein UUP; ABC REG subfamily, DNA binding protein; NMR {Escherichia coli} Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>3mwm_A ZUR, putative metal uptake regulation protein; FUR, regulatory metal, graded transcription regulation, transcription; 2.40A {Streptomyces coelicolor} Back     alignment and structure
>2fe3_A Peroxide operon regulator; oxidative stress regulator, DNA binding protein; 1.75A {Bacillus subtilis} PDB: 3f8n_A 2rgv_A* Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>3viq_B Mating-type switching protein SWI5; recombination activator; 2.20A {Schizosaccharomyces pombe} PDB: 3vir_A* Back     alignment and structure
>1mzb_A Ferric uptake regulation protein; ferric uptake regulator, iron, DTXR, gene regulation; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.42 Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>2w57_A Ferric uptake regulation protein; gene regulation, transcription regulation, transport, iron, repressor, DNA-binding, transcription; 2.60A {Vibrio cholerae} Back     alignment and structure
>3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} Back     alignment and structure
>2xig_A Ferric uptake regulation protein; hpfur, transcription, homeostasis; HET: CIT; 1.85A {Helicobacter pylori} Back     alignment and structure
>1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>1go4_E MAD1 (mitotic arrest deficient)-like 1; mitotic spindle checkpoint, cell cycle, mitosis, nuclear Pro; 2.05A {Homo sapiens} SCOP: h.1.22.1 Back     alignment and structure
>1ub9_A Hypothetical protein PH1061; helix-turn-helix motif, winged helix motif, structural genom transcription; 2.05A {Pyrococcus horikoshii} SCOP: a.4.5.28 Back     alignment and structure
>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3deu_A Transcriptional regulator SLYA; MARR, WING-helix, transcription regulator, activator, DNA-binding, repressor; HET: SAL; 2.30A {Salmonella typhimurium} SCOP: a.4.5.28 Back     alignment and structure
>1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 Back     alignment and structure
>4aik_A Transcriptional regulator SLYA; transcription, transcription factor; 1.85A {Yersinia pseudotuberculosis} PDB: 4aih_A 4aij_A 3qpt_A* 3q5f_A* Back     alignment and structure
>2p4w_A Transcriptional regulatory protein ARSR family; archaea, PHR, heat shock, transcriptional regulation, winged DNA binding; 2.60A {Pyrococcus furiosus} SCOP: a.4.5.64 Back     alignment and structure
>1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A Back     alignment and structure
>3f6v_A Possible transcriptional regulator, ARSR family protein; probable transcriptional repressor ARSR family, structural genomics, PSI-2; 1.48A {Rhodococcus SP} Back     alignment and structure
>1tbx_A ORF F-93, hypothetical 11.0 kDa protein; sulfolobus spindle virus, winged helix, fusellovirus; 2.70A {Sulfolobus virus 1} SCOP: a.4.5.48 Back     alignment and structure
>2qlz_A Transcription factor PF0095; 2.50A {Pyrococcus furiosus} PDB: 2quf_A Back     alignment and structure
>3nmd_A CGMP dependent protein kinase; leucine zipper, coiled-coil, structural genomics, berkeley S genomics center, BSGC, dimerization; HET: MSE; 2.27A {Homo sapiens} Back     alignment and structure
>3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} Back     alignment and structure
>3v7d_A Suppressor of kinetochore protein 1; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_A* 3mks_A* Back     alignment and structure
>3eyy_A Putative iron uptake regulatory protein; NUR, nickel-uptake regulator, D-domain, dimerization domain, DB-domain, DNA-binding domain; 2.40A {Streptomyces coelicolor} Back     alignment and structure
>3cuq_B Vacuolar protein-sorting-associated protein 36; ESCRT, MBV, VPS, nucleus, protein transport, transc transcription regulation, transport, endosome; 2.61A {Homo sapiens} PDB: 2zme_B Back     alignment and structure
>3cuq_A Vacuolar-sorting protein SNF8; ESCRT, MBV, VPS, nucleus, protein transport, transc transcription regulation, transport, endosome; 2.61A {Homo sapiens} PDB: 2zme_A Back     alignment and structure
>1fs1_B SKP1, cyclin A/CDK2-associated P45; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.157.1.1 d.42.1.1 PDB: 1fs2_B 1ldk_D Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>4ets_A Ferric uptake regulation protein; metal binding protein, transcription factor; 2.10A {Campylobacter jejuni subsp} Back     alignment and structure
>1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A Back     alignment and structure
>1u5t_A Appears to BE functionally related to SNF7; SNF8P; ESCRT, endosomal, trafficking, protein complex, transport protein; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 PDB: 1w7p_A Back     alignment and structure
>3r0a_A Putative transcriptional regulator; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.31A {Methanosarcina mazei} Back     alignment and structure
>3onj_A T-snare VTI1; helix, HABC, protein transport; 1.92A {Saccharomyces cerevisiae} PDB: 3onl_C Back     alignment and structure
>2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>2dk8_A DNA-directed RNA polymerase III 39 kDa polypeptide; structural genomics, RNA_POL_RPC34 domain, RNA polymerase III C39 subunit, NPPSFA; NMR {Mus musculus} SCOP: a.4.5.85 Back     alignment and structure
>4hbl_A Transcriptional regulator, MARR family; HTH, transcription factor, DNA binding; 2.50A {Staphylococcus epidermidis} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>1s3j_A YUSO protein; structural genomics, MARR transcriptional regulator family, PSI, protein structure initiative; HET: MSE; 2.25A {Bacillus subtilis} SCOP: a.4.5.28 Back     alignment and structure
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3f3x_A Transcriptional regulator, MARR family, putative; DNA binding protein, DNA-binding, transcription regulation; 1.90A {Sulfolobus solfataricus} Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>4abx_A DNA repair protein RECN; DNA binding protein, ATP binding protein, double break repair, coiled-coil; HET: DNA; 2.04A {Deinococcus radiodurans} Back     alignment and structure
>2xvc_A ESCRT-III, SSO0910; cell cycle, cell division, cytokinesis, winged-helix; 2.15A {Sulfolobus solfataricus} Back     alignment and structure
>3fm5_A Transcriptional regulator; MCSG, PF04017, PSI, MARR, structu genomics, protein structure initiative, midwest center for structural genomics; HET: GOL; 2.00A {Rhodococcus jostii} Back     alignment and structure
>3u2r_A Regulatory protein MARR; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, helix-turn-helix; 2.20A {Planctomyces limnophilus} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query208
d2g9wa1122 Hypothetical protein Rv1846c {Mycobacterium tuberc 97.44
d2d1ha1109 Hypothetical transcriptional regulator ST1889 {Sul 95.59
d1p6ra_82 Penicillinase repressor BlaI {Bacillus licheniform 95.35
d1sd4a_122 Penicillinase repressor BlaI {Staphylococcus aureu 94.88
d1ku9a_151 DNA-binding protein Mj223 {Archaeon Methanococcus 94.75
d1ucra_74 Dissimilatory sulfite reductase DsvD {Desulfovibri 94.21
d1okra_120 Methicillin resistance regulatory protein MecI {St 93.96
d1u5ta268 Vacuolar sorting protein SNF8 {Baker's yeast (Sacc 93.38
d1r1ta_98 SmtB repressor {Cyanobacteria (Synechococcus), pcc 92.62
d1ub9a_100 Hypothetical protein PH1061 {Archaeon Pyrococcus h 91.61
d1r1ua_94 Metal-sensing transcriptional repressor CzrA {Stap 91.44
d1u2wa1108 Cadmium efflux system accessory protein CadC {Stap 91.23
d1nexa170 Centromere DNA-binding protein complex Cbf3 subuni 91.22
d1mzba_134 Ferric uptake regulation protein, FUR {Pseudomonas 91.09
d1ulya_190 Hypothetical protein PH1932 {Pyrococcus horikoshii 89.2
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 89.2
d1dpua_69 C-terminal domain of RPA32 {Human (Homo sapiens) [ 89.03
d1seta1110 Seryl-tRNA synthetase (SerRS) {Thermus thermophilu 88.43
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidu 85.77
d1q1ha_88 Transcription factor E/IIe-alpha, N-terminal domai 85.54
d1z6ra170 Mlc protein N-terminal domain {Escherichia coli [T 83.64
d1mkma175 Transcriptional regulator IclR, N-terminal domain 82.21
d1r7ja_90 Sso10a (SSO10449) {Archaeon Sulfolobus solfataricu 82.09
d2p4wa1194 Transcriptional regulatory protein PF1790 {Pyrococ 82.06
d1j5ya165 Putative transcriptional regulator TM1602, N-termi 81.99
>d2g9wa1 a.4.5.39 (A:3-124) Hypothetical protein Rv1846c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: Penicillinase repressor
domain: Hypothetical protein Rv1846c
species: Mycobacterium tuberculosis [TaxId: 1773]

Probab=97.44  E-value=0.00085  Score=49.34  Aligned_cols=66  Identities=11%  Similarity=0.203  Sum_probs=57.9

Q ss_pred             HHHHHHhhhccchhhhcchHHHHhhcccccCCccchHHHHHHHhhhcCcccccccccceeEeeccchhh
Q psy2296          14 TGLLELFHEKEEFFQLKLIIELEKLAPKEKGIISQSVKEILQSLVDDGLVESEKIGTSTYFWSFPNKAS   82 (208)
Q Consensus        14 ~~il~~f~~~~~~f~lK~~~ElEK~~pK~~GI~~~~VKdvlq~LVDDglV~~EKiGtsN~YWsFps~~~   82 (208)
                      ..||+++-......+.+   ||-...|..+|+...||.=+|..|++-|+|..++.|...+|++.-+...
T Consensus        10 ~~IM~~lW~~g~~~t~~---eI~~~l~~~~~~~~sTV~T~L~rL~~Kg~l~~~~~gr~~~Y~~~i~~e~   75 (122)
T d2g9wa1          10 RAVMDHLWSRTEPQTVR---QVHEALSARRDLAYTTVMAVLQRLAKKNLVLQIRDDRAHRYAPVHGRDE   75 (122)
T ss_dssp             HHHHHHHHTCSSCEEHH---HHHHHHTTTCCCCHHHHHHHHHHHHHTTSEEEEC---CCEEEESSCHHH
T ss_pred             HHHHHHHHcCCCCccHH---HHHHHHhccCCCcHHHHHHHHHHHHHCCCEEEeecCCeEEEEeCCCHHH
Confidence            56899999988889999   9999999878999999999999999999999999999999999988643
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1p6ra_ a.4.5.39 (A:) Penicillinase repressor BlaI {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1sd4a_ a.4.5.39 (A:) Penicillinase repressor BlaI {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1ku9a_ a.4.5.36 (A:) DNA-binding protein Mj223 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ucra_ a.4.5.45 (A:) Dissimilatory sulfite reductase DsvD {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1okra_ a.4.5.39 (A:) Methicillin resistance regulatory protein MecI {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1u5ta2 a.4.5.54 (A:165-232) Vacuolar sorting protein SNF8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r1ta_ a.4.5.5 (A:) SmtB repressor {Cyanobacteria (Synechococcus), pcc7942 [TaxId: 1129]} Back     information, alignment and structure
>d1ub9a_ a.4.5.28 (A:) Hypothetical protein PH1061 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1r1ua_ a.4.5.5 (A:) Metal-sensing transcriptional repressor CzrA {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1u2wa1 a.4.5.5 (A:12-119) Cadmium efflux system accessory protein CadC {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mzba_ a.4.5.42 (A:) Ferric uptake regulation protein, FUR {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ulya_ a.4.5.58 (A:) Hypothetical protein PH1932 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1dpua_ a.4.5.16 (A:) C-terminal domain of RPA32 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1seta1 a.2.7.1 (A:1-110) Seryl-tRNA synthetase (SerRS) {Thermus thermophilus, strain hb27 [TaxId: 274]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1q1ha_ a.4.5.41 (A:) Transcription factor E/IIe-alpha, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1r7ja_ a.4.5.49 (A:) Sso10a (SSO10449) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2p4wa1 a.4.5.64 (A:1-194) Transcriptional regulatory protein PF1790 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure