Psyllid ID: psy2326

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-
ITSKCKDIRWHFIGHLQSNKVPKVIKVPNLEYIETIHDTRLATQVNNAWAKHQPDKKLKVFCQINTSGEENKHGAHPEHAEALVSHVINSCPNLEFTDKHGAHPEHAEALVSHVINSCPNLEFTGLMTIGKYGYDTKHGPNPDFLELAKCRKDVCKKLNLNESNVELSMGMSSDLRERESS
cccccccccEEEEccccccHHHHHcccccEEEEEEccHHHHHHHHHHHHHHcccccccEEEEEEEcccccccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHcccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHHcccccccEEEccccccHHHHHcc
ccccccccEEEEEcccccccccHHEEcccccEEEEccHHHHHHHHHHHHHHHccccccEEEEEEEcccccccccccHHHHHHHHHHHHHHccccEEccccccHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHccccccccEEEccccHHHHHHHHc
ITSKCKDIRWHFighlqsnkvpkvikvpnleyieTIHDTRLATQVnnawakhqpdkkLKVFCQINtsgeenkhgahpeHAEALVSHVInscpnleftdkhgahpeHAEALVSHVInscpnleftglmtigkygydtkhgpnpdflELAKCRKDVCKKLNLNESNVELSMgmssdlreress
itskckdirwhfighlqsnkvpkviKVPNLEYIETIHDTRLATQVNNawakhqpdkKLKVFCQINTSGEENKHGAHPEHAEALVSHVINSCPNLEFTDKHGAHPEHAEALVSHVINSCPNLEFTGLMTIGKYGYDTKHGPNPDFLELAKCRKDVCKKlnlnesnvelsmgmssdlreress
ITSKCKDIRWHFIGHLQSNKVPKVIKVPNLEYIETIHDTRLATQVNNAWAKHQPDKKLKVFCQINTSGEENKHGAHPEHAEALVSHVINSCPNLEFTDKHGAHPEHAEALVSHVINSCPNLEFTGLMTIGKYGYDTKHGPNPDFLELAKCRKDVCKKLNLNESNVELSMGMSSDLRERESS
****CKDIRWHFIGHLQSNKVPKVIKVPNLEYIETIHDTRLATQVNNAWAKHQPDKKLKVFCQIN****************ALVSHVINSCPNLEFTDKHGAHPEHAEALVSHVINSCPNLEFTGLMTIGKYGYDTKHGPNPDFLELAKCRKDVCKKLNL*********************
**SKCKDIRWHFIGHLQSNKVPKVIKVPNLEYIETIHDTRLATQVNNAWAKHQPDKKLKVFCQINTSGEENKHGAHPEHAEALVSHVINSCPNLEFTDKHGAHPEHAEALVSHVINSCPNLEFTGLMTIGKYGYDTKHGPNPDFLELAKCRKDVCKKLNLNESNVELSMGMSSDLRERESS
ITSKCKDIRWHFIGHLQSNKVPKVIKVPNLEYIETIHDTRLATQVNNAWAKHQPDKKLKVFCQINTSGEENKHGAHPEHAEALVSHVINSCPNLEFTDKHGAHPEHAEALVSHVINSCPNLEFTGLMTIGKYGYDTKHGPNPDFLELAKCRKDVCKKLNLNESNVELS*************
*TSKCKDIRWHFIGHLQSNKVPKVIKVPNLEYIETIHDTRLATQVNNAWAKHQPDKKLKVFCQINTSGEENKHGAHPEHAEALVSHVINSCPNLEFTDKHGAHPEHAEALVSHVINSCPNLEFTGLMTIGKYGYDTKHGPNPDFLELAKCRKDVCKKLNLNESNVELSMGMSSDLRERESS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ITSKCKDIRWHFIGHLQSNKVPKVIKVPNLEYIETIHDTRLATQVNNAWAKHQPDKKLKVFCQINTSGEENKHGAHPEHAEALVSHVINSCPNLEFTDKHGAHPEHAEALVSHVINSCPNLEFTGLMTIGKYGYDTKHGPNPDFLELAKCRKDVCKKLNLNESNVELSMGMSSDLRERESS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query181 2.2.26 [Sep-21-2011]
Q9Z2Y8274 Proline synthase co-trans yes N/A 0.823 0.543 0.443 4e-39
O94903275 Proline synthase co-trans yes N/A 0.823 0.541 0.448 7e-39
Q3T0G5273 Proline synthase co-trans yes N/A 0.823 0.545 0.443 5e-38
Q5R4Z1275 Proline synthase co-trans yes N/A 0.823 0.541 0.448 1e-37
P52057244 Proline synthase co-trans yes N/A 0.812 0.602 0.378 6e-25
P38197257 UPF0001 protein YBL036C O yes N/A 0.773 0.544 0.352 6e-17
Q9P6Q1237 UPF0001 protein C644.09 O yes N/A 0.745 0.569 0.363 7e-17
Q1ZXI6255 Proline synthase co-trans yes N/A 0.773 0.549 0.313 5e-16
Q9KUQ4236 UPF0001 protein VC_0461 O yes N/A 0.734 0.563 0.284 3e-09
O66631228 UPF0001 protein aq_274 OS yes N/A 0.740 0.587 0.272 7e-08
>sp|Q9Z2Y8|PROSC_MOUSE Proline synthase co-transcribed bacterial homolog protein OS=Mus musculus GN=Prosc PE=1 SV=1 Back     alignment and function desciption
 Score =  160 bits (405), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 78/176 (44%), Positives = 102/176 (57%), Gaps = 27/176 (15%)

Query: 1   ITSKCKDIRWHFIGHLQSNKVPKVIKVPNLEYIETIHDTRLATQVNNAWAKHQPDKKLKV 60
           I S C +I+WHFIGHLQ   V K++ VPNL  +ET+   +LA +VN++W K  P + LKV
Sbjct: 82  ILSSCPEIKWHFIGHLQKQNVNKLMAVPNLSMLETVDSVKLADKVNSSWQKKGPTEPLKV 141

Query: 61  FCQINTSGEENKHGAHPEHAEALVSHVINSCPNLEFTDKHGAHPEHAEALVSHVINSCPN 120
             QINTSGE++KHG  P    A+V H+  SC                           P+
Sbjct: 142 MVQINTSGEDSKHGLLPSETIAVVEHIKASC---------------------------PS 174

Query: 121 LEFTGLMTIGKYGYDTKHGPNPDFLELAKCRKDVCKKLNLNESNVELSMGMSSDLR 176
           LEF GLMTIG +G+D   GPNPDF  L   R+++C+KL +    VELSMGMS D +
Sbjct: 175 LEFVGLMTIGSFGHDLSQGPNPDFQRLLTLRRELCEKLGIPVEQVELSMGMSMDFQ 230

Mus musculus (taxid: 10090)
>sp|O94903|PROSC_HUMAN Proline synthase co-transcribed bacterial homolog protein OS=Homo sapiens GN=PROSC PE=1 SV=1 Back     alignment and function description
>sp|Q3T0G5|PROSC_BOVIN Proline synthase co-transcribed bacterial homolog protein OS=Bos taurus GN=PROSC PE=2 SV=1 Back     alignment and function description
>sp|Q5R4Z1|PROSC_PONAB Proline synthase co-transcribed bacterial homolog protein OS=Pongo abelii GN=PROSC PE=2 SV=1 Back     alignment and function description
>sp|P52057|PROSC_CAEEL Proline synthase co-transcribed bacterial homolog protein OS=Caenorhabditis elegans GN=F09E5.8 PE=3 SV=1 Back     alignment and function description
>sp|P38197|YBD6_YEAST UPF0001 protein YBL036C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBL036C PE=1 SV=1 Back     alignment and function description
>sp|Q9P6Q1|YKC9_SCHPO UPF0001 protein C644.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC644.09 PE=3 SV=1 Back     alignment and function description
>sp|Q1ZXI6|PROSC_DICDI Proline synthase co-transcribed bacterial homolog protein OS=Dictyostelium discoideum GN=prosc PE=3 SV=2 Back     alignment and function description
>sp|Q9KUQ4|Y461_VIBCH UPF0001 protein VC_0461 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=VC_0461 PE=3 SV=1 Back     alignment and function description
>sp|O66631|Y274_AQUAE UPF0001 protein aq_274 OS=Aquifex aeolicus (strain VF5) GN=aq_274 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query181
357605973242 proline synthetase co-transcribed bacter 0.817 0.611 0.488 5e-41
224080861276 PREDICTED: proline synthase co-transcrib 0.823 0.539 0.482 8e-40
114051511262 proline synthetase co-transcribed bacter 0.817 0.564 0.454 9e-39
118101365276 PREDICTED: proline synthase co-transcrib 0.823 0.539 0.471 2e-38
270013195248 hypothetical protein TcasGA2_TC011768 [T 0.801 0.584 0.485 3e-38
307202202248 Proline synthetase co-transcribed bacter 0.779 0.568 0.482 3e-38
345491690249 PREDICTED: proline synthase co-transcrib 0.812 0.590 0.460 3e-38
326932746215 PREDICTED: proline synthase co-transcrib 0.823 0.693 0.471 3e-38
91090970 292 PREDICTED: similar to proline synthetase 0.801 0.496 0.485 3e-38
431902264269 Proline synthetase co-transcribed bacter 0.823 0.553 0.448 4e-38
>gi|357605973|gb|EHJ64853.1| proline synthetase co-transcribed bacterial-like protein [Danaus plexippus] Back     alignment and taxonomy information
 Score =  172 bits (436), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 86/176 (48%), Positives = 107/176 (60%), Gaps = 28/176 (15%)

Query: 1   ITSKCKDIRWHFIGHLQSNKVPKVIKVPNLEYIETIHDTRLATQVNNAWAKH-QPDKKLK 59
           I  KCKDI WHFIGHLQ+NK+ +++  P L  +ET+H  +LA  +N  W K+ + D+KLK
Sbjct: 69  ILEKCKDIHWHFIGHLQTNKINRLLGSPGLYMVETVHSQKLADNLNKQWPKYMKADEKLK 128

Query: 60  VFCQINTSGEENKHGAHPEHAEALVSHVINSCPNLEFTDKHGAHPEHAEALVSHVINSCP 119
           V  Q+NTSGE+ K G  P  A +LV HVI                            +C 
Sbjct: 129 VMVQVNTSGEDVKSGVEPAQAVSLVEHVI---------------------------KNCE 161

Query: 120 NLEFTGLMTIGKYGYDTKHGPNPDFLELAKCRKDVCKKLNLNESNVELSMGMSSDL 175
           NL+F GLMTIG+Y YD   GPNPDFL LA CR +VC+KL LN  +VELSMGMSSD 
Sbjct: 162 NLDFKGLMTIGQYDYDITKGPNPDFLTLASCRNEVCEKLRLNIKDVELSMGMSSDF 217

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|224080861|ref|XP_002193974.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein [Taeniopygia guttata] Back     alignment and taxonomy information
>gi|114051511|ref|NP_001040304.1| proline synthetase co-transcribed bacterial-like protein [Bombyx mori] gi|87248205|gb|ABD36155.1| proline synthetase co-transcribed bacterial-like protein [Bombyx mori] Back     alignment and taxonomy information
>gi|118101365|ref|XP_424381.2| PREDICTED: proline synthase co-transcribed bacterial homolog protein [Gallus gallus] Back     alignment and taxonomy information
>gi|270013195|gb|EFA09643.1| hypothetical protein TcasGA2_TC011768 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307202202|gb|EFN81689.1| Proline synthetase co-transcribed bacterial-like protein protein [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|345491690|ref|XP_001607241.2| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|326932746|ref|XP_003212474.1| PREDICTED: proline synthase co-transcribed bacterial homolog protein-like [Meleagris gallopavo] Back     alignment and taxonomy information
>gi|91090970|ref|XP_974705.1| PREDICTED: similar to proline synthetase co-transcribed bacterial-like protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|431902264|gb|ELK08765.1| Proline synthetase co-transcribed bacterial like protein [Pteropus alecto] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query181
UNIPROTKB|E1C516276 PROSC "Uncharacterized protein 0.679 0.445 0.449 1.4e-25
MGI|MGI:1891207274 Prosc "proline synthetase co-t 0.679 0.448 0.441 1.2e-24
UNIPROTKB|Q3T0G5273 PROSC "Proline synthase co-tra 0.944 0.626 0.373 1.6e-24
RGD|1308962275 Prosc "proline synthetase co-t 0.530 0.349 0.520 3.3e-24
UNIPROTKB|F1RX84275 PROSC "Uncharacterized protein 0.944 0.621 0.368 1.1e-23
UNIPROTKB|O94903275 PROSC "Proline synthase co-tra 0.530 0.349 0.510 1.8e-23
UNIPROTKB|E5RFX7137 PROSC "Proline synthase co-tra 0.530 0.700 0.510 1.8e-23
FB|FBgn0039751254 CG1983 [Drosophila melanogaste 0.519 0.370 0.479 4.9e-21
SGD|S000000132257 YBL036C "Putative non-specific 0.392 0.276 0.486 1.7e-20
TAIR|locus:2008910257 AT1G11930 [Arabidopsis thalian 0.502 0.354 0.462 4.1e-17
UNIPROTKB|E1C516 PROSC "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 290 (107.1 bits), Expect = 1.4e-25, P = 1.4e-25
 Identities = 58/129 (44%), Positives = 81/129 (62%)

Query:     1 ITSKCKDIRWHFIGHLQSNKVPKVIKVPNLEYIETIHDTRLATQVNNAWAKHQPDKKLKV 60
             I S C +I+WHFIGHLQ + V K+I VPNL  +ET+   +LA +VN++W K    +KLKV
Sbjct:    81 ILSSCPEIKWHFIGHLQKSNVNKLIAVPNLFMLETVDSVKLADRVNSSWQKKGSPQKLKV 140

Query:    61 FCQINTSGEENKHGAHPEHAEALVSHVINSCPNLEFTDKHGAHPEHAEALVSHVINSCPN 120
               Q+NTSGE++KHG  P    A V HVIN CP+LEF    G     +   + H ++  PN
Sbjct:   141 MVQVNTSGEDSKHGLPPRDTTAAVEHVINKCPSLEFV---GLMTIGS---IGHDLSKGPN 194

Query:   121 LEFTGLMTI 129
              +F  L+++
Sbjct:   195 PDFQVLLSL 203
GO:0005739 "mitochondrion" evidence=IEA
MGI|MGI:1891207 Prosc "proline synthetase co-transcribed" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0G5 PROSC "Proline synthase co-transcribed bacterial homolog protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|1308962 Prosc "proline synthetase co-transcribed homolog (bacterial)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RX84 PROSC "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|O94903 PROSC "Proline synthase co-transcribed bacterial homolog protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E5RFX7 PROSC "Proline synthase co-transcribed bacterial homolog protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0039751 CG1983 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
SGD|S000000132 YBL036C "Putative non-specific single-domain racemase" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
TAIR|locus:2008910 AT1G11930 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P52057PROSC_CAEELNo assigned EC number0.37850.81210.6024yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
cd06822227 cd06822, PLPDE_III_YBL036c_euk, Pyridoxal 5-phosph 2e-73
cd00635222 cd00635, PLPDE_III_YBL036c_like, Type III Pyridoxa 1e-36
COG0325228 COG0325, COG0325, Predicted enzyme with a TIM-barr 5e-32
cd06824224 cd06824, PLPDE_III_Yggs_like, Pyridoxal 5-phosphat 2e-23
TIGR00044229 TIGR00044, TIGR00044, pyridoxal phosphate enzyme, 1e-18
pfam01168217 pfam01168, Ala_racemase_N, Alanine racemase, N-ter 2e-11
cd06808211 cd06808, PLPDE_III, Type III Pyridoxal 5-phosphate 6e-04
>gnl|CDD|143496 cd06822, PLPDE_III_YBL036c_euk, Pyridoxal 5-phosphate (PLP)-binding TIM barrel domain of Type III PLP-Dependent Enzymes, Eukaryotic YBL036c-like proteins Back     alignment and domain information 
 Score =  220 bits (562), Expect = 2e-73
 Identities = 84/169 (49%), Positives = 106/169 (62%), Gaps = 27/169 (15%)

Query: 6   KDIRWHFIGHLQSNKVPKVIKVPNLEYIETIHDTRLATQVNNAWAKHQPDKKLKVFCQIN 65
            DI+WHFIGHLQSNKV K++KVPNL  +ET+   +LA ++N AW K    + LKV  Q+N
Sbjct: 66  IDIKWHFIGHLQSNKVKKLLKVPNLYMVETVDSEKLADKLNKAWEKLGEREPLKVMVQVN 125

Query: 66  TSGEENKHGAHPEHAEALVSHVINSCPNLEFTDKHGAHPEHAEALVSHVINSCPNLEFTG 125
           TSGEE+K G   E +EA+                          LV H+I  CPNL+F+G
Sbjct: 126 TSGEESKSGL--EPSEAV-------------------------ELVKHIIEECPNLKFSG 158

Query: 126 LMTIGKYGYDTKHGPNPDFLELAKCRKDVCKKLNLNESNVELSMGMSSD 174
           LMTIG +GY    GPNPDFL L  CRK VC+KL +N  ++ELSMGMS+D
Sbjct: 159 LMTIGSFGYSLSSGPNPDFLCLVDCRKKVCEKLGINPDDLELSMGMSAD 207

This subfamily contains mostly uncharacterized eukaryotic proteins with similarity to the yeast hypothetical protein YBL036c, which is homologous to a Pseudomonas aeruginosa gene that is co-transcribed with a known proline biosynthetic gene. YBL036c is a single domain monomeric protein with a typical TIM barrel fold. It binds the PLP cofactor and has been shown to exhibit amino acid racemase activity. The YBL036c structure is similar to the N-terminal domain of the fold type III PLP-dependent enzymes, bacterial alanine racemase and eukaryotic ornithine decarboxylase, which are two-domain dimeric proteins. The lack of a second domain in YBL036c may explain limited D- to L-alanine racemase or non-specific racemase activity. Some members of this subfamily are also referred to as PROSC (Proline synthetase co-transcribed bacterial homolog). Length = 227
>gnl|CDD|143483 cd00635, PLPDE_III_YBL036c_like, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, YBL036c-like proteins Back     alignment and domain information
>gnl|CDD|223402 COG0325, COG0325, Predicted enzyme with a TIM-barrel fold [General function prediction only] Back     alignment and domain information
>gnl|CDD|143497 cd06824, PLPDE_III_Yggs_like, Pyridoxal 5-phosphate (PLP)-binding TIM barrel domain of Type III PLP-Dependent Enzymes, Yggs-like proteins Back     alignment and domain information
>gnl|CDD|129155 TIGR00044, TIGR00044, pyridoxal phosphate enzyme, YggS family Back     alignment and domain information
>gnl|CDD|216340 pfam01168, Ala_racemase_N, Alanine racemase, N-terminal domain Back     alignment and domain information
>gnl|CDD|143484 cd06808, PLPDE_III, Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 181
KOG3157|consensus244 100.0
COG0325228 Predicted enzyme with a TIM-barrel fold [General f 100.0
cd06822227 PLPDE_III_YBL036c_euk Pyridoxal 5-phosphate (PLP)- 100.0
TIGR00044229 pyridoxal phosphate enzyme, YggS family. Members o 99.97
cd06824224 PLPDE_III_Yggs_like Pyridoxal 5-phosphate (PLP)-bi 99.9
cd00635222 PLPDE_III_YBL036c_like Type III Pyridoxal 5-phosph 99.87
PF01168218 Ala_racemase_N: Alanine racemase, N-terminal domai 99.79
cd06821 361 PLPDE_III_D-TA Type III Pyridoxal 5-phosphate (PLP 99.67
cd06820 353 PLPDE_III_LS_D-TA_like Type III Pyridoxal 5-phosph 99.64
cd06818 382 PLPDE_III_cryptic_DSD Type III Pyridoxal 5-phospha 99.63
cd06815 353 PLPDE_III_AR_like_1 Type III Pyridoxal 5-phosphate 99.63
cd00430 367 PLPDE_III_AR Type III Pyridoxal 5-phosphate (PLP)- 99.58
cd06808211 PLPDE_III Type III Pyridoxal 5-phosphate (PLP)-Dep 99.5
TIGR00492 367 alr alanine racemase. This enzyme interconverts L- 99.49
cd06819 358 PLPDE_III_LS_D-TA Type III Pyridoxal 5-phosphate ( 99.42
cd07376 345 PLPDE_III_DSD_D-TA_like Type III Pyridoxal 5-phosp 99.41
cd06811 382 PLPDE_III_yhfX_like Type III Pyridoxal 5-phosphate 99.38
cd06810 368 PLPDE_III_ODC_DapDC_like Type III Pyridoxal 5-phos 99.2
cd06817 389 PLPDE_III_DSD Type III Pyridoxal 5-phosphate (PLP) 99.18
PRK13340 406 alanine racemase; Reviewed 99.17
PRK00053 363 alr alanine racemase; Reviewed 99.14
cd06839 382 PLPDE_III_Btrk_like Type III Pyridoxal 5-phosphate 99.02
cd06814 379 PLPDE_III_DSD_D-TA_like_3 Type III Pyridoxal 5-pho 99.0
TIGR01048 417 lysA diaminopimelate decarboxylase. This family co 98.88
cd06828 373 PLPDE_III_DapDC Type III Pyridoxal 5-phosphate (PL 98.88
cd06812 374 PLPDE_III_DSD_D-TA_like_1 Type III Pyridoxal 5-pho 98.81
COG3616 368 Predicted amino acid aldolase or racemase [Amino a 98.78
cd06843 377 PLPDE_III_PvsE_like Type III Pyridoxal 5-phosphate 98.69
PLN02537 410 diaminopimelate decarboxylase 98.65
cd06842 423 PLPDE_III_Y4yA_like Type III Pyridoxal 5-phosphate 98.57
cd06826 365 PLPDE_III_AR2 Type III Pyridoxal 5-phosphate (PLP) 98.44
cd06813 388 PLPDE_III_DSD_D-TA_like_2 Type III Pyridoxal 5-pho 98.4
cd06825 368 PLPDE_III_VanT Type III Pyridoxal 5-phosphate (PLP 98.39
cd06827 354 PLPDE_III_AR_proteobact Type III Pyridoxal 5-phosp 98.32
PRK11930 822 putative bifunctional UDP-N-acetylmuramoyl-tripept 98.3
PRK03646 355 dadX alanine racemase; Reviewed 98.21
TIGR03099 398 dCO2ase_PEP1 pyridoxal-dependent decarboxylase, ex 98.19
cd06841 379 PLPDE_III_MccE_like Type III Pyridoxal 5-phosphate 98.05
COG3457 353 Predicted amino acid racemase [Amino acid transpor 97.73
cd06830 409 PLPDE_III_ADC Type III Pyridoxal 5-phosphate (PLP) 97.69
COG0019 394 LysA Diaminopimelate decarboxylase [Amino acid tra 97.69
PF02784251 Orn_Arg_deC_N: Pyridoxal-dependent decarboxylase, 97.59
cd00622 362 PLPDE_III_ODC Type III Pyridoxal 5-phosphate (PLP) 97.46
COG0787 360 Alr Alanine racemase [Cell envelope biogenesis, ou 97.38
PRK11165 420 diaminopimelate decarboxylase; Provisional 97.22
cd06836 379 PLPDE_III_ODC_DapDC_like_1 Type III Pyridoxal 5-ph 97.03
PLN02439 559 arginine decarboxylase 96.96
PRK05354 634 arginine decarboxylase; Provisional 96.75
TIGR01273 624 speA arginine decarboxylase, biosynthetic. A disti 96.66
cd06831 394 PLPDE_III_ODC_like_AZI Type III Pyridoxal 5-phosph 96.09
TIGR01047 380 nspC carboxynorspermidine decarboxylase. This prot 95.87
cd06840 368 PLPDE_III_Bif_AspK_DapDC Type III Pyridoxal 5-phos 95.47
PRK08961 861 bifunctional aspartate kinase/diaminopimelate deca 95.35
KOG0622|consensus 448 90.87
cd06829346 PLPDE_III_CANSDC Type III Pyridoxal 5-phosphate (P 90.03
>KOG3157|consensus Back     alignment and domain information 
Probab=100.00  E-value=7.4e-52  Score=348.93  Aligned_cols=148  Identities=49%  Similarity=0.845  Sum_probs=142.5

Q ss_pred             CCceeeeecccccccHHhhhcCCCccEEEEeccHHHHHHHHHHHHhcCCCCCceEEEEEeCCCCCccCCCCccchhhhhh
Q psy2326           6 KDIRWHFIGHLQSNKVPKVIKVPNLEYIETIHDTRLATQVNNAWAKHQPDKKLKVFCQINTSGEENKHGAHPEHAEALVS   85 (181)
Q Consensus         6 ~di~WHfIG~LQsNKvk~l~~~~~~~~I~sVDs~~lA~~L~~~~~~~~~~~~l~VliQVN~s~E~~K~Gv~p~~~~~~~~   85 (181)
                      +||+|||||||||||+|+|+.+||+++|+|||+.|+|+.|+++|++.+++.||+||||||||||++|+|+.|.++.    
T Consensus        74 ~DI~WHFIG~lQsnK~kkl~svpnL~~vetVDseK~A~~ld~a~~k~g~~~PL~V~VQvNTSGEd~K~Giepse~~----  149 (244)
T KOG3157|consen   74 DDIKWHFIGHLQSNKCKKLLSVPNLYSVETVDSEKKARKLDSAWSKLGPDNPLKVLVQVNTSGEDSKSGIEPSEAP----  149 (244)
T ss_pred             ccceeeeechhhhcccchhccCCceEEEEecchHHHHHHHHHHHHhcCCCCCeEEEEEeecCCccccCCCChhhhH----
Confidence            5899999999999999999999999999999999999999999999998889999999999999999999999999    


Q ss_pred             hhccCCCCCcccCCCCCCchhHHHHHHHHHhhCCCceEeeeeecCCCCCCCCCCccHHHHHHHHHHHHHHHhcCCCCCCC
Q psy2326          86 HVINSCPNLEFTDKHGAHPEHAEALVSHVINSCPNLEFTGLMTIGKYGYDTKHGPNPDFLELAKCRKDVCKKLNLNESNV  165 (181)
Q Consensus        86 ~~~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~~p~L~l~GLMTi~~~~~d~~~~~~~~F~~L~~l~~~l~~~~~~~~~~~  165 (181)
                                             +|+++|..+|+||+|.||||||.++++...+.||+|+.|.++|+.+++++|++++-.
T Consensus       150 -----------------------~l~~~i~~~c~nL~f~GlMTIGs~~~s~ss~eNpDF~~L~~~r~~ic~~lg~~~dq~  206 (244)
T KOG3157|consen  150 -----------------------ELAEHIKSECKNLKFSGLMTIGSFDNSHSSGENPDFQVLVKLRESICKKLGIPADQV  206 (244)
T ss_pred             -----------------------HHHHHHHHhCCcceeeeeEEeccccccccCCCCccHHHHHHHHHHHHHHhCCChHHh
Confidence                                   999999888999999999999999998666889999999999999999999987789


Q ss_pred             EEeeCCcchHHHHhc
Q psy2326         166 ELSMGMSSDLRERES  180 (181)
Q Consensus       166 ~LSMGMS~D~~~AI~  180 (181)
                      +||||||+||+.||+
T Consensus       207 eLSMGMS~DF~~AIe  221 (244)
T KOG3157|consen  207 ELSMGMSADFLLAIE  221 (244)
T ss_pred             hhhcccchhHHHHHH
Confidence            999999999999997

>COG0325 Predicted enzyme with a TIM-barrel fold [General function prediction only] Back     alignment and domain information
>cd06822 PLPDE_III_YBL036c_euk Pyridoxal 5-phosphate (PLP)-binding TIM barrel domain of Type III PLP-Dependent Enzymes, Eukaryotic YBL036c-like proteins Back     alignment and domain information
>TIGR00044 pyridoxal phosphate enzyme, YggS family Back     alignment and domain information
>cd06824 PLPDE_III_Yggs_like Pyridoxal 5-phosphate (PLP)-binding TIM barrel domain of Type III PLP-Dependent Enzymes, Yggs-like proteins Back     alignment and domain information
>cd00635 PLPDE_III_YBL036c_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, YBL036c-like proteins Back     alignment and domain information
>PF01168 Ala_racemase_N: Alanine racemase, N-terminal domain; InterPro: IPR001608 Alanine racemase plays a role in providing the D-alanine required for cell wall biosynthesis by isomerising L-alanine to D-alanine Back     alignment and domain information
>cd06821 PLPDE_III_D-TA Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme D-Threonine Aldolase Back     alignment and domain information
>cd06820 PLPDE_III_LS_D-TA_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Low Specificity D-Threonine Aldolase-like Back     alignment and domain information
>cd06818 PLPDE_III_cryptic_DSD Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Bacterial Cryptic D-Serine Dehydratase Back     alignment and domain information
>cd06815 PLPDE_III_AR_like_1 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Alanine Racemase-like 1 Back     alignment and domain information
>cd00430 PLPDE_III_AR Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Alanine Racemase Back     alignment and domain information
>cd06808 PLPDE_III Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Back     alignment and domain information
>TIGR00492 alr alanine racemase Back     alignment and domain information
>cd06819 PLPDE_III_LS_D-TA Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Low Specificity D-Threonine Aldolase Back     alignment and domain information
>cd07376 PLPDE_III_DSD_D-TA_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Similar to D-Serine Dehydratase and D-Threonine Aldolase Back     alignment and domain information
>cd06811 PLPDE_III_yhfX_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme yhfX Back     alignment and domain information
>cd06810 PLPDE_III_ODC_DapDC_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Ornithine and Diaminopimelate Decarboxylases, and Related Enzymes Back     alignment and domain information
>cd06817 PLPDE_III_DSD Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Eukaryotic D-Serine Dehydratase Back     alignment and domain information
>PRK13340 alanine racemase; Reviewed Back     alignment and domain information
>PRK00053 alr alanine racemase; Reviewed Back     alignment and domain information
>cd06839 PLPDE_III_Btrk_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Btrk Decarboxylase Back     alignment and domain information
>cd06814 PLPDE_III_DSD_D-TA_like_3 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Similar to D-Serine Dehydratase and D-Threonine Aldolase, Unknown Group 3 Back     alignment and domain information
>TIGR01048 lysA diaminopimelate decarboxylase Back     alignment and domain information
>cd06828 PLPDE_III_DapDC Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Diaminopimelate Decarboxylase Back     alignment and domain information
>cd06812 PLPDE_III_DSD_D-TA_like_1 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Similar to D-Serine Dehydratase and D-Threonine Aldolase, Unknown Group 1 Back     alignment and domain information
>COG3616 Predicted amino acid aldolase or racemase [Amino acid transport and metabolism] Back     alignment and domain information
>cd06843 PLPDE_III_PvsE_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme PvsE Back     alignment and domain information
>PLN02537 diaminopimelate decarboxylase Back     alignment and domain information
>cd06842 PLPDE_III_Y4yA_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Y4yA Back     alignment and domain information
>cd06826 PLPDE_III_AR2 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme, Alanine Racemase 2 Back     alignment and domain information
>cd06813 PLPDE_III_DSD_D-TA_like_2 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes Similar to D-Serine Dehydratase and D-Threonine Aldolase, Unknown Group 2 Back     alignment and domain information
>cd06825 PLPDE_III_VanT Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, VanT and similar proteins Back     alignment and domain information
>cd06827 PLPDE_III_AR_proteobact Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Proteobacterial Alanine Racemases Back     alignment and domain information
>PRK11930 putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase; Provisional Back     alignment and domain information
>PRK03646 dadX alanine racemase; Reviewed Back     alignment and domain information
>TIGR03099 dCO2ase_PEP1 pyridoxal-dependent decarboxylase, exosortase system type 1 associated Back     alignment and domain information
>cd06841 PLPDE_III_MccE_like Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme MccE Back     alignment and domain information
>COG3457 Predicted amino acid racemase [Amino acid transport and metabolism] Back     alignment and domain information
>cd06830 PLPDE_III_ADC Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Arginine Decarboxylase Back     alignment and domain information
>COG0019 LysA Diaminopimelate decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02784 Orn_Arg_deC_N: Pyridoxal-dependent decarboxylase, pyridoxal binding domain; InterPro: IPR022644 These enzymes are collectively known as group IV decarboxylases [] Back     alignment and domain information
>cd00622 PLPDE_III_ODC Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Ornithine Decarboxylase Back     alignment and domain information
>COG0787 Alr Alanine racemase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11165 diaminopimelate decarboxylase; Provisional Back     alignment and domain information
>cd06836 PLPDE_III_ODC_DapDC_like_1 Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzymes, Uncharacterized Proteins with similarity to Ornithine and Diaminopimelate Decarboxylases Back     alignment and domain information
>PLN02439 arginine decarboxylase Back     alignment and domain information
>PRK05354 arginine decarboxylase; Provisional Back     alignment and domain information
>TIGR01273 speA arginine decarboxylase, biosynthetic Back     alignment and domain information
>cd06831 PLPDE_III_ODC_like_AZI Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Ornithine Decarboxylase-like Antizyme Inhibitor Back     alignment and domain information
>TIGR01047 nspC carboxynorspermidine decarboxylase Back     alignment and domain information
>cd06840 PLPDE_III_Bif_AspK_DapDC Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Bifunctional Aspartate Kinase/Diaminopimelate Decarboxylase Back     alignment and domain information
>PRK08961 bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional Back     alignment and domain information
>KOG0622|consensus Back     alignment and domain information
>cd06829 PLPDE_III_CANSDC Type III Pyridoxal 5-phosphate (PLP)-Dependent Enzyme Carboxynorspermidine Decarboxylase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
1b54_A257 Crystal Structure Of A Yeast Hypothetical Protein-A 5e-18
1ct5_A256 Crystal Structure Of Yeast Hypothetical Protein Ybl 1e-15
3cpg_A282 Crystal Structure Of An Unknown Protein From Bifido 4e-07
1w8g_A234 Crystal Structure Of E. Coli K-12 Yggs Length = 234 9e-06
3r79_A244 Crystal Structure Of An Uncharactertized Protein Fr 1e-05
3sy1_A245 Crystal Structure Of Engineered Protein. Northeast 3e-04
>pdb|1B54|A Chain A, Crystal Structure Of A Yeast Hypothetical Protein-A Structure From Bnl's Human Proteome Project Length = 257 Back     alignment and structure 
Iteration: 1

 Score = 87.0 bits (214), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 87/176 (49%), Gaps = 36/176 (20%)
Query: 7   DIRWHFIGHLQSNKVPKVIKVPNLEYIETIHDTRLATQVNNAWAKHQPDKKLKVFC--QI 64
           DI+WHFIG LQ+NK   + KVPNL  +ETI   + A ++N + AK QPD    + C  QI
Sbjct: 85  DIKWHFIGGLQTNKCKDLAKVPNLYSVETIDSLKKAKKLNESRAKFQPDCN-PILCNVQI 143
Query: 65  NTSGEENKHGAHPEHAEALVSHVINSCPNLEFTDKHGAHPEHAEALVSHVINSCPNLEFT 124
           NTS E+ K G + E                          E  E +   +   C  ++  
Sbjct: 144 NTSHEDQKSGLNNE-------------------------AEIFEVIDFFLSEECKYIKLN 178
Query: 125 GLMTIGKYGY---DTKHGPNPDFLELAKCRKDVCKKLNLNESNVELSMGMSSDLRE 177
           GLMTIG +     D+K   N DF  L + +K +  K     ++++LSMGMS+D RE
Sbjct: 179 GLMTIGSWNVSHEDSKE--NRDFATLVEWKKKIDAKFG---TSLKLSMGMSADFRE 229
>pdb|1CT5|A Chain A, Crystal Structure Of Yeast Hypothetical Protein Ybl036c-Selenomet Crystal Length = 256 Back     alignment and structure
>pdb|3CPG|A Chain A, Crystal Structure Of An Unknown Protein From Bifidobacterium Adolescentis Length = 282 Back     alignment and structure
>pdb|1W8G|A Chain A, Crystal Structure Of E. Coli K-12 Yggs Length = 234 Back     alignment and structure
>pdb|3R79|A Chain A, Crystal Structure Of An Uncharactertized Protein From Agrobacterium Tumefaciens Length = 244 Back     alignment and structure
>pdb|3SY1|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or70 Length = 245 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
1ct5_A256 Protein (yeast hypothetical protein, selenoMet); T 3e-51
3sy1_A245 UPF0001 protein YGGS; engineered protein, structur 2e-38
3cpg_A282 Uncharacterized protein; unknown protein, TIM barr 8e-37
3r79_A244 Uncharacterized protein; PSI-biology, structural g 2e-32
>1ct5_A Protein (yeast hypothetical protein, selenoMet); TIM barrel, pyridoxal-5'-phosphate, selenomethionine, structural genomics, PSI; HET: PLP; 2.00A {Saccharomyces cerevisiae} SCOP: c.1.6.2 PDB: 1b54_A* Length = 256 Back     alignment and structure
 Score =  163 bits (416), Expect = 3e-51
 Identities = 57/172 (33%), Positives = 81/172 (47%), Gaps = 30/172 (17%)

Query: 6   KDIRWHFIGHLQSNKVPKVIKVPNLEYIETIHDTRLATQVNNAWAKHQPD-KKLKVFCQI 64
            DI+WHFIG LQ+NK   + KVPNL  +ETI   + A ++N + AK QPD   +    QI
Sbjct: 83  DDIKWHFIGGLQTNKCKDLAKVPNLYSVETIDSLKKAKKLNESRAKFQPDCNPILCNVQI 142

Query: 65  NTSGEENKHGAHPEHAEALVSHVINSCPNLEFTDKHGAHPEHAEALVSHVINSCPNLEFT 124
           NTS E+ K G + E                          E  E +   +   C  ++  
Sbjct: 143 NTSHEDQKSGLNNEA-------------------------EIFEVIDFFLSEECKYIKLN 177

Query: 125 GLMTIGKYGYDT-KHGPNPDFLELAKCRKDVCKKLNLNESNVELSMGMSSDL 175
           GLMTIG +         N DF  L + +K +  K     ++++LSMGMS+D 
Sbjct: 178 GLMTIGSWNVSHEDSKENRDFATLVEWKKKIDAK---FGTSLKLSMGMSADF 226
>3sy1_A UPF0001 protein YGGS; engineered protein, structural genomics, PSI-biology, protei structure initiative; HET: MES; 1.47A {Escherichia coli} PDB: 1w8g_A* Length = 245 Back     alignment and structure
>3cpg_A Uncharacterized protein; unknown protein, TIM barrel, monomer, structural genomics, PSI-2, protein structure initiative; 1.71A {Bifidobacterium adolescentis ATCC15703} Length = 282 Back     alignment and structure
>3r79_A Uncharacterized protein; PSI-biology, structural genomics, NEW YORK structural genomi research consortium, TIM barrel; HET: PLP; 1.90A {Agrobacterium tumefaciens} Length = 244 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query181
3sy1_A245 UPF0001 protein YGGS; engineered protein, structur 100.0
3r79_A244 Uncharacterized protein; PSI-biology, structural g 100.0
1ct5_A256 Protein (yeast hypothetical protein, selenoMet); T 100.0
3cpg_A282 Uncharacterized protein; unknown protein, TIM barr 99.95
3gwq_A 426 D-serine deaminase; structural genomics, joint cen 99.86
1vfs_A 386 Alanine racemase; TIM-barrel, greek-KEY motief, is 99.7
1xfc_A 384 Alanine racemase; alpha-beta barrel, beta-structur 99.7
1rcq_A 357 Catabolic alanine racemase DADX; alpha-beta barrel 99.65
2rjg_A 379 Alanine racemase; alpha/beta barrel, cell shape, c 99.62
2j66_A 428 BTRK, decarboxylase; butirosin, AHBA biosynthesis, 99.62
2dy3_A 361 Alanine racemase; alpha/beta barrel, isomerase; HE 99.6
1bd0_A 388 Alanine racemase; isomerase, pyridoxal phosphate, 99.58
2vd8_A 391 Alanine racemase; pyridoxal 5'-phosphate, peptidog 99.58
4ecl_A 374 Serine racemase, vantg; antibiotic resistance, van 99.54
1twi_A 434 Diaminopimelate decarboxylase; antibiotic resistan 99.54
3llx_A 376 Predicted amino acid aldolase or racemase; structu 99.52
2qgh_A 425 Diaminopimelate decarboxylase; lyase; HET: PLP LYS 99.52
3co8_A 380 Alanine racemase; protein structure initiative II, 99.5
3anu_A 376 D-serine dehydratase; PLP-dependent fold-type III 99.46
2p3e_A 420 Diaminopimelate decarboxylase; southeast collabora 99.45
3e5p_A 371 Alanine racemase; ALR, PLP, SCP, isomerase, pyrido 99.45
3kw3_A 376 Alanine racemase; niaid, ssgcid, seattle structura 99.45
3mub_A 367 Alanine racemase; alpha/beta barrel, extended beta 99.44
2o0t_A 467 Diaminopimelate decarboxylase; PLP binding enzyme, 99.42
4a3q_A 382 Alanine racemase 1; isomerase, PLP-dependent enzym 99.38
3hur_A 395 Alanine racemase; structural genomics, isomerase, 99.24
3vab_A 443 Diaminopimelate decarboxylase 1; structural genomi 99.08
3n2b_A 441 Diaminopimelate decarboxylase; LYSA, lyase, struct 99.06
2nva_A 372 Arginine decarboxylase, A207R protein; PLP, TIM ba 98.78
2plj_A 419 Lysine/ornithine decarboxylase; type IV decarboxyl 98.61
3n2o_A 648 ADC, biosynthetic arginine decarboxylase; lyase; H 98.41
3nzq_A 666 ADC, biosynthetic arginine decarboxylase; alpha-be 98.41
3nzp_A 619 Arginine decarboxylase; alpha-beta protein, struct 98.36
7odc_A 424 Protein (ornithine decarboxylase); pyridoxal-5'-ph 98.36
3btn_A 448 Antizyme inhibitor 1; TIM-like A/B barrel domain a 97.96
1f3t_A 425 ODC, ornithine decarboxylase; beta-alpha-barrel, m 97.95
2oo0_A 471 ODC, ornithine decarboxylase; beta-alpha barrel, s 97.85
2yxx_A 386 Diaminopimelate decarboxylase; TM1517, TIM beta/al 97.68
1knw_A 425 Diaminopimelate decarboxylase; pyridoxal-phosphate 97.6
3n29_A 418 Carboxynorspermidine decarboxylase; lyase; HET: PL 96.77
3mt1_A 365 Putative carboxynorspermidine decarboxylase prote; 96.51
>3sy1_A UPF0001 protein YGGS; engineered protein, structural genomics, PSI-biology, protei structure initiative; HET: MES; 1.47A {Escherichia coli} PDB: 1w8g_A* Back     alignment and structure
Probab=100.00  E-value=6.3e-39  Score=271.43  Aligned_cols=140  Identities=26%  Similarity=0.362  Sum_probs=128.0

Q ss_pred             CCCceeeeecccccccHHhhhcCCCccEEEEeccHHHHHHHHHHHHhcCCCCCceEEEEEeCCCCCccCCCCccchhhhh
Q psy2326           5 CKDIRWHFIGHLQSNKVPKVIKVPNLEYIETIHDTRLATQVNNAWAKHQPDKKLKVFCQINTSGEENKHGAHPEHAEALV   84 (181)
Q Consensus         5 ~~di~WHfIG~LQsNKvk~l~~~~~~~~I~sVDs~~lA~~L~~~~~~~~~~~~l~VliQVN~s~E~~K~Gv~p~~~~~~~   84 (181)
                      ||+|.|||||++|+||++.++.  ++++++||||.++|+.|++++.+.++  +++|+||||||+|.+|+|+.|+++.   
T Consensus        75 ~~~i~w~~iG~lq~nk~~~~~~--~~~~i~sVds~~~a~~l~~~a~~~~~--~~~V~lqVntG~e~~R~G~~~ee~~---  147 (245)
T 3sy1_A           75 VTGLEWNFAGPLQSNKSRLVAE--HFDWCITIDRLRIATRLNDQRPAELP--PLNVLIQINISDENSKSGIQLAELD---  147 (245)
T ss_dssp             CCSCEEEECSCCCGGGHHHHHH--HCSEEEEECCHHHHHHHHHHSCTTSC--CEEEEEEBCCSCTTCCSSBCGGGHH---
T ss_pred             CCCeEEeecCCCChHHHHHHHH--HCCEEEecCCHHHHHHHHHHHHHcCC--CceEEEEEECCCCcCCcCCCHHHHH---
Confidence            4689999999999999999986  68999999999999999999988887  9999999999999999999999988   


Q ss_pred             hhhccCCCCCcccCCCCCCchhHHHHHHHHHhhCCCceEeeeeecCCCCCCCCCCccHHHHHHHHHHHHHHHhcCCCCCC
Q psy2326          85 SHVINSCPNLEFTDKHGAHPEHAEALVSHVINSCPNLEFTGLMTIGKYGYDTKHGPNPDFLELAKCRKDVCKKLNLNESN  164 (181)
Q Consensus        85 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~~p~L~l~GLMTi~~~~~d~~~~~~~~F~~L~~l~~~l~~~~~~~~~~  164 (181)
                                              ++++.+ .++|+|+++|||||+|..++ .+..++.|++|++++++|+++++   ..
T Consensus       148 ------------------------~l~~~i-~~~~~l~l~Glmt~~~~~~d-~~~~~~~f~~l~~l~~~l~~~~~---~~  198 (245)
T 3sy1_A          148 ------------------------ELAAAV-AELPRLRLRGLSAIPAPESE-YVRQFEVARQMAVAFAGLKTRYP---HI  198 (245)
T ss_dssp             ------------------------HHHHHH-TTCTTEEEEEEECCCCCCSC-HHHHHHHHHHHHHHHHHHHTTST---TC
T ss_pred             ------------------------HHHHHH-HcCCCCeEEEEEEeCCCCCC-HHHHHHHHHHHHHHHHHHHHhCC---CC
Confidence                                    899998 68999999999999999876 34568899999999999987643   37


Q ss_pred             CEEeeCCcchHHHHhc
Q psy2326         165 VELSMGMSSDLRERES  180 (181)
Q Consensus       165 ~~LSMGMS~D~~~AI~  180 (181)
                      .+||||||+||+.||+
T Consensus       199 ~~LSmGmS~d~~~Ai~  214 (245)
T 3sy1_A          199 DTLALGQSDDMEAAIA  214 (245)
T ss_dssp             CEEECCCSTTHHHHHH
T ss_pred             CEEeccCcHhHHHHHH
Confidence            8999999999999986
>3r79_A Uncharacterized protein; PSI-biology, structural genomics, NEW YORK structural genomi research consortium, TIM barrel; HET: PLP; 1.90A {Agrobacterium tumefaciens} Back     alignment and structure
>1ct5_A Protein (yeast hypothetical protein, selenoMet); TIM barrel, pyridoxal-5'-phosphate, selenomethionine, structural genomics, PSI; HET: PLP; 2.00A {Saccharomyces cerevisiae} SCOP: c.1.6.2 PDB: 1b54_A* Back     alignment and structure
>3cpg_A Uncharacterized protein; unknown protein, TIM barrel, monomer, structural genomics, PSI-2, protein structure initiative; 1.71A {Bifidobacterium adolescentis ATCC15703} Back     alignment and structure
>3gwq_A D-serine deaminase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, lyase; HET: MSE; 2.00A {Burkholderia xenovorans LB400} Back     alignment and structure
>1vfs_A Alanine racemase; TIM-barrel, greek-KEY motief, isomerase; HET: KCX DCS; 1.90A {Streptomyces lavendulae} SCOP: b.49.2.2 c.1.6.1 PDB: 1vfh_A* 1vft_A* Back     alignment and structure
>1xfc_A Alanine racemase; alpha-beta barrel, beta-structure for C-terminal domain, INT aldimine form, isomerase; HET: PLP; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>1rcq_A Catabolic alanine racemase DADX; alpha-beta barrel, beta-structure for C-terminal domain, internal/external aldimine forms, isomerase; HET: KCX PLP DLY; 1.45A {Pseudomonas aeruginosa} SCOP: b.49.2.2 c.1.6.1 PDB: 2odo_A* Back     alignment and structure
>2rjg_A Alanine racemase; alpha/beta barrel, cell shape, cell WALL biogenesis/degradat isomerase, peptidoglycan synthesis, pyridoxal phosphate; HET: KCX PLP; 2.40A {Escherichia coli} PDB: 2rjh_A* 3b8v_A* 3b8u_A* 3b8t_A* 3b8w_A* Back     alignment and structure
>2j66_A BTRK, decarboxylase; butirosin, AHBA biosynthesis, lyase; HET: PLP; 1.65A {Bacillus circulans} Back     alignment and structure
>2dy3_A Alanine racemase; alpha/beta barrel, isomerase; HET: PLP; 2.10A {Corynebacterium glutamicum} Back     alignment and structure
>1bd0_A Alanine racemase; isomerase, pyridoxal phosphate, alanine phosphonate; HET: IN5; 1.60A {Geobacillus stearothermophilus} SCOP: b.49.2.2 c.1.6.1 PDB: 1sft_A* 2sfp_A* 1l6g_A* 1niu_A* 1l6f_A* 1xql_A* 1xqk_A* 1epv_A* 1ftx_A* 3uw6_A Back     alignment and structure
>2vd8_A Alanine racemase; pyridoxal 5'-phosphate, peptidoglycan synthesis, PLP, OPPF, L-alanine, isomerase, D- alanine, pyridoxal phosphate; HET: MLY LLP; 1.47A {Bacillus anthracis} PDB: 2vd9_A* 3ha1_A* Back     alignment and structure
>4ecl_A Serine racemase, vantg; antibiotic resistance, vancomycin resistance, center for STR genomics of infectious diseases (csgid); HET: MSE; 2.02A {Enterococcus faecalis} Back     alignment and structure
>1twi_A Diaminopimelate decarboxylase; antibiotic resistance, lysine biosynthesis, structural genomics, NYSGXRC, PSI; HET: LYS PLP; 2.00A {Methanocaldococcus jannaschii} SCOP: b.49.2.3 c.1.6.1 PDB: 1tuf_A* Back     alignment and structure
>3llx_A Predicted amino acid aldolase or racemase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: LLP TRS; 1.50A {Idiomarina loihiensis} Back     alignment and structure
>2qgh_A Diaminopimelate decarboxylase; lyase; HET: PLP LYS; 2.30A {Helicobacter pylori} PDB: 3c5q_A* Back     alignment and structure
>3co8_A Alanine racemase; protein structure initiative II, PSI-II, PLP, TIM barrel, structural genomics, NEW YORK SGX center for structural genomics; HET: PLP; 1.70A {Oenococcus oeni} Back     alignment and structure
>3anu_A D-serine dehydratase; PLP-dependent fold-type III enzyme, PL binding, zinc binding, lyase; HET: PLP; 1.90A {Gallus gallus} PDB: 3anv_A* 3awn_A* 3awo_A* Back     alignment and structure
>2p3e_A Diaminopimelate decarboxylase; southeast collaboratory for struct genomics, riken spring-8 center; 1.99A {Aquifex aeolicus} Back     alignment and structure
>3e5p_A Alanine racemase; ALR, PLP, SCP, isomerase, pyridoxal phosph; HET: PLP EPE 2PE; 2.50A {Enterococcus faecalis} PDB: 3e6e_A* Back     alignment and structure
>3kw3_A Alanine racemase; niaid, ssgcid, seattle structural genomics center for infect disease, iodide SOAK, LLP, CAT-scratch DI isomerase; HET: LLP; 2.04A {Bartonella henselae} Back     alignment and structure
>2o0t_A Diaminopimelate decarboxylase; PLP binding enzyme, lysine biosynthesis, STRU genomics, TB structural genomics consortium, TBSGC; HET: LLP; 2.33A {Mycobacterium tuberculosis} PDB: 1hkv_A* 1hkw_A Back     alignment and structure
>4a3q_A Alanine racemase 1; isomerase, PLP-dependent enzymes; HET: PLP; 2.15A {Staphylococcus aureus} PDB: 3oo2_A Back     alignment and structure
>3hur_A Alanine racemase; structural genomics, isomerase, pyridoxal phosphate, PSI-2, protein structure initiative; 2.50A {Oenococcus oeni psu-1} Back     alignment and structure
>3vab_A Diaminopimelate decarboxylase 1; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: LLP; 2.10A {Brucella melitensis BV} Back     alignment and structure
>3n2b_A Diaminopimelate decarboxylase; LYSA, lyase, structural genom center for structural genomics of infectious diseases, CSGI; 1.80A {Vibrio cholerae} Back     alignment and structure
>2nva_A Arginine decarboxylase, A207R protein; PLP, TIM barrel, eukaryotic ODC- like, lyase; HET: PL2; 1.80A {Paramecium bursaria chlorella virus 1} PDB: 2nv9_A* Back     alignment and structure
>2plj_A Lysine/ornithine decarboxylase; type IV decarboxylase, beta/alpha barrel, beta barrel, lyase; HET: P3T; 1.70A {Vibrio vulnificus} PDB: 2plk_A* Back     alignment and structure
>3n2o_A ADC, biosynthetic arginine decarboxylase; lyase; HET: PLP; 2.30A {Vibrio vulnificus} Back     alignment and structure
>3nzq_A ADC, biosynthetic arginine decarboxylase; alpha-beta protein, structural genomics, PSI-biology, protei structure initiative; 3.10A {Escherichia coli} Back     alignment and structure
>3nzp_A Arginine decarboxylase; alpha-beta protein, structural genomics, PSI-biology, protei structure initiative; HET: PLP; 3.00A {Campylobacter jejuni subsp} Back     alignment and structure
>7odc_A Protein (ornithine decarboxylase); pyridoxal-5'-phosphate, PLP, group IV decarboxylase, polyami parasitical, chemotherapy target, putrescine; HET: PLP; 1.60A {Mus musculus} SCOP: b.49.2.3 c.1.6.1 PDB: 2on3_A 1d7k_A* Back     alignment and structure
>3btn_A Antizyme inhibitor 1; TIM-like A/B barrel domain and A sheet domain, structural genomics, israel structural proteomics center, ISPC; 2.05A {Mus musculus} Back     alignment and structure
>1f3t_A ODC, ornithine decarboxylase; beta-alpha-barrel, modified greek KEY beta-sheet, lyase; HET: PLP; 2.00A {Trypanosoma brucei} SCOP: b.49.2.3 c.1.6.1 PDB: 1qu4_A* 1szr_C* 2tod_A* 1njj_A* Back     alignment and structure
>2oo0_A ODC, ornithine decarboxylase; beta-alpha barrel, sheet, lyase; HET: PLP; 1.90A {Homo sapiens} Back     alignment and structure
>2yxx_A Diaminopimelate decarboxylase; TM1517, TIM beta/alpha barrel fold, lyase, structural genomi NPPSFA; HET: PLP; 1.70A {Thermotoga maritima} Back     alignment and structure
>1knw_A Diaminopimelate decarboxylase; pyridoxal-phosphate, decarboxylation, lysin barrel, lyase; HET: PLP MES; 2.10A {Escherichia coli} SCOP: b.49.2.3 c.1.6.1 PDB: 1ko0_A* Back     alignment and structure
>3n29_A Carboxynorspermidine decarboxylase; lyase; HET: PLP; 1.90A {Campylobacter jejuni subsp} Back     alignment and structure
>3mt1_A Putative carboxynorspermidine decarboxylase prote; PSI2, MCSG, structural genomics; 2.50A {Sinorhizobium meliloti} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 181
d1ct5a_244 c.1.6.2 (A:) "Hypothetical" protein ybl036c {Baker 3e-11
>d1ct5a_ c.1.6.2 (A:) "Hypothetical" protein ybl036c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: PLP-binding barrel
family: "Hypothetical" protein ybl036c
domain: "Hypothetical" protein ybl036c
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

 Score = 58.0 bits (139), Expect = 3e-11
 Identities = 59/175 (33%), Positives = 83/175 (47%), Gaps = 30/175 (17%)

Query: 5   CKDIRWHFIGHLQSNKVPKVIKVPNLEYIETIHDTRLATQVNNAWAKHQPDK-KLKVFCQ 63
             DI+WHFIG LQ+NK   + KVPNL  +ETI   + A ++N + AK QPD   +    Q
Sbjct: 81  PDDIKWHFIGGLQTNKCKDLAKVPNLYSVETIDSLKKAKKLNESRAKFQPDCNPILCNVQ 140

Query: 64  INTSGEENKHGAHPEHAEALVSHVINSCPNLEFTDKHGAHPEHAEALVSHVINSCPNLEF 123
           INTS E+ K G + E                          E  E +   +   C  ++ 
Sbjct: 141 INTSHEDQKSGLNNEA-------------------------EIFEVIDFFLSEECKYIKL 175

Query: 124 TGLMTIGKYGYDTKHG-PNPDFLELAKCRKDVCKKLNLNESNVELSMGMSSDLRE 177
            GLMTIG +    +    N DF  L + +K +  K   +   ++LSMGMS+D RE
Sbjct: 176 NGLMTIGSWNVSHEDSKENRDFATLVEWKKKIDAKFGTS---LKLSMGMSADFRE 227

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query181
d1ct5a_244 "Hypothetical" protein ybl036c {Baker's yeast (Sac 100.0
d1vfsa2237 Alanine racemase {Streptomyces lavendulae [TaxId: 98.67
d1bd0a2233 Alanine racemase {Bacillus stearothermophilus [Tax 98.37
d1rcqa2226 Alanine racemase {Pseudomonas aeruginosa [TaxId: 2 97.85
d1hkva2265 Diaminopimelate decarboxylase LysA {Mycobacterium 97.24
d1twia2264 Diaminopimelate decarboxylase LysA {Archaeon Metha 96.62
d1f3ta2240 Eukaryotic ornithine decarboxylase {Trypanosoma br 96.48
d1knwa2247 Diaminopimelate decarboxylase LysA {Escherichia co 96.38
d7odca2240 Eukaryotic ornithine decarboxylase {Mouse (Mus mus 95.84
>d1ct5a_ c.1.6.2 (A:) "Hypothetical" protein ybl036c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: PLP-binding barrel
family: "Hypothetical" protein ybl036c
domain: "Hypothetical" protein ybl036c
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=100.00  E-value=6.4e-45  Score=308.31  Aligned_cols=145  Identities=39%  Similarity=0.616  Sum_probs=121.2

Q ss_pred             CceeeeecccccccHHhhhcCCCccEEEEeccHHHHHHHHHHHHhcCC-CCCceEEEEEeCCCCCccCCCCcc-chhhhh
Q psy2326           7 DIRWHFIGHLQSNKVPKVIKVPNLEYIETIHDTRLATQVNNAWAKHQP-DKKLKVFCQINTSGEENKHGAHPE-HAEALV   84 (181)
Q Consensus         7 di~WHfIG~LQsNKvk~l~~~~~~~~I~sVDs~~lA~~L~~~~~~~~~-~~~l~VliQVN~s~E~~K~Gv~p~-~~~~~~   84 (181)
                      +++|||||||||||||++++++++++||||||+++|+.|++.+.+.++ ..+++||||||+++|++|+|+.|+ ++.   
T Consensus        83 ~i~wHfIG~LQsNKvk~i~~~~~~~~I~svds~kla~~l~~~~~~~~~~~~~~~~~iQVNi~~e~~KsG~~~~~~l~---  159 (244)
T d1ct5a_          83 DIKWHFIGGLQTNKCKDLAKVPNLYSVETIDSLKKAKKLNESRAKFQPDCNPILCNVQINTSHEDQKSGLNNEAEIF---  159 (244)
T ss_dssp             TCEEEECSCCCGGGHHHHHHCTTEEEEEEECSHHHHHHHHHHHHHHCTTSCCEEEEEEBCCSSSCCSSSBCCHHHHH---
T ss_pred             ceeeeeecccccchHHHHHHhcccccccccccccchhHHHHHHhhhhcccCcceeEEeeecccccccCCCCcHHHHH---
Confidence            799999999999999999987778999999999999999998887543 237899999999999999999986 555   


Q ss_pred             hhhccCCCCCcccCCCCCCchhHHHHHHHHH-hhCCCceEeeeeecCCCCCCC-CCCccHHHHHHHHHHHHHHHhcCCCC
Q psy2326          85 SHVINSCPNLEFTDKHGAHPEHAEALVSHVI-NSCPNLEFTGLMTIGKYGYDT-KHGPNPDFLELAKCRKDVCKKLNLNE  162 (181)
Q Consensus        85 ~~~~~~~~~~~~~~~~~~~~~~~~~l~~~i~-~~~p~L~l~GLMTi~~~~~d~-~~~~~~~F~~L~~l~~~l~~~~~~~~  162 (181)
                                              ++++.+. ..|++|+++|||||||...++ ...++.+|+.|+++++++...++.  
T Consensus       160 ------------------------~~~~~~~~~~~~~l~l~GLM~i~p~~~~~~~~~~~~~F~~l~~l~~~l~~~~~~--  213 (244)
T d1ct5a_         160 ------------------------EVIDFFLSEECKYIKLNGLMTIGSWNVSHEDSKENRDFATLVEWKKKIDAKFGT--  213 (244)
T ss_dssp             ------------------------HHHHHHHSTTCCSEEEEEEECCCCCC---------HHHHHHHHHHHHHHHHHCC--
T ss_pred             ------------------------HHHHHHHHHhcccchhccccccccCCCCchhhHHHHHHHHHHHHHHHHhccCCC--
Confidence                                    6777663 468999999999999986542 234567899999999999988753  


Q ss_pred             CCCEEeeCCcchHHHHhcC
Q psy2326         163 SNVELSMGMSSDLRERESS  181 (181)
Q Consensus       163 ~~~~LSMGMS~D~~~AI~~  181 (181)
                       ..+||||||+||++||+.
T Consensus       214 -~~~LSMGMS~Dye~AI~~  231 (244)
T d1ct5a_         214 -SLKLSMGMSADFREAIRQ  231 (244)
T ss_dssp             -CCEEECCCTTTHHHHHHT
T ss_pred             -CCEEeChhhhhHHHHHHC
Confidence             469999999999999974
>d1vfsa2 c.1.6.1 (A:13-249) Alanine racemase {Streptomyces lavendulae [TaxId: 1914]} Back     information, alignment and structure
>d1bd0a2 c.1.6.1 (A:12-244) Alanine racemase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1rcqa2 c.1.6.1 (A:8-233) Alanine racemase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1hkva2 c.1.6.1 (A:46-310) Diaminopimelate decarboxylase LysA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1twia2 c.1.6.1 (A:50-313) Diaminopimelate decarboxylase LysA {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1f3ta2 c.1.6.1 (A:44-283) Eukaryotic ornithine decarboxylase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1knwa2 c.1.6.1 (A:32-278) Diaminopimelate decarboxylase LysA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d7odca2 c.1.6.1 (A:44-283) Eukaryotic ornithine decarboxylase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure