Psyllid ID: psy2349


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
MVTPSTFKEVLVHLDLKGAPPSLTYLKEILPILAYTGATSLLIEWEDTLPYSLGFDNTNPFRETEIFIILAAAESNGLASIPLVPLYSDMDFVLKVKEFAKMRQNFNDTRFICPNARSSLDLVFKMIGRMRFVLGTPISPLFCPPSALNFGTCRDDKISVVAFP
cccccccccEEEEEEcccccccHHHHHHHHHHHHHHcccEEEEEEEccccccccccccccccHHHHHHHHHHHHHcccEEcccccccHHHHHHHccHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccc
cccccccccEEEEEEcccccccHHHHHHHHHHHHHccccEEEEEEEccccccccccccccccHHHHHHHHHHHHHcccEEEEcHHHHHHHHHHHccHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHcccccEEEEccHHHHHHccccHcccEEEccc
MVTPSTFKEVLVHLdlkgappsltyLKEILPILAYTGATSLLIewedtlpyslgfdntnpfreTEIFIILAAAesnglasiplvplysdmdFVLKVKEFAKMRQNfndtrficpnarsSLDLVFKMIGRMRfvlgtpisplfcppsalnfgtcrddkisvvafp
MVTPSTFKEVLVHLDLKGAPPSLTYLKEILPILAYTGATSLLIEWEDTLPYSLGFDNTNPFRETEIFIILAAAESNGLASIPLVPLYSDMDFVLKVKEFAKMRQNfndtrficpnarSSLDLVFKMIGRMRFVLGTPISPLFCPPSalnfgtcrdDKISVVAFP
MVTPSTFKEVLVHLDLKGAPPSLTYLKEILPILAYTGATSLLIEWEDTLPYSLGFDNTNPFRETEIFIILAAAESNGLASIPLVPLYSDMDFVLKVKEFAKMRQNFNDTRFICPNARSSLDLVFKMIGRMRFVLGTPISPLFCPPSALNFGTCRDDKISVVAFP
******FKEVLVHLDLKGAPPSLTYLKEILPILAYTGATSLLIEWEDTLPYSLGFDNTNPFRETEIFIILAAAESNGLASIPLVPLYSDMDFVLKVKEFAKMRQNFNDTRFICPNARSSLDLVFKMIGRMRFVLGTPISPLFCPPSALNFGTCRDDKISVV***
****ST**EVLVHLDLKGAPPSLTYLKEILPILAYTGATSLLIEWEDTLPYSLGFDNTNPFRETEIFIILAAAESNGLASIPLVPLYSDMDFVLKVKEFAKMRQNFNDTRFICPNARSSLDLVFKMIGRMRFVLGTPISPLFCPPSALNFGTCRDDKISVVAFP
MVTPSTFKEVLVHLDLKGAPPSLTYLKEILPILAYTGATSLLIEWEDTLPYSLGFDNTNPFRETEIFIILAAAESNGLASIPLVPLYSDMDFVLKVKEFAKMRQNFNDTRFICPNARSSLDLVFKMIGRMRFVLGTPISPLFCPPSALNFGTCRDDKISVVAFP
*****TFKEVLVHLDLKGAPPSLTYLKEILPILAYTGATSLLIEWEDTLPYSLGFDNTNPFRETEIFIILAAAESNGLASIPLVPLYSDMDFVLKVKEFAKMRQNFNDTRFICPNARSSLDLVFKMIGRMRFVLGTPISPLFCPPSALNFGTCRDDKISVVAFP
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVTPSTFKEVLVHLDLKGAPPSLTYLKEILPILAYTGATSLLIEWEDTLPYSLGFDNTNPFRETEIFIILAAAESNGLASIPLVPLYSDMDFVLKVKEFAKMRQNFNDTRFICPNARSSLDLVFKMIGRMRFVLGTPISPLFCPPSALNFGTCRDDKISVVAFP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query164 2.2.26 [Sep-21-2011]
Q3U4H6 486 Hexosaminidase D OS=Mus m no N/A 0.792 0.267 0.398 2e-17
Q8WVB3 486 Hexosaminidase D OS=Homo no N/A 0.786 0.265 0.410 4e-16
A6QNR0 346 Hexosaminidase D OS=Bos t no N/A 0.731 0.346 0.406 9e-16
>sp|Q3U4H6|HEXDC_MOUSE Hexosaminidase D OS=Mus musculus GN=Hexdc PE=1 SV=1 Back     alignment and function desciption
 Score = 88.6 bits (218), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/133 (39%), Positives = 73/133 (54%), Gaps = 3/133 (2%)

Query: 1   MVTPSTFKEVLVHLDLKGAPPSLTYLKEILPILAYTGATSLLIEWEDTLPYSLG---FDN 57
           M +P+ FK  LVHLDLKGAPP ++YL E+ P+    GA  LLIE+ED  PY         
Sbjct: 1   MSSPTPFKMRLVHLDLKGAPPKVSYLSEVFPLFHALGANGLLIEYEDMFPYEGHLRLLRA 60

Query: 58  TNPFRETEIFIILAAAESNGLASIPLVPLYSDMDFVLKVKEFAKMRQNFNDTRFICPNAR 117
            + +  +E+  IL  A  + L  IPLV  +  M+FVLK   FA +R+       + P+  
Sbjct: 61  KHAYSPSEVTEILRLARLSELEVIPLVQTFGHMEFVLKHAAFAHLREVALFPNTLNPHEA 120

Query: 118 SSLDLVFKMIGRM 130
            SL LV  MI ++
Sbjct: 121 ESLALVQAMIDQI 133




Has hexosaminidase activity.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 5EC: 2
>sp|Q8WVB3|HEXDC_HUMAN Hexosaminidase D OS=Homo sapiens GN=HEXDC PE=2 SV=3 Back     alignment and function description
>sp|A6QNR0|HEXDC_BOVIN Hexosaminidase D OS=Bos taurus GN=HEXDC PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query164
195569971 710 GD19213 [Drosophila simulans] gi|1941989 0.774 0.178 0.415 2e-20
391326869 591 PREDICTED: hexosaminidase D-like [Metase 0.786 0.218 0.386 3e-20
195348935 706 GM15285 [Drosophila sechellia] gi|194122 0.774 0.179 0.415 4e-20
194744877 704 GF18511 [Drosophila ananassae] gi|190627 0.774 0.180 0.415 4e-20
21357133 708 CG7985, isoform A [Drosophila melanogast 0.774 0.179 0.407 9e-20
427785613 546 Putative hexosaminidase d-like protein [ 0.774 0.232 0.384 2e-19
347971594 705 AGAP004270-PA [Anopheles gambiae str. PE 0.731 0.170 0.382 2e-19
194900276 706 GG22715 [Drosophila erecta] gi|190651386 0.774 0.179 0.4 3e-19
195497552 828 GE25519 [Drosophila yakuba] gi|194182250 0.774 0.153 0.407 3e-19
195107341 703 GI23723 [Drosophila mojavensis] gi|19391 0.774 0.180 0.404 8e-19
>gi|195569971|ref|XP_002102982.1| GD19213 [Drosophila simulans] gi|194198909|gb|EDX12485.1| GD19213 [Drosophila simulans] Back     alignment and taxonomy information
 Score =  103 bits (257), Expect = 2e-20,   Method: Composition-based stats.
 Identities = 54/130 (41%), Positives = 80/130 (61%), Gaps = 3/130 (2%)

Query: 4   PSTFKEVLVHLDLKGAPPSLTYLKEILPILAYTGATSLLIEWEDTLPYS---LGFDNTNP 60
           P    E LVHLDLKGAPP L++LK++LP+L   GAT LLIE+ED  PYS         N 
Sbjct: 187 PRAPAERLVHLDLKGAPPKLSFLKQLLPVLRALGATGLLIEYEDMFPYSGVLQPLAAHNA 246

Query: 61  FRETEIFIILAAAESNGLASIPLVPLYSDMDFVLKVKEFAKMRQNFNDTRFICPNARSSL 120
           ++E E+   L  A  +GL+ +PLV  +  M++VLK+  F +MR+     + ICP+   S+
Sbjct: 247 YKEDELRDFLECAALHGLSVMPLVQTFGHMEYVLKLSGFEQMRELAESPQSICPSQPQSM 306

Query: 121 DLVFKMIGRM 130
            L+ +M+ ++
Sbjct: 307 ALLEQMLTQV 316




Source: Drosophila simulans

Species: Drosophila simulans

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|391326869|ref|XP_003737932.1| PREDICTED: hexosaminidase D-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|195348935|ref|XP_002041002.1| GM15285 [Drosophila sechellia] gi|194122607|gb|EDW44650.1| GM15285 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|194744877|ref|XP_001954919.1| GF18511 [Drosophila ananassae] gi|190627956|gb|EDV43480.1| GF18511 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|21357133|ref|NP_650689.1| CG7985, isoform A [Drosophila melanogaster] gi|442619765|ref|NP_001262699.1| CG7985, isoform B [Drosophila melanogaster] gi|5901810|gb|AAD55413.1|AF181627_1 BcDNA.GH04120 [Drosophila melanogaster] gi|10726597|gb|AAF55509.2| CG7985, isoform A [Drosophila melanogaster] gi|220943658|gb|ACL84372.1| CG7985-PA [synthetic construct] gi|440217588|gb|AGB96079.1| CG7985, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|427785613|gb|JAA58258.1| Putative hexosaminidase d-like protein [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|347971594|ref|XP_313191.5| AGAP004270-PA [Anopheles gambiae str. PEST] gi|333468737|gb|EAA08649.6| AGAP004270-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|194900276|ref|XP_001979683.1| GG22715 [Drosophila erecta] gi|190651386|gb|EDV48641.1| GG22715 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195497552|ref|XP_002096149.1| GE25519 [Drosophila yakuba] gi|194182250|gb|EDW95861.1| GE25519 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|195107341|ref|XP_001998272.1| GI23723 [Drosophila mojavensis] gi|193914866|gb|EDW13733.1| GI23723 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query164
FB|FBgn0028499 708 CG7985 [Drosophila melanogaste 0.756 0.175 0.417 1.5e-19
WB|WBGene00015767 596 hex-2 [Caenorhabditis elegans 0.896 0.246 0.326 4.4e-18
WB|WBGene00013497 512 hex-5 [Caenorhabditis elegans 0.756 0.242 0.330 3e-17
WB|WBGene00021766 491 hex-4 [Caenorhabditis elegans 0.762 0.254 0.375 4.4e-17
MGI|MGI:3605542 486 Hexdc "hexosaminidase (glycosy 0.792 0.267 0.406 9.1e-17
RGD|2302323 486 Hexdc "hexosaminidase (glycosy 0.786 0.265 0.413 9.1e-17
UNIPROTKB|F1S009 481 HEXDC "Uncharacterized protein 0.792 0.270 0.406 1.1e-16
UNIPROTKB|F1MED7 479 HEXDC "Hexosaminidase D" [Bos 0.768 0.263 0.418 4e-16
UNIPROTKB|A6QNR0 346 HEXDC "Hexosaminidase D" [Bos 0.731 0.346 0.414 1.4e-15
UNIPROTKB|Q8WVB3 486 HEXDC "Hexosaminidase D" [Homo 0.768 0.259 0.427 1.4e-15
FB|FBgn0028499 CG7985 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 243 (90.6 bits), Expect = 1.5e-19, P = 1.5e-19
 Identities = 53/127 (41%), Positives = 78/127 (61%)

Query:     4 PSTFKEVLVHLDLKGAPPSLTYLKEILPILAYTGATSLLIEWEDTLPYSLGFDNT---NP 60
             P    E LVHLDLKGAPP L++LK++LP+L   GAT LLIE+ED  PYS         N 
Sbjct:   185 PRAPAERLVHLDLKGAPPKLSFLKQLLPVLRALGATGLLIEYEDMFPYSGVLQPLAAHNA 244

Query:    61 FRETEIFIILAAAESNGLASIPLVPLYSDMDFVLKVKEFAKMRQNFNDTRFICPNARSSL 120
             ++E E+   L  A  +GL+ +PLV  +  M++VLK+  F ++R+     + ICP+   S+
Sbjct:   245 YKEDELRDFLECAALHGLSVMPLVQTFGHMEYVLKLSGFEQLRELAESPQSICPSQPQSM 304

Query:   121 DLVFKMI 127
              L+ +M+
Sbjct:   305 ALLEQML 311




GO:0004553 "hydrolase activity, hydrolyzing O-glycosyl compounds" evidence=IEA
GO:0005975 "carbohydrate metabolic process" evidence=IEA
WB|WBGene00015767 hex-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00013497 hex-5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00021766 hex-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
MGI|MGI:3605542 Hexdc "hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|2302323 Hexdc "hexosaminidase (glycosyl hydrolase family 20, catalytic domain) containing" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1S009 HEXDC "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MED7 HEXDC "Hexosaminidase D" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|A6QNR0 HEXDC "Hexosaminidase D" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WVB3 HEXDC "Hexosaminidase D" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
cd06565 301 cd06565, GH20_GcnA-like, Glycosyl hydrolase family 6e-27
>gnl|CDD|119335 cd06565, GH20_GcnA-like, Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins Back     alignment and domain information
 Score =  102 bits (256), Expect = 6e-27
 Identities = 42/121 (34%), Positives = 64/121 (52%), Gaps = 4/121 (3%)

Query: 11  LVHLDLKG-APPSLTYLKEILPILAYTGATSLLIEWEDTLPYSLG---FDNTNPFRETEI 66
            VHLDLK  A P ++YLK++L +LA  GA  LL+ +EDT PY            + + EI
Sbjct: 3   GVHLDLKRNAVPKVSYLKKLLRLLALLGANGLLLYYEDTFPYEGEPEVGRMRGAYTKEEI 62

Query: 67  FIILAAAESNGLASIPLVPLYSDMDFVLKVKEFAKMRQNFNDTRFICPNARSSLDLVFKM 126
             I   A   G+  IPL+     ++F+LK  EF  +R+  +  + +CP    + D + +M
Sbjct: 63  REIDDYAAELGIEVIPLIQTLGHLEFILKHPEFRHLREVDDPPQTLCPGEPKTYDFIEEM 122

Query: 127 I 127
           I
Sbjct: 123 I 123


GcnA is an exoglucosidase which cleaves N-acetyl-beta-D-galactosamine (NAG) and N-acetyl-beta-D-galactosamine residues from 4-methylumbelliferylated (4MU) substrates, as well as cleaving NAG from chito-oligosaccharides (i.e. NAG polymers). In contrast, sulfated forms of the substrate are unable to be cleaved and act instead as mild competitive inhibitors. Additionally, the enzyme is known to be poisoned by several first-row transition metals as well as by mercury. GcnA forms a homodimer with subunits comprised of three domains, an N-terminal zincin-like domain, this central catalytic GH20 domain, and a C-terminal alpha helical domain. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself. Length = 301

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 164
cd06565 301 GH20_GcnA-like Glycosyl hydrolase family 20 (GH20) 100.0
cd06569 445 GH20_Sm-chitobiase-like The chitobiase of Serratia 100.0
cd06570 311 GH20_chitobiase-like_1 A functionally uncharacteri 100.0
cd06562 348 GH20_HexA_HexB-like Beta-N-acetylhexosaminidases c 100.0
cd06563 357 GH20_chitobiase-like The chitobiase of Serratia ma 100.0
PF00728 351 Glyco_hydro_20: Glycosyl hydrolase family 20, cata 100.0
cd06568 329 GH20_SpHex_like A subgroup of the Glycosyl hydrola 100.0
cd06564 326 GH20_DspB_LnbB-like Glycosyl hydrolase family 20 ( 100.0
cd02742 303 GH20_hexosaminidase Beta-N-acetylhexosaminidases o 100.0
KOG2499|consensus 542 100.0
COG3525 732 Chb N-acetyl-beta-hexosaminidase [Carbohydrate tra 100.0
PF02638 311 DUF187: Glycosyl hydrolase like GH101; InterPro: I 98.26
PF14871132 GHL6: Hypothetical glycosyl hydrolase 6 97.63
COG1649 418 Uncharacterized protein conserved in bacteria [Fun 97.15
PF02449 374 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR0 97.02
PF13200 316 DUF4015: Putative glycosyl hydrolase domain 96.8
PF10566273 Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro: 96.32
PRK09441 479 cytoplasmic alpha-amylase; Reviewed 95.55
PRK12313 633 glycogen branching enzyme; Provisional 95.13
PF00150 281 Cellulase: Cellulase (glycosyl hydrolase family 5) 94.94
COG0296 628 GlgB 1,4-alpha-glucan branching enzyme [Carbohydra 94.54
smart00642166 Aamy Alpha-amylase domain. 94.29
KOG0470|consensus 757 94.16
PF00128 316 Alpha-amylase: Alpha amylase, catalytic domain; In 94.02
PLN00196 428 alpha-amylase; Provisional 93.49
PF13199 559 Glyco_hydro_66: Glycosyl hydrolase family 66; PDB: 93.27
TIGR02403 543 trehalose_treC alpha,alpha-phosphotrehalase. Treha 93.23
TIGR02402 542 trehalose_TreZ malto-oligosyltrehalose trehalohydr 93.21
PRK14705 1224 glycogen branching enzyme; Provisional 93.2
PLN02361 401 alpha-amylase 93.06
TIGR02104 605 pulA_typeI pullulanase, type I. Pullulan is an unu 92.85
PLN02784 894 alpha-amylase 92.65
PRK05402 726 glycogen branching enzyme; Provisional 92.61
PF07555 306 NAGidase: beta-N-acetylglucosaminidase ; InterPro: 92.6
PRK01060 281 endonuclease IV; Provisional 92.59
PRK14706 639 glycogen branching enzyme; Provisional 92.56
TIGR02100 688 glgX_debranch glycogen debranching enzyme GlgX. Th 92.42
TIGR01515 613 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 92.24
PRK10785 598 maltodextrin glucosidase; Provisional 91.84
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 91.83
PRK12568 730 glycogen branching enzyme; Provisional 90.91
PRK14510 1221 putative bifunctional 4-alpha-glucanotransferase/g 90.63
TIGR02401 825 trehalose_TreY malto-oligosyltrehalose synthase. T 90.63
PRK14582 671 pgaB outer membrane N-deacetylase; Provisional 90.43
smart00518 273 AP2Ec AP endonuclease family 2. These endonuclease 90.36
PRK10933 551 trehalose-6-phosphate hydrolase; Provisional 90.3
PLN02447 758 1,4-alpha-glucan-branching enzyme 90.08
PF02679244 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); 89.85
PRK14511 879 maltooligosyl trehalose synthase; Provisional 89.78
PLN02960 897 alpha-amylase 89.31
PRK10340 1021 ebgA cryptic beta-D-galactosidase subunit alpha; R 89.29
PRK03705 658 glycogen debranching enzyme; Provisional 89.2
TIGR03849237 arch_ComA phosphosulfolactate synthase. This model 88.88
TIGR02456 539 treS_nterm trehalose synthase. Trehalose synthase 88.38
PRK09505 683 malS alpha-amylase; Reviewed 87.93
PF02065 394 Melibiase: Melibiase; InterPro: IPR000111 O-Glycos 87.61
PF14488166 DUF4434: Domain of unknown function (DUF4434) 87.58
PF01301 319 Glyco_hydro_35: Glycosyl hydrolases family 35; Int 87.43
PF02836 298 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM 86.77
PF05913 357 DUF871: Bacterial protein of unknown function (DUF 85.91
COG1874 673 LacA Beta-galactosidase [Carbohydrate transport an 84.59
cd00452190 KDPG_aldolase KDPG and KHG aldolase. This family b 84.46
PRK06552213 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog 84.31
PRK10150 604 beta-D-glucuronidase; Provisional 84.08
cd01299342 Met_dep_hydrolase_A Metallo-dependent hydrolases, 83.49
PF01261213 AP_endonuc_2: Xylose isomerase-like TIM barrel; In 82.51
cd06592 303 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharact 81.62
cd06593 308 GH31_xylosidase_YicI YicI alpha-xylosidase is a gl 81.45
TIGR03234254 OH-pyruv-isom hydroxypyruvate isomerase. This enzy 81.19
PRK14507 1693 putative bifunctional 4-alpha-glucanotransferase/m 81.16
KOG0256|consensus 471 80.25
PF01055 441 Glyco_hydro_31: Glycosyl hydrolases family 31 ; In 80.23
TIGR01866216 cas_Csn2 CRISPR-associated protein, Csn2 family. C 80.08
>cd06565 GH20_GcnA-like Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins Back     alignment and domain information
Probab=100.00  E-value=7.1e-49  Score=329.50  Aligned_cols=148  Identities=30%  Similarity=0.460  Sum_probs=142.1

Q ss_pred             ceeEEEeCCC-CCCCHHHHHHHHHHHHhcCCCEEEEEeeccCCCCCC---CCCCCCCCHHHHHHHHHHHHHcCCeEeecc
Q psy2349           9 EVLVHLDLKG-APPSLTYLKEILPILAYTGATSLLIEWEDTLPYSLG---FDNTNPFRETEIFIILAAAESNGLASIPLV   84 (164)
Q Consensus         9 ~Rg~~lD~~r-~~~~~~~lk~~i~~la~~k~N~l~l~~ed~~p~~~~---~~~~~~yT~~dir~iv~yA~~~gI~VIPei   84 (164)
                      .||+|||+|| +++++++||++|+.||.+|+|.||||++|+|||++.   .+.+++||++|+++|++||++|||+|||||
T Consensus         1 ~RG~mlD~~R~~~~~~~~lk~~id~ma~~k~N~l~lhl~D~f~~~~~p~~~~~~~~yT~~ei~ei~~yA~~~gI~vIPei   80 (301)
T cd06565           1 FRGVHLDLKRNAVPKVSYLKKLLRLLALLGANGLLLYYEDTFPYEGEPEVGRMRGAYTKEEIREIDDYAAELGIEVIPLI   80 (301)
T ss_pred             CceEEEecCCCCCCCHHHHHHHHHHHHHcCCCEEEEEEecceecCCCcccccCCCCcCHHHHHHHHHHHHHcCCEEEecC
Confidence            5999999999 999999999999999999999999999999999988   445899999999999999999999999999


Q ss_pred             CCcchHHHHhcCccchhhhcCCCCCCcccCCChhhHHHHHHHHHhc-ccCCCCCeeeccCCccCCCCCCCHHHHH
Q psy2349          85 PLYSDMDFVLKVKEFAKMRQNFNDTRFICPNARSSLDLVFKMIGRM-RFVLGTPISPLFCPPSALNFGTCRDDKI  158 (164)
Q Consensus        85 d~pGH~~~~l~~~~~~~l~~~~~~~~~l~p~~~~t~~~~~~l~~E~-~lf~~s~~iHiGg~DE~~~~~~~~~~~~  158 (164)
                      |+|||+++++++++|..+++.+.+.++|||++|+|++|+++|++|+ ++|| +++||||| ||++.+|.|+.|++
T Consensus        81 d~pGH~~~~l~~~~~~~l~~~~~~~~~l~~~~~~t~~fi~~li~ev~~~f~-s~~~HIG~-DE~~~~g~~~~~~~  153 (301)
T cd06565          81 QTLGHLEFILKHPEFRHLREVDDPPQTLCPGEPKTYDFIEEMIRQVLELHP-SKYIHIGM-DEAYDLGRGRSLRK  153 (301)
T ss_pred             CCHHHHHHHHhCcccccccccCCCCCccCCCChhHHHHHHHHHHHHHHhCC-CCeEEECC-CcccccCCCHHHHH
Confidence            9999999999999999999888788999999999999999999999 9999 99999999 99999999999886



GcnA is an exoglucosidase which cleaves N-acetyl-beta-D-galactosamine (NAG) and N-acetyl-beta-D-galactosamine residues from 4-methylumbelliferylated (4MU) substrates, as well as cleaving NAG from chito-oligosaccharides (i.e. NAG polymers). In contrast, sulfated forms of the substrate are unable to be cleaved and act instead as mild competitive inhibitors. Additionally, the enzyme is known to be poisoned by several first-row transition metals as well as by mercury. GcnA forms a homodimer with subunits comprised of three domains, an N-terminal zincin-like domain, this central catalytic GH20 domain, and a C-terminal alpha helical domain. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

>cd06569 GH20_Sm-chitobiase-like The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin Back     alignment and domain information
>cd06570 GH20_chitobiase-like_1 A functionally uncharacterized subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the chitobiase of Serratia marcescens, a beta-N-1,4-acetylhexosaminidase that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin Back     alignment and domain information
>cd06562 GH20_HexA_HexB-like Beta-N-acetylhexosaminidases catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides Back     alignment and domain information
>cd06563 GH20_chitobiase-like The chitobiase of Serratia marcescens is a beta-N-1,4-acetylhexosaminidase with a glycosyl hydrolase family 20 (GH20) domain that hydrolyzes the beta-1,4-glycosidic linkages in oligomers derived from chitin Back     alignment and domain information
>PF00728 Glyco_hydro_20: Glycosyl hydrolase family 20, catalytic domain; InterPro: IPR015883 Glycoside hydrolase family 20 GH20 from CAZY comprises enzymes with several known activities; beta-hexosaminidase (3 Back     alignment and domain information
>cd06568 GH20_SpHex_like A subgroup of the Glycosyl hydrolase family 20 (GH20) catalytic domain found in proteins similar to the N-acetylhexosaminidase from Streptomyces plicatus (SpHex) Back     alignment and domain information
>cd06564 GH20_DspB_LnbB-like Glycosyl hydrolase family 20 (GH20) catalytic domain of dispersin B (DspB), lacto-N-biosidase (LnbB) and related proteins Back     alignment and domain information
>cd02742 GH20_hexosaminidase Beta-N-acetylhexosaminidases of glycosyl hydrolase family 20 (GH20) catalyze the removal of beta-1,4-linked N-acetyl-D-hexosamine residues from the non-reducing ends of N-acetyl-beta-D-hexosaminides including N-acetylglucosides and N-acetylgalactosides Back     alignment and domain information
>KOG2499|consensus Back     alignment and domain information
>COG3525 Chb N-acetyl-beta-hexosaminidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF02638 DUF187: Glycosyl hydrolase like GH101; InterPro: IPR003790 This entry describes proteins of unknown function Back     alignment and domain information
>PF14871 GHL6: Hypothetical glycosyl hydrolase 6 Back     alignment and domain information
>COG1649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF02449 Glyco_hydro_42: Beta-galactosidase; InterPro: IPR013529 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF13200 DUF4015: Putative glycosyl hydrolase domain Back     alignment and domain information
>PF10566 Glyco_hydro_97: Glycoside hydrolase 97 ; InterPro: IPR019563 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK09441 cytoplasmic alpha-amylase; Reviewed Back     alignment and domain information
>PRK12313 glycogen branching enzyme; Provisional Back     alignment and domain information
>PF00150 Cellulase: Cellulase (glycosyl hydrolase family 5); InterPro: IPR001547 O-Glycosyl hydrolases 3 Back     alignment and domain information
>COG0296 GlgB 1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00642 Aamy Alpha-amylase domain Back     alignment and domain information
>KOG0470|consensus Back     alignment and domain information
>PF00128 Alpha-amylase: Alpha amylase, catalytic domain; InterPro: IPR006047 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PLN00196 alpha-amylase; Provisional Back     alignment and domain information
>PF13199 Glyco_hydro_66: Glycosyl hydrolase family 66; PDB: 3VMO_A 3VMN_A 3VMP_A Back     alignment and domain information
>TIGR02403 trehalose_treC alpha,alpha-phosphotrehalase Back     alignment and domain information
>TIGR02402 trehalose_TreZ malto-oligosyltrehalose trehalohydrolase Back     alignment and domain information
>PRK14705 glycogen branching enzyme; Provisional Back     alignment and domain information
>PLN02361 alpha-amylase Back     alignment and domain information
>TIGR02104 pulA_typeI pullulanase, type I Back     alignment and domain information
>PLN02784 alpha-amylase Back     alignment and domain information
>PRK05402 glycogen branching enzyme; Provisional Back     alignment and domain information
>PF07555 NAGidase: beta-N-acetylglucosaminidase ; InterPro: IPR011496 This family consists of both eukaryotic and prokaryotic hyaluronidases Back     alignment and domain information
>PRK01060 endonuclease IV; Provisional Back     alignment and domain information
>PRK14706 glycogen branching enzyme; Provisional Back     alignment and domain information
>TIGR02100 glgX_debranch glycogen debranching enzyme GlgX Back     alignment and domain information
>TIGR01515 branching_enzym alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase Back     alignment and domain information
>PRK10785 maltodextrin glucosidase; Provisional Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>PRK12568 glycogen branching enzyme; Provisional Back     alignment and domain information
>PRK14510 putative bifunctional 4-alpha-glucanotransferase/glycogen debranching enzyme; Provisional Back     alignment and domain information
>TIGR02401 trehalose_TreY malto-oligosyltrehalose synthase Back     alignment and domain information
>PRK14582 pgaB outer membrane N-deacetylase; Provisional Back     alignment and domain information
>smart00518 AP2Ec AP endonuclease family 2 Back     alignment and domain information
>PRK10933 trehalose-6-phosphate hydrolase; Provisional Back     alignment and domain information
>PLN02447 1,4-alpha-glucan-branching enzyme Back     alignment and domain information
>PF02679 ComA: (2R)-phospho-3-sulfolactate synthase (ComA); InterPro: IPR003830 Methanogenic archaea produce methane via the anaerobic reduction of acetate or single carbon compounds [] Back     alignment and domain information
>PRK14511 maltooligosyl trehalose synthase; Provisional Back     alignment and domain information
>PLN02960 alpha-amylase Back     alignment and domain information
>PRK10340 ebgA cryptic beta-D-galactosidase subunit alpha; Reviewed Back     alignment and domain information
>PRK03705 glycogen debranching enzyme; Provisional Back     alignment and domain information
>TIGR03849 arch_ComA phosphosulfolactate synthase Back     alignment and domain information
>TIGR02456 treS_nterm trehalose synthase Back     alignment and domain information
>PRK09505 malS alpha-amylase; Reviewed Back     alignment and domain information
>PF02065 Melibiase: Melibiase; InterPro: IPR000111 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF14488 DUF4434: Domain of unknown function (DUF4434) Back     alignment and domain information
>PF01301 Glyco_hydro_35: Glycosyl hydrolases family 35; InterPro: IPR001944 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF02836 Glyco_hydro_2_C: Glycosyl hydrolases family 2, TIM barrel domain; InterPro: IPR006103 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PF05913 DUF871: Bacterial protein of unknown function (DUF871); InterPro: IPR008589 This family consists of several conserved hypothetical proteins from bacteria and archaea Back     alignment and domain information
>COG1874 LacA Beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd00452 KDPG_aldolase KDPG and KHG aldolase Back     alignment and domain information
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional Back     alignment and domain information
>PRK10150 beta-D-glucuronidase; Provisional Back     alignment and domain information
>cd01299 Met_dep_hydrolase_A Metallo-dependent hydrolases, subgroup A is part of the superfamily of metallo-dependent hydrolases, a large group of proteins that show conservation in their 3-dimensional fold (TIM barrel) and in details of their active site Back     alignment and domain information
>PF01261 AP_endonuc_2: Xylose isomerase-like TIM barrel; InterPro: IPR012307 This TIM alpha/beta barrel structure is found in xylose isomerase (P19148 from SWISSPROT) and in endonuclease IV (P12638 from SWISSPROT, 3 Back     alignment and domain information
>cd06592 GH31_glucosidase_KIAA1161 KIAA1161 is an uncharacterized Homo sapiens protein with a glycosyl hydrolase family 31 (GH31) domain that is homologous to the Escherichia coli YihQ glucosidase Back     alignment and domain information
>cd06593 GH31_xylosidase_YicI YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose Back     alignment and domain information
>TIGR03234 OH-pyruv-isom hydroxypyruvate isomerase Back     alignment and domain information
>PRK14507 putative bifunctional 4-alpha-glucanotransferase/malto-oligosyltrehalose synthase; Provisional Back     alignment and domain information
>KOG0256|consensus Back     alignment and domain information
>PF01055 Glyco_hydro_31: Glycosyl hydrolases family 31 ; InterPro: IPR000322 O-Glycosyl hydrolases 3 Back     alignment and domain information
>TIGR01866 cas_Csn2 CRISPR-associated protein, Csn2 family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query164
2epl_X 627 N-acetyl-beta-D-glucosaminidase; glycoside hydrola 1e-11
>2epl_X N-acetyl-beta-D-glucosaminidase; glycoside hydrolase, family 20, GCNA, hydro; 1.40A {Streptococcus gordonii} PDB: 2epk_X 2epm_X 2epn_A* 2epo_A Length = 627 Back     alignment and structure
 Score = 60.4 bits (146), Expect = 1e-11
 Identities = 22/128 (17%), Positives = 51/128 (39%), Gaps = 11/128 (8%)

Query: 7   FKEVLVHLDL-KGAPPSLTYLKEILPILAYTGATSLLIEWEDTLPYS----LGFDNTNPF 61
           ++++    D  + A  +L+  K+++ +LA  G ++  +  EDT         G+     +
Sbjct: 84  YEDLAYMADCSRNAVLNLSSAKKMIEVLALMGYSTFELYMEDTYEIENQPYFGYFR-GRY 142

Query: 62  RETEIFIILAAAESNGLASIPLVPLYSDMDFVLKV--KEFAKMRQNFNDTRFICPNARSS 119
              E+  I   A    ++ +P +   + +   +K   KE  ++R   +    +       
Sbjct: 143 TVAELQEIEDYAADFDMSFVPCIQTLAHLSAFVKWGIKEVQELRDVED---ILLIGEEKV 199

Query: 120 LDLVFKMI 127
            DL+  M 
Sbjct: 200 YDLIEGMF 207


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query164
3rcn_A 543 Beta-N-acetylhexosaminidase; structural genomics, 100.0
1now_A 507 Beta-hexosaminidase beta chain; (beta/alpha)8-barr 100.0
2gjx_A 507 Beta-hexosaminidase alpha chain; beta-hexosaminida 100.0
3ozo_A 572 N-acetylglucosaminidase; beta-N-acetyl-D-hexosamin 100.0
2epl_X 627 N-acetyl-beta-D-glucosaminidase; glycoside hydrola 100.0
1yht_A 367 DSPB; beta barrel, hydrolase; 2.00A {Aggregatibact 100.0
3gh5_A 525 HEX1, beta-hexosaminidase; beta-N-acetylhexosamini 100.0
1c7s_A 858 Beta-N-acetylhexosaminidase; glycosyl hydrolase, c 100.0
2yl6_A 434 Beta-N-acetylhexosaminidase; peptidoglycan-anchor, 100.0
1jak_A 512 Beta-N-acetylhexosaminidase; glycoside hydrolase, 100.0
2yl5_A 442 Beta-N-acetylhexosaminidase; hydrolase; 2.15A {Str 100.0
2v5c_A 594 O-GLCNACASE NAGJ; glycosidase, GH84, GH84C, hydrol 99.93
2v5d_A 737 O-GLCNACASE NAGJ; family 32 carbohydrate binding m 99.92
2cho_A 716 Glucosaminidase, hexosaminiase; O-GLCNACASE, hydro 99.85
3tty_A 675 Beta-GAL, beta-galactosidase; TIM barrel, glycosid 97.71
1kwg_A 645 Beta-galactosidase; TIM barrel, glycoside hydrolas 97.1
1wky_A 464 Endo-beta-1,4-mannanase; TIM barrel, catalytic dom 96.22
2whl_A 294 Beta-mannanase, baman5; glycoside hydrolase, hydro 96.17
3mi6_A 745 Alpha-galactosidase; NESG, structural genomics, PS 95.99
3dhu_A 449 Alpha-amylase; structural genomics, hydrolase, gly 95.85
3m07_A 618 Putative alpha amylase; IDP00968, csgid, structura 95.83
2xn2_A 732 Alpha-galactosidase; hydrolase, glycosidase; HET: 95.75
1ea9_C 583 Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A 95.53
2yfo_A 720 Alpha-galactosidase-sucrose kinase agask; hydrolas 95.49
2d73_A 738 Alpha-glucosidase SUSB; glycoside hydrolase family 95.43
1j0h_A 588 Neopullulanase; beta-alpha-barrels, hydrolase; 1.9 95.43
3vup_A 351 Beta-1,4-mannanase; TIM barrel, digestive fluid, H 95.32
1uuq_A 440 Mannosyl-oligosaccharide glucosidase; hydrolase, m 95.27
3nco_A 320 Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1 95.23
2bhu_A 602 Maltooligosyltrehalose trehalohydrolase; alpha-amy 95.21
3jug_A 345 Beta-mannanase; TIM-barrel, glycosidase, hydrolase 94.94
1ur4_A 399 Galactanase; hydrolase, beta-1, glycoside hydrolas 94.68
1rh9_A 373 Endo-beta-mannanase; endo-beta-mannase, retaining, 94.59
3k1d_A 722 1,4-alpha-glucan-branching enzyme; mycobacterium t 94.48
2c0h_A 353 Mannan endo-1,4-beta-mannosidase; hydrolase, signa 94.36
1fob_A 334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 94.35
3pzg_A 383 Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 94.28
1lwj_A 441 4-alpha-glucanotransferase; alpha-amylase family, 94.24
3d3a_A 612 Beta-galactosidase; protein structure initiative I 94.09
1wzl_A 585 Alpha-amylase II; pullulan, GH-13, alpha-amylase f 93.88
1ht6_A 405 AMY1, alpha-amylase isozyme 1; barley, beta-alpha- 93.84
3aof_A 317 Endoglucanase; glycosyl hydrolase family 5, cellul 93.68
3a24_A 641 Alpha-galactosidase; glycoside hydrolase family 97 93.67
2dh2_A 424 4F2 cell-surface antigen heavy chain; TIM-barrel, 93.55
1ece_A 358 Endocellulase E1; glycosyl hydrolase; HET: BGC; 2. 93.54
1h1n_A 305 Endo type cellulase ENGI; hydrolase, glycosyl hydr 93.41
1jae_A 471 Alpha-amylase; glycosidase, carbohydrate metabolis 93.18
1wpc_A 485 Glucan 1,4-alpha-maltohexaosidase; maltohexaose-pr 93.05
1bqc_A 302 Protein (beta-mannanase); glycosyl hydrolase, fami 93.04
1ceo_A 343 Cellulase CELC; glycosyl hydrolase, family A/5 of 93.04
2z1k_A 475 (NEO)pullulanase; hydrolase, structural genomics, 93.01
3zss_A 695 Putative glucanohydrolase PEP1A; alpha-glucan bios 92.92
3civ_A 343 Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1. 92.75
4aie_A 549 Glucan 1,6-alpha-glucosidase; hydrolase, glycoside 92.73
2w61_A 555 GAS2P, glycolipid-anchored surface protein 2; glyc 92.72
3bh4_A 483 Alpha-amylase; calcium, carbohydrate metabolism, g 92.67
1tvn_A 293 Cellulase, endoglucanase G; glycoside hydrolase, C 92.64
3icg_A 515 Endoglucanase D; cellulase, xylanase, carbohydrate 92.6
1vjz_A 341 Endoglucanase; TM1752, structural genomics, JCSG, 92.59
1qnr_A 344 Endo-1,4-B-D-mannanase; hydrolase, anomalous scatt 92.57
1ud2_A 480 Amylase, alpha-amylase; calcium-free, alkaline, hy 92.43
3ayr_A 376 Endoglucanase; TIM barrel, hydrolase, carbohydrate 92.4
4gqr_A 496 Pancreatic alpha-amylase; glycosyl hydrolase, diab 92.4
3aj7_A 589 Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydro 92.31
1hjs_A 332 Beta-1,4-galactanase; 4-galactanases, family 53 gl 92.31
1zja_A 557 Trehalulose synthase; sucrose isomerase, alpha-amy 92.25
4fnq_A 729 Alpha-galactosidase AGAB; glycoside hydrolase, hyd 92.23
1gcy_A 527 Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-b 92.1
3faw_A 877 Reticulocyte binding protein; TIM barrel, beta bar 92.07
1egz_A 291 Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CL 92.0
2wsk_A 657 Glycogen debranching enzyme; carbohydrate metaboli 91.95
3vmn_A 643 Dextranase; TIM barrel, immunoglobrin fold, greek- 91.93
2aaa_A 484 Alpha-amylase; glycosidase; 2.10A {Aspergillus nig 91.9
2wan_A 921 Pullulanase; hydrolase, glycoside hydrolase, polys 91.88
2wc7_A 488 Alpha amylase, catalytic region; CD/PUL-hydrolyzin 91.83
1hvx_A 515 Alpha-amylase; hydrolase, glycosyltransferase, the 91.78
1m53_A 570 Isomaltulose synthase; klebsiella SP. LX3, sucrose 91.74
2guy_A 478 Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; 91.68
3pzt_A 327 Endoglucanase; alpha/beta barrel, glycosyl hydrola 91.67
2zic_A 543 Dextran glucosidase; TIM barrel, (beta/alpha)8-bar 91.65
1m7x_A 617 1,4-alpha-glucan branching enzyme; alpha/beta barr 91.57
4hty_A 359 Cellulase; (alpha/beta)8 barrel, family 5 endogluc 91.52
3ndz_A 345 Endoglucanase D; cellotriose, xylanase, carbohydra 91.35
2ze0_A 555 Alpha-glucosidase; TIM barrel, glucoside hydrolase 91.34
3edf_A 601 FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin c 91.31
4aee_A 696 Alpha amylase, catalytic region; hydrolase, hypert 91.08
3k8k_A 669 Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, bet 91.05
2e8y_A 718 AMYX protein, pullulanase; multiple domain, beta-a 91.04
1vem_A 516 Beta-amylase; beta-alpha-barrels, optimum PH, hydr 91.0
1yq2_A 1024 Beta-galactosidase; glycosyl hydrolase family 2, T 90.92
4aef_A 645 Neopullulanase (alpha-amylase II); hydrolase, ther 90.87
3u7v_A 552 Beta-galactosidase; structural genomics, PSI-biolo 90.85
1ji1_A 637 Alpha-amylase I; beta/alpha barrel, hydrolase; 1.6 90.82
1wza_A 488 Alpha-amylase A; hydrolase, halophilic, thermophil 90.8
1uok_A 558 Oligo-1,6-glucosidase; sugar degradation, hydrolas 90.77
1mxg_A 435 Alpha amylase; hyperthermostable, family 13 glycos 90.72
4awe_A 387 Endo-beta-D-1,4-mannanase; hydrolase, endo-mannana 90.65
7a3h_A 303 Endoglucanase; hydrolase, cellulose degradation, g 90.65
2jep_A 395 Xyloglucanase; family 5, plant cell WALL, hydrolas 90.64
3qr3_A 340 Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A 90.62
1g94_A 448 Alpha-amylase; beta-alpha-8-barrel, 3 domain struc 90.58
1g5a_A 628 Amylosucrase; glycosyltransferase, glycoside hydro 90.54
3czg_A 644 Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 89.71
3vgf_A 558 Malto-oligosyltrehalose trehalohydrolase; alpha/be 89.65
1ua7_A 422 Alpha-amylase; beta-alpha-barrels, acarbose, greek 89.38
2xsa_A 447 Ogoga, hyaluronoglucosaminidase; O-GLCNACYLATION, 89.38
3l55_A 353 B-1,4-endoglucanase/cellulase; putative beta-1,4-e 89.21
3aml_A 755 OS06G0726400 protein; starch-branching, transferas 89.15
1qho_A 686 Alpha-amylase; glycoside hydrolase, starch degrada 88.96
3qho_A 458 Endoglucanase, 458AA long hypothetical endo-1,4-be 88.93
1gjw_A 637 Maltodextrin glycosyltransferase; alpha-amylase, m 88.75
3n9k_A 399 Glucan 1,3-beta-glucosidase; aromatic entranceway/ 88.42
2p0o_A 372 Hypothetical protein DUF871; structural genomics, 88.33
1bf2_A 750 Isoamylase; hydrolase, glycosidase, debranching en 88.32
1h4p_A 408 Glucan 1,3-beta-glucosidase I/II; hydrolase, gluca 88.19
3bc9_A 599 AMYB, alpha amylase, catalytic region; acarbose, t 87.97
3ucq_A 655 Amylosucrase; thermostability, amylose synthesis, 87.91
1x7f_A 385 Outer surface protein; structural genomics, unknow 87.87
1g01_A 364 Endoglucanase; alpha/beta barrel, TIM barrel, hydr 87.75
3og2_A 1003 Beta-galactosidase; TIM barrel domain, glycoside h 87.72
1edg_A 380 Endoglucanase A; family A, cellulases, xylanases, 87.58
1tg7_A 971 Beta-galactosidase; TIM barrel domain, glycoside h 87.46
3fn9_A 692 Putative beta-galactosidase; structural genomics, 87.35
1d3c_A 686 Cyclodextrin glycosyltransferase; alpha-amylase, p 87.34
4e8d_A 595 Glycosyl hydrolase, family 35; TIM barrel, beta-pr 87.1
1qwg_A251 PSL synthase;, (2R)-phospho-3-sulfolactate synthas 87.08
2y8k_A 491 Arabinoxylanase, carbohydrate binding family 6; hy 86.97
2osx_A 481 Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel 86.84
3bmv_A 683 Cyclomaltodextrin glucanotransferase; glycosidase, 86.84
2ya0_A 714 Putative alkaline amylopullulanase; hydrolase, gly 86.79
2vr5_A 718 Glycogen operon protein GLGX; hydrolase, glycosida 86.45
1jz7_A 1023 Lactase, beta-galactosidase, LACZ; TIM barrel (alp 86.32
3cmg_A 667 Putative beta-galactosidase; structural genomics, 86.3
1cyg_A 680 Cyclodextrin glucanotransferase; glycosyltransfera 85.48
1iv8_A 720 Maltooligosyl trehalose synthase; beta alpha barre 85.39
1gqi_A 708 Alpha-glucuronidase; (alpha-beta)8 barrel, glycosi 84.42
2cks_A 306 Endoglucanase E-5; carbohydrate metabolism, polysa 84.15
2wqp_A 349 Polysialic acid capsule biosynthesis protein SIAC; 83.6
3thd_A 654 Beta-galactosidase; TIM-barrel domain, glycosyl hy 83.41
3aie_A844 Glucosyltransferase-SI; beta-alpha-barrels; HET: M 83.19
3ttq_A1108 Dextransucrase; (beta/alpha)8 barrel, transferase; 83.08
1zy9_A 564 Alpha-galactosidase; TM1192, struc genomics, joint 83.03
4e38_A232 Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho 82.66
2j78_A 468 Beta-glucosidase A; family 1, hydrolase, inhibitor 82.5
1vli_A 385 Spore coat polysaccharide biosynthesis protein SP; 82.0
2ya1_A 1014 Putative alkaline amylopullulanase; hydrolase, gly 81.85
3oba_A 1032 Beta-galactosidase; TIM barrel, tetramer, GH2, gly 81.61
3gnh_A403 L-lysine, L-arginine carboxypeptidase CC2672; N-me 81.39
1qtw_A 285 Endonuclease IV; DNA repair enzyme, TIM barrel, tr 80.99
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 80.99
4f9d_A 618 Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylas; 80.51
3s5u_A220 Putative uncharacterized protein; crispr, crispr a 80.13
1vff_A 423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 80.12
>3rcn_A Beta-N-acetylhexosaminidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta half sandwich; HET: MSE; 2.51A {Arthrobacter aurescens} Back     alignment and structure
Probab=100.00  E-value=4.6e-49  Score=351.44  Aligned_cols=159  Identities=10%  Similarity=0.087  Sum_probs=137.8

Q ss_pred             CCCCCCCceeEEEeCCCCCCCHHHHHHHHHHHHhcCCCEEEEEeecc--CCCCCC-------CC----------------
Q psy2349           2 VTPSTFKEVLVHLDLKGAPPSLTYLKEILPILAYTGATSLLIEWEDT--LPYSLG-------FD----------------   56 (164)
Q Consensus         2 ~D~P~~~~Rg~~lD~~r~~~~~~~lk~~i~~la~~k~N~l~l~~ed~--~p~~~~-------~~----------------   56 (164)
                      +|+|+|+|||+|||+||||+++++||++||.||.+|+|.||+|++|+  ||++..       ..                
T Consensus       133 ~D~Prf~~RG~mLDvsRhf~~~~~ik~~ID~MA~~KlN~lH~HltDdqgwriei~~yP~Lt~~Ga~r~~t~~g~~~~~~~  212 (543)
T 3rcn_A          133 EDKPRFGYRGTMLDVARHFMPKDNVLRFIEVMAMHKLNVLHLHLTDDQGWRMQINRYPKLTETGAWRRESSLGSWRAGVF  212 (543)
T ss_dssp             EECCSCSEEEEEEETTTSCCCHHHHHHHHHHHHHTTCCEEEEECEETTEECBCCSSCTHHHHTTTEESCCBSSCGGGCCB
T ss_pred             EecCCCCccccccccCCCccCHHHHHHHHHHHHHcCCcEEEeecccccCcchhcccchhhhhhccccccccccccccccc
Confidence            69999999999999999999999999999999999999999999875  455433       11                


Q ss_pred             ----CCCCCCHHHHHHHHHHHHHcCCeEeeccCCcchHHHHhc-Cccchhhh---c--------CCCCCCcccCCChhhH
Q psy2349          57 ----NTNPFRETEIFIILAAAESNGLASIPLVPLYSDMDFVLK-VKEFAKMR---Q--------NFNDTRFICPNARSSL  120 (164)
Q Consensus        57 ----~~~~yT~~dir~iv~yA~~~gI~VIPeid~pGH~~~~l~-~~~~~~l~---~--------~~~~~~~l~p~~~~t~  120 (164)
                          .+++||++|+|+||+||++|||+||||||+|||+.++++ +|++....   .        .....++||| +|+||
T Consensus       213 ~~~~~~g~YT~~di~eIv~YA~~rgI~VIPEID~PGH~~a~l~aypeL~~~~~~d~~~~~~~~~~g~~~~~L~p-~~~ty  291 (543)
T 3rcn_A          213 DGRPHGGFYTQDDLREIVAFAADRHITVIPEIDVPGHSQAAIAAYPELGAGPADGSSPVEVWTRWGINETVLEV-SETSL  291 (543)
T ss_dssp             CCCCEECCBCHHHHHHHHHHHHHTTCEEEEECCCSSSCHHHHHHCGGGSCCC----CCCCCCCSCSCCSCCCCC-SHHHH
T ss_pred             cCCccCCCcCHHHHHHHHHHHHHcCCEEeeeeccchhHHHHHHhChhhccCccccCcccccccccCcCCCccCC-CHHHH
Confidence                257999999999999999999999999999999999987 55543221   0        1123478999 99999


Q ss_pred             HHHHHHHHhc-ccCCCCCeeeccCCccCCC--CCCCHHHHHHHHhC
Q psy2349         121 DLVFKMIGRM-RFVLGTPISPLFCPPSALN--FGTCRDDKISVVAF  163 (164)
Q Consensus       121 ~~~~~l~~E~-~lf~~s~~iHiGg~DE~~~--~~~~~~~~~~m~~~  163 (164)
                      +|+++|++|+ ++|| ++|||||| ||+..  |..||.||++|++.
T Consensus       292 ~fl~~v~~Ev~~lFp-~~~iHiGg-DE~~~~~W~~~p~~~~~m~~~  335 (543)
T 3rcn_A          292 EFYRNVLDEVVEIFP-SPWISLGG-DEVPLTQWQASAQAQAKAAEL  335 (543)
T ss_dssp             HHHHHHHHHHHHHCC-CSEEEEEC-CCCCSHHHHTCHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhCC-CceEEEcc-ccccccccccCHHHHHHHHHh
Confidence            9999999999 9999 99999999 99986  68999999999863



>1now_A Beta-hexosaminidase beta chain; (beta/alpha)8-barrel, homodimer, family 20 glycosidase, HYDR; HET: NAG IFG; 2.20A {Homo sapiens} SCOP: c.1.8.6 d.92.2.1 PDB: 1nou_A* 1np0_A* 2gjx_B* 3lmy_A* 1o7a_A* 2gk1_B* Back     alignment and structure
>2gjx_A Beta-hexosaminidase alpha chain; beta-hexosaminidase A, glycosidase, TAY-sachs disease, GM2 ganglisode, TIM barrel, hydrolase; HET: NAG BMA NDG; 2.80A {Homo sapiens} SCOP: c.1.8.6 d.92.2.1 PDB: 2gk1_A* Back     alignment and structure
>3ozo_A N-acetylglucosaminidase; beta-N-acetyl-D-hexosaminidase, hydrolase-hydrolase inhibito; HET: NGT; 2.00A {Ostrinia furnacalis} PDB: 3nsn_A* 3nsm_A* 3ozp_A* 3s6t_A* 3vtr_A* Back     alignment and structure
>2epl_X N-acetyl-beta-D-glucosaminidase; glycoside hydrolase, family 20, GCNA, hydro; 1.40A {Streptococcus gordonii} PDB: 2epk_X 2epm_X 2epn_A* 2epo_A Back     alignment and structure
>1yht_A DSPB; beta barrel, hydrolase; 2.00A {Aggregatibacter actinomycetemcomitans} SCOP: c.1.8.6 Back     alignment and structure
>3gh5_A HEX1, beta-hexosaminidase; beta-N-acetylhexosaminidase, glycosphingolipids, paenibacill GH20, hydrolase, structural genomics, NPPSFA; HET: NAG; 1.60A {Paenibacillus SP} PDB: 3gh4_A* 3gh7_A* 3sur_A* 3sus_A* 3sut_A* 3suu_A* 3suv_A* 3suw_A* Back     alignment and structure
>1c7s_A Beta-N-acetylhexosaminidase; glycosyl hydrolase, chitinolysis, A/B(TIM)-barrel, site directed mutagenesis; HET: CBS; 1.80A {Serratia marcescens} SCOP: b.1.18.2 b.2.2.3 c.1.8.6 d.92.2.1 PDB: 1c7t_A* 1qba_A 1qbb_A* Back     alignment and structure
>2yl6_A Beta-N-acetylhexosaminidase; peptidoglycan-anchor, hydrolase; HET: ETE; 1.60A {Streptococcus pneumoniae} PDB: 2yll_A* 2yl8_A* 3rpm_A* Back     alignment and structure
>1jak_A Beta-N-acetylhexosaminidase; glycoside hydrolase, family 20, substrate-assisted catalysis, alpha/beta barrel, isofagomin inhibitor complex; HET: IFG; 1.75A {Streptomyces plicatus} SCOP: c.1.8.6 d.92.2.1 PDB: 1hp4_A* 1hp5_A* 1m01_A* 1m04_A* 1m03_A* Back     alignment and structure
>2yl5_A Beta-N-acetylhexosaminidase; hydrolase; 2.15A {Streptococcus pneumoniae} PDB: 2yla_A* 2yl9_A* Back     alignment and structure
>2v5c_A O-GLCNACASE NAGJ; glycosidase, GH84, GH84C, hydrolase, coiled coil, family 84 glycoside hydrolase, carbohydrate binding module; 2.10A {Clostridium perfringens} PDB: 2cbj_A* 2cbi_A 2vur_A* 2x0y_A* 2j62_A* 2wb5_A* 2xpk_A* 2yds_A* 2ydr_A* 2ydq_A* Back     alignment and structure
>2v5d_A O-GLCNACASE NAGJ; family 32 carbohydrate binding module, glycosidase, GH84, GH84C, CBM32, hydrolase, coiled coil; 3.30A {Clostridium perfringens} Back     alignment and structure
>2cho_A Glucosaminidase, hexosaminiase; O-GLCNACASE, hydrolase, N-acetylglucosamine; 1.85A {Bacteroides thetaiotaomicron} SCOP: a.246.1.1 c.1.8.10 d.92.2.3 PDB: 2chn_A 2vvn_A* 2vvs_A* 2x0h_A* 2xm2_A* 2w4x_A* 2w66_A* 2w67_A* 2wca_A* 2xj7_A* 2xm1_A* 2j47_A* 2jiw_A* 2wzh_A* 2wzi_A* 2j4g_A* Back     alignment and structure
>3tty_A Beta-GAL, beta-galactosidase; TIM barrel, glycoside hydrolase, hydrolase; HET: GLA; 2.25A {Bacillus circulans subsp} PDB: 3tts_A* Back     alignment and structure
>1kwg_A Beta-galactosidase; TIM barrel, glycoside hydrolase family 42, trimer, hydrolase; 1.60A {Thermus thermophilus} SCOP: b.71.1.1 c.1.8.1 c.23.16.5 PDB: 1kwk_A* Back     alignment and structure
>1wky_A Endo-beta-1,4-mannanase; TIM barrel, catalytic domain, CBM, hydrolase; 1.65A {Bacillus SP} SCOP: b.18.1.31 c.1.8.3 Back     alignment and structure
>2whl_A Beta-mannanase, baman5; glycoside hydrolase, hydrolase; HET: MAN BMA; 1.40A {Bacillus agaradhaerens} PDB: 2whj_A Back     alignment and structure
>3mi6_A Alpha-galactosidase; NESG, structural genomics, PSI-2, protein structure initiati northeast structural genomics consortium, hydrolase; 2.70A {Lactobacillus brevis} Back     alignment and structure
>3dhu_A Alpha-amylase; structural genomics, hydrolase, glycosidase, PSI-2, protein structure initiative; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>3m07_A Putative alpha amylase; IDP00968, csgid, structural genomics, center for structural genomics of infectious diseases, unknown function; HET: BTB PG4 PGE; 1.40A {Salmonella enterica subsp} Back     alignment and structure
>2xn2_A Alpha-galactosidase; hydrolase, glycosidase; HET: SME GLA IMD; 1.58A {Lactobacillus acidophilus ncfm} PDB: 2xn1_A* 2xn0_A* Back     alignment and structure
>1ea9_C Cyclomaltodextrinase; hydrolase, glycosidase; 3.2A {Bacillus SP} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>2yfo_A Alpha-galactosidase-sucrose kinase agask; hydrolase; HET: GLA GAL; 1.35A {Ruminococcus gnavus E1} PDB: 2yfn_A* Back     alignment and structure
>2d73_A Alpha-glucosidase SUSB; glycoside hydrolase family 97, TIM barrel; 1.60A {Bacteroides thetaiotaomicron vpi-5482} PDB: 2zq0_A* 2jke_A* 2jka_A* 2jkp_A* Back     alignment and structure
>1j0h_A Neopullulanase; beta-alpha-barrels, hydrolase; 1.90A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1j0i_A* 1j0j_A* 1j0k_A* 1sma_A 1gvi_A* Back     alignment and structure
>3vup_A Beta-1,4-mannanase; TIM barrel, digestive fluid, HYD; 1.05A {Aplysia kurodai} Back     alignment and structure
>1uuq_A Mannosyl-oligosaccharide glucosidase; hydrolase, mannosidase, mannan, glycoside hydrolase, family 5; 1.5A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uz4_A* Back     alignment and structure
>3nco_A Endoglucanase fncel5A; fncel5A, F. nodosum RT17-B1, hydrolase; 1.50A {Fervidobacterium nodosum} PDB: 3rjx_A 3rjy_A* Back     alignment and structure
>2bhu_A Maltooligosyltrehalose trehalohydrolase; alpha-amylase, protein-carbohydrate complex, desiccation resistance; HET: TRS PGE; 1.1A {Deinococcus radiodurans} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 2bhy_A* 2bhz_A* 2bxy_A* 2bxz_A* 2by0_A* 2by1_A* 2by2_A* 2by3_A* Back     alignment and structure
>3jug_A Beta-mannanase; TIM-barrel, glycosidase, hydrolase; 1.60A {Bacillus} Back     alignment and structure
>1ur4_A Galactanase; hydrolase, beta-1, glycoside hydrolase, substrate specificity, pectin, GH-A, family 53, plant cell WALL degradation; HET: B2G PGE; 2.2A {Bacillus licheniformis} SCOP: c.1.8.3 PDB: 1r8l_A* 1ur0_A* 2ccr_A* 2j74_A* 2gft_A* Back     alignment and structure
>1rh9_A Endo-beta-mannanase; endo-beta-mannase, retaining, glycoside hydrolase family 5; 1.50A {Solanum lycopersicum} SCOP: c.1.8.3 Back     alignment and structure
>3k1d_A 1,4-alpha-glucan-branching enzyme; mycobacterium tuberculosis H37RV, mesophilic human pathogen, RV1326C gene, glycosyl transferase; 2.33A {Mycobacterium tuberculosis} Back     alignment and structure
>2c0h_A Mannan endo-1,4-beta-mannosidase; hydrolase, signal, TIM alpha/beta barrel; 1.6A {Mytilus edulis} SCOP: c.1.8.3 Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>3pzg_A Mannan endo-1,4-beta-mannosidase. glycosyl hydrol 5; alpha/beta barrel, glycosyl hydrolase, sugar binding, secret hydrolase; 1.40A {Thermotoga petrophila} PDB: 3pz9_A 3pzi_A* 3pzm_A 3pzn_A* 3pzo_A* 3pzq_A* Back     alignment and structure
>1lwj_A 4-alpha-glucanotransferase; alpha-amylase family, acarbose, (beta/alpha)8 barrel; HET: ACG; 2.50A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1lwh_A* Back     alignment and structure
>3d3a_A Beta-galactosidase; protein structure initiative II, PSI II, NYSGXRC, 11092F, structural genomics; 2.15A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1wzl_A Alpha-amylase II; pullulan, GH-13, alpha-amylase family, hydrolase; 2.00A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1ji2_A 1bvz_A 1vfk_A* 3a6o_A* 1wzm_A 1jf6_A 1wzk_A 2d2o_A* 1jib_A* 1jl8_A* 1vb9_A* 1g1y_A* 1vfo_A* 1vfm_A* 1vfu_A* 1jf5_A Back     alignment and structure
>1ht6_A AMY1, alpha-amylase isozyme 1; barley, beta-alpha-barrel, hydrolase; 1.50A {Hordeum vulgare} SCOP: b.71.1.1 c.1.8.1 PDB: 1p6w_A* 1rpk_A* 3bsg_A 2qpu_A* 1rp8_A* 1rp9_A* 2qps_A 3bsh_A* 1ava_A 1amy_A 1bg9_A* Back     alignment and structure
>3aof_A Endoglucanase; glycosyl hydrolase family 5, cellulase, biofuel, hyperthermo hydrolase; HET: BMA; 1.29A {Thermotoga maritima} PDB: 3amg_A* 3amc_A 3amd_A 3mmu_A 3mmw_A 3azs_A* 3azr_A* 3azt_A* Back     alignment and structure
>3a24_A Alpha-galactosidase; glycoside hydrolase family 97, retaining glycosidase; HET: MES; 2.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2dh2_A 4F2 cell-surface antigen heavy chain; TIM-barrel, glycosidase like, antiparallel beta-sheet, greek terminal domain, extracellular domain; 2.10A {Homo sapiens} PDB: 2dh3_A Back     alignment and structure
>1ece_A Endocellulase E1; glycosyl hydrolase; HET: BGC; 2.40A {Acidothermus cellulolyticus} SCOP: c.1.8.3 PDB: 1vrx_A Back     alignment and structure
>1h1n_A Endo type cellulase ENGI; hydrolase, glycosyl hydrolase, family 5, subtype, thermophilic, thermophIle, endoglucanase; 1.12A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1gzj_A Back     alignment and structure
>1jae_A Alpha-amylase; glycosidase, carbohydrate metabolism, 4-glucan-4-glucanohydrolase, hydrolase; 1.65A {Tenebrio molitor} SCOP: b.71.1.1 c.1.8.1 PDB: 1clv_A 1tmq_A 1viw_A* Back     alignment and structure
>1wpc_A Glucan 1,4-alpha-maltohexaosidase; maltohexaose-producing amylase, alpha-amylase, acarbose, HYD; HET: ACI GLC GAL; 1.90A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1wp6_A* 2d3l_A* 2d3n_A* 2die_A 2gjp_A* 2gjr_A 1w9x_A* Back     alignment and structure
>1bqc_A Protein (beta-mannanase); glycosyl hydrolase, family 5, thermomonospora fusca; 1.50A {Thermobifida fusca} SCOP: c.1.8.3 PDB: 2man_A* 3man_A* Back     alignment and structure
>1ceo_A Cellulase CELC; glycosyl hydrolase, family A/5 of glycosyl hydrolases, cellulose degradation; 1.90A {Clostridium thermocellum} SCOP: c.1.8.3 PDB: 1cen_A 1cec_A Back     alignment and structure
>2z1k_A (NEO)pullulanase; hydrolase, structural genomics, NPPSFA, national project on structural and functional analyses; HET: GLC; 2.30A {Thermus thermophilus} Back     alignment and structure
>3zss_A Putative glucanohydrolase PEP1A; alpha-glucan biosynthesis, glycoside hydrolase FA; 1.80A {Streptomyces coelicolor} PDB: 3zst_A* 3zt5_A* 3zt6_A* 3zt7_A* Back     alignment and structure
>3civ_A Endo-beta-1,4-mannanase; TIM barrel, hydrolase; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>4aie_A Glucan 1,6-alpha-glucosidase; hydrolase, glycoside hydrolase 13; HET: MES GOL; 2.05A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>2w61_A GAS2P, glycolipid-anchored surface protein 2; glycoprotein, cell membrane, fungal cell WALL, transglycosyl glucan, membrane, GPI-anchor; 1.62A {Saccharomyces cerevisiae} PDB: 2w62_A* 2w63_A* Back     alignment and structure
>3bh4_A Alpha-amylase; calcium, carbohydrate metabolism, glycosidase, hydrolase, metal-binding, secreted; 1.40A {Bacillus amyloliquefaciens} PDB: 1e43_A 1e3z_A* 1e40_A* 1e3x_A 1vjs_A 1ob0_A 1bli_A 1bpl_B 1bpl_A Back     alignment and structure
>1tvn_A Cellulase, endoglucanase G; glycoside hydrolase, CLAN GH-A, family 5-2; 1.41A {Pseudoalteromonas haloplanktis} SCOP: c.1.8.3 PDB: 1tvp_A* Back     alignment and structure
>1vjz_A Endoglucanase; TM1752, structural genomics, JCSG, PSI, prote structure initiative, joint center for structural genomics; 2.05A {Thermotoga maritima} SCOP: c.1.8.3 Back     alignment and structure
>1qnr_A Endo-1,4-B-D-mannanase; hydrolase, anomalous scattering; HET: NAG MAB; 1.4A {Trichoderma reesei} SCOP: c.1.8.3 PDB: 1qno_A* 1qnq_A* 1qnp_A* 1qns_A* Back     alignment and structure
>1ud2_A Amylase, alpha-amylase; calcium-free, alkaline, hydrolase; 2.13A {Bacillus SP} SCOP: b.71.1.1 c.1.8.1 PDB: 1ud4_A 1ud5_A 1ud6_A 1ud8_A 1ud3_A Back     alignment and structure
>3ayr_A Endoglucanase; TIM barrel, hydrolase, carbohydrate/sugar binding; 2.00A {Piromyces rhizinflatus} PDB: 3ays_A* Back     alignment and structure
>4gqr_A Pancreatic alpha-amylase; glycosyl hydrolase, diabetes, obesity, digestion, glycosidas inhibition, flavonol, drug design; HET: NAG MYC; 1.20A {Homo sapiens} PDB: 1cpu_A* 1bsi_A 1u2y_A* 1u30_A* 1u33_A* 1xcw_A* 1xcx_A* 1xd0_A* 1xd1_A* 2qmk_A* 2qv4_A* 3bai_A* 3baj_A* 3baw_A* 3ij7_A* 1hny_A* 3ij9_A* 3ij8_A* 4gqq_A* 1kgw_A* ... Back     alignment and structure
>3aj7_A Oligo-1,6-glucosidase; (beta/alpha)8-barrel, hydrolase; 1.30A {Saccharomyces cerevisiae} PDB: 3a4a_A* 3a47_A 3axi_A* 3axh_A* Back     alignment and structure
>1hjs_A Beta-1,4-galactanase; 4-galactanases, family 53 glycoside hydrolase, thermostability, PH optimum, CLAN GH-A, thermophIle, alkalophIle; HET: NAG EPE; 1.87A {Thielavia heterothallica} SCOP: c.1.8.3 PDB: 1hju_A* 1hjq_A* Back     alignment and structure
>1zja_A Trehalulose synthase; sucrose isomerase, alpha-amylase family, (beta/alpha)8 barrel; 1.60A {Pseudomonas mesoacidophila} PDB: 1zjb_A 2pwd_A* 2pwh_A 2pwg_A 2pwe_A* 2pwf_A* 3gbe_A* 3gbd_A* Back     alignment and structure
>4fnq_A Alpha-galactosidase AGAB; glycoside hydrolase, hydrolase; 1.80A {Geobacillus stearothermophilus} PDB: 4fnr_A 4fnu_A* 4fnt_A* 4fns_A* 4fnp_A* Back     alignment and structure
>1gcy_A Glucan 1,4-alpha-maltotetrahydrolase; beta-alpha-barrel, beta sheet; 1.60A {Pseudomonas stutzeri} SCOP: b.71.1.1 c.1.8.1 PDB: 1jdc_A* 1jda_A* 1jdd_A* 1qi5_A* 1qi3_A* 1qi4_A* 2amg_A 1qpk_A* Back     alignment and structure
>3faw_A Reticulocyte binding protein; TIM barrel, beta barrel, hydrolase, cell WALL, peptidoglycan-anchor, secreted; 2.10A {Streptococcus agalactiae COH1} PDB: 3fax_A* Back     alignment and structure
>1egz_A Endoglucanase Z, EGZ, CEL5; glycosyl hydrolase, CLAN GH-A, family 5-2, cellulase; 2.30A {Erwinia chrysanthemi} SCOP: c.1.8.3 Back     alignment and structure
>2wsk_A Glycogen debranching enzyme; carbohydrate metabolism, hydrolase, glycosidase, ISO-amylase glycosyl hydrolase, glycogen metabolism; 2.25A {Escherichia coli k-12} Back     alignment and structure
>3vmn_A Dextranase; TIM barrel, immunoglobrin fold, greek-KEY-motif, glycoside H family 66, hydrolase; 1.60A {Streptococcus mutans} PDB: 3vmo_A* 3vmp_A* Back     alignment and structure
>2aaa_A Alpha-amylase; glycosidase; 2.10A {Aspergillus niger} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2wan_A Pullulanase; hydrolase, glycoside hydrolase, polysaccharide, amylase, starch, carbohydrate; 1.65A {Bacillus acidopullulyticus} Back     alignment and structure
>2wc7_A Alpha amylase, catalytic region; CD/PUL-hydrolyzing enzymes, hydrolase, glycosidase, neopullu; 2.37A {Nostoc punctiforme} PDB: 2wcs_A 2wkg_A Back     alignment and structure
>1hvx_A Alpha-amylase; hydrolase, glycosyltransferase, thermostability; 2.00A {Geobacillus stearothermophilus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1m53_A Isomaltulose synthase; klebsiella SP. LX3, sucrose isomerization, isomerase; 2.20A {Klebsiella SP} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>2guy_A Alpha-amylase A; (beta-alpha) 8 barrel, hydrolase; HET: NAG BMA; 1.59A {Aspergillus oryzae} SCOP: b.71.1.1 c.1.8.1 PDB: 2gvy_A* 3kwx_A* 6taa_A 7taa_A* 2taa_A Back     alignment and structure
>3pzt_A Endoglucanase; alpha/beta barrel, glycosyl hydrolase, cellulose binding, HY; 1.97A {Bacillus subtilis subsp} PDB: 3pzu_A 3pzv_A Back     alignment and structure
>2zic_A Dextran glucosidase; TIM barrel, (beta/alpha)8-barrel, hydrolase; 2.20A {Streptococcus mutans} PDB: 2zid_A* Back     alignment and structure
>1m7x_A 1,4-alpha-glucan branching enzyme; alpha/beta barrel, beta sandwich, transferase; 2.30A {Escherichia coli} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 3o7y_A* 3o7z_A* Back     alignment and structure
>4hty_A Cellulase; (alpha/beta)8 barrel, family 5 endoglucanase, hydrolase; 2.00A {Uncultured bacterium} PDB: 4hu0_A* Back     alignment and structure
>3ndz_A Endoglucanase D; cellotriose, xylanase, carbohydrate binding D glucanase, hydrolase; HET: CT3; 2.08A {Clostridium cellulovorans} PDB: 3ndy_A* Back     alignment and structure
>2ze0_A Alpha-glucosidase; TIM barrel, glucoside hydrolase, extremophIle, hydrolase; 2.00A {Geobacillus SP} Back     alignment and structure
>3edf_A FSPCMD, cyclomaltodextrinase; alpha-cyclodextrin complex, glycosidase, hydrolase; HET: CE6 ACX; 1.65A {Flavobacterium SP} PDB: 3edj_A* 3edk_A* 3ede_A 3edd_A* 1h3g_A Back     alignment and structure
>4aee_A Alpha amylase, catalytic region; hydrolase, hyperthermostable, cyclodextrin hydrolase, GH13; 2.28A {Staphylothermus marinus} Back     alignment and structure
>3k8k_A Alpha-amylase, SUSG; alpha8/BETA8 barrel, CBM, beta-sandwich, membrane protein; 2.20A {Bacteroides thetaiotaomicron} PDB: 3k8m_A* 3k8l_A* Back     alignment and structure
>2e8y_A AMYX protein, pullulanase; multiple domain, beta-alpha-barrel, alpha-amylase-family, HY; 2.11A {Bacillus subtilis} PDB: 2e8z_A* 2e9b_A* Back     alignment and structure
>1vem_A Beta-amylase; beta-alpha-barrels, optimum PH, hydrolase; HET: GLC; 1.85A {Bacillus cereus} SCOP: b.3.1.1 c.1.8.1 PDB: 1b90_A* 1j0y_A* 1j0z_A* 1j10_A* 1b9z_A* 1j12_A* 1j18_A* 1j11_A* 5bca_A 1veo_A* 1itc_A* 1ven_A* 1vep_A* 1cqy_A Back     alignment and structure
>1yq2_A Beta-galactosidase; glycosyl hydrolase family 2, TIM barrel, hexamer; 1.90A {Arthrobacter SP} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 Back     alignment and structure
>4aef_A Neopullulanase (alpha-amylase II); hydrolase, thermostability, high temperature; 2.34A {Pyrococcus furiosus} Back     alignment and structure
>3u7v_A Beta-galactosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, TIM barrel, glyco_hydro_42; HET: MSE; 1.80A {Caulobacter crescentus} Back     alignment and structure
>1ji1_A Alpha-amylase I; beta/alpha barrel, hydrolase; 1.60A {Thermoactinomyces vulgaris} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 PDB: 1uh3_A* 2d0f_A* 1izj_A 1uh4_A* 1uh2_A* 2d0g_A* 2d0h_A* 1izk_A Back     alignment and structure
>1wza_A Alpha-amylase A; hydrolase, halophilic, thermophilic; 1.60A {Halothermothrix orenii} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1uok_A Oligo-1,6-glucosidase; sugar degradation, hydrolase, TIM-barrel glycosidase; 2.00A {Bacillus cereus} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1mxg_A Alpha amylase; hyperthermostable, family 13 glycosyl hydrola (beta/alpha)8-barrel, hydrolase; HET: ACR ETE; 1.60A {Pyrococcus woesei} SCOP: b.71.1.1 c.1.8.1 PDB: 1mwo_A* 1mxd_A* 3qgv_A* Back     alignment and structure
>4awe_A Endo-beta-D-1,4-mannanase; hydrolase, endo-mannanase, glycosyl hydrolase, GH5; HET: NAG; 1.40A {Neurospora sitophila} Back     alignment and structure
>7a3h_A Endoglucanase; hydrolase, cellulose degradation, glycoside H family 5, michaelis complex, SKEW-BOAT, distortion; 0.95A {Bacillus agaradhaerens} SCOP: c.1.8.3 PDB: 1h2j_A* 1hf6_A* 1ocq_A* 1w3k_A* 1h11_A* 4a3h_A* 5a3h_A* 6a3h_A* 1w3l_A 8a3h_A* 2v38_A* 1qhz_A 1qi0_A* 1e5j_A* 1qi2_A* 1h5v_A* 1a3h_A 2a3h_A* 3a3h_A* 1lf1_A Back     alignment and structure
>2jep_A Xyloglucanase; family 5, plant cell WALL, hydrolase; 1.4A {Paenibacillus pabuli} PDB: 2jeq_A* Back     alignment and structure
>3qr3_A Endoglucanase EG-II; TIM barrel, hydrolase; 2.05A {Hypocrea jecorina} Back     alignment and structure
>1g94_A Alpha-amylase; beta-alpha-8-barrel, 3 domain structure, hydrolase; HET: DAF GLC; 1.74A {Pseudoalteromonas haloplanktis} SCOP: b.71.1.1 c.1.8.1 PDB: 1g9h_A* 1l0p_A 1aqm_A* 1aqh_A* 1b0i_A 1jd7_A 1jd9_A 1kxh_A* Back     alignment and structure
>1g5a_A Amylosucrase; glycosyltransferase, glycoside hydrolase, (beta-alpha)8 barrel; HET: EPE; 1.40A {Neisseria polysaccharea} SCOP: b.71.1.1 c.1.8.1 PDB: 1jg9_A* 1mw1_A* 1mw2_A* 1mw3_A* 3ueq_A* 1jgi_A* 1mvy_A* 1mw0_A* 1s46_A* 1zs2_A* Back     alignment and structure
>3czg_A Sucrose hydrolase; (alpha/beta)8-barrel; HET: GLC; 1.80A {Xanthomonas axonopodis PV} PDB: 3cze_A* 3czl_A* 3czk_A* 2wpg_A Back     alignment and structure
>3vgf_A Malto-oligosyltrehalose trehalohydrolase; alpha/beta barrel, alpha-amylas hydrolase; HET: GLC FLC; 2.30A {Sulfolobus solfataricus} PDB: 3vge_A* 3vgd_A* 3vgb_A* 1eh9_A* 3vgh_A* 3vgg_A* 1eha_A Back     alignment and structure
>1ua7_A Alpha-amylase; beta-alpha-barrels, acarbose, greek-KEY motif, hydrolase; HET: ACI GLD GLC G6D BGC; 2.21A {Bacillus subtilis} SCOP: b.71.1.1 c.1.8.1 PDB: 1bag_A* 3dc0_A Back     alignment and structure
>2xsa_A Ogoga, hyaluronoglucosaminidase; O-GLCNACYLATION, O-GLCNACASE, glycosyl hydrolase, hydrolase; 2.00A {Oceanicola granulosus} PDB: 2xsb_A* Back     alignment and structure
>3aml_A OS06G0726400 protein; starch-branching, transferase; HET: EPE; 1.70A {Oryza sativa japonica group} PDB: 3amk_A Back     alignment and structure
>1qho_A Alpha-amylase; glycoside hydrolase, starch degradation; HET: MAL ABD; 1.70A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1qhp_A* Back     alignment and structure
>3qho_A Endoglucanase, 458AA long hypothetical endo-1,4-beta-glucanase; cellulase, catalytic domain, hydrolase; HET: CTT; 1.65A {Pyrococcus horikoshii} PDB: 3axx_A* 2zum_A 2zun_A* 3qhm_A* 3qhn_A* Back     alignment and structure
>1gjw_A Maltodextrin glycosyltransferase; alpha-amylase, maltosyltransferase; HET: MAL GLC; 2.1A {Thermotoga maritima} SCOP: b.71.1.1 c.1.8.1 PDB: 1gju_A* Back     alignment and structure
>3n9k_A Glucan 1,3-beta-glucosidase; aromatic entranceway/clamp, exoglucanase, glycoside hydrolas protein-carbohydrate interaction; HET: BGC; 1.70A {Candida albicans} SCOP: c.1.8.3 PDB: 2pc8_A* 2pb1_A* 2pbo_A 3o6a_A 2pf0_A 1cz1_A 1eqc_A* 1eqp_A Back     alignment and structure
>2p0o_A Hypothetical protein DUF871; structural genomics, TIM barrel, PF05 2, protein structure initiative, midwest center for structu genomics; 2.15A {Enterococcus faecalis} Back     alignment and structure
>1bf2_A Isoamylase; hydrolase, glycosidase, debranching enzyme; 2.00A {Pseudomonas amyloderamosa} SCOP: b.1.18.2 b.71.1.1 c.1.8.1 Back     alignment and structure
>1h4p_A Glucan 1,3-beta-glucosidase I/II; hydrolase, glucan degradation, hydrolyase, glycosidase; HET: NAG BMA MAN NDG; 1.75A {Saccharomyces cerevisiae} SCOP: c.1.8.3 Back     alignment and structure
>3bc9_A AMYB, alpha amylase, catalytic region; acarbose, thermostable, halophilic, N domain, starch binding, hydrolase; HET: G6D GLC ACI BGC ACR; 1.35A {Halothermothrix orenii} PDB: 3bcd_A* 3bcf_A Back     alignment and structure
>3ucq_A Amylosucrase; thermostability, amylose synthesis, sucrose isomerization, beta/alpha-barrel, carbohydrate binding, transferase; 1.97A {Deinococcus geothermalis} PDB: 3uer_A* Back     alignment and structure
>1x7f_A Outer surface protein; structural genomics, unknown function, MCSG, PSI, midwest center for struct genomics; 2.30A {Bacillus cereus atcc 14579} SCOP: b.62.1.2 c.1.8.12 Back     alignment and structure
>1g01_A Endoglucanase; alpha/beta barrel, TIM barrel, hydrolase; 1.90A {Bacillus SP} SCOP: c.1.8.3 PDB: 1g0c_A* Back     alignment and structure
>3og2_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family 35, glycoprot hydrolase; HET: NAG BMA MAN GLC; 1.20A {Trichoderma reesei} PDB: 3ogr_A* 3ogs_A* 3ogv_A* Back     alignment and structure
>1edg_A Endoglucanase A; family A, cellulases, xylanases, family 5 of glycosyl hydrol cellulose degradation; 1.60A {Clostridium cellulolyticum} SCOP: c.1.8.3 Back     alignment and structure
>1tg7_A Beta-galactosidase; TIM barrel domain, glycoside hydrolase, family GH35, glycopr penicillium, hydrolase; HET: NAG BMA MAN; 1.90A {Penicillium SP} SCOP: b.149.1.1 b.18.1.27 b.18.1.27 b.71.1.5 c.1.8.14 PDB: 1xc6_A* Back     alignment and structure
>3fn9_A Putative beta-galactosidase; structural genomics, glycosidas hydrolase, PSI-2, protein structure initiative; 2.70A {Bacteroides fragilis} Back     alignment and structure
>1d3c_A Cyclodextrin glycosyltransferase; alpha-amylase, product complex, oligosaccharide, family 13 glycosyl hydrolase, transglycosylation; HET: GLC; 1.78A {Bacillus circulans} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 1cxf_A* 1cxk_A* 1cdg_A* 1cxe_A* 1cxh_A* 1cxi_A* 2cxg_A* 1cgv_A* 2dij_A* 1cgy_A* 1kck_A* 1cgx_A* 1cxl_A* 1cgw_A* 1tcm_A 1kcl_A* 1eo5_A* 1eo7_A* 1dtu_A* 1ot1_A* ... Back     alignment and structure
>4e8d_A Glycosyl hydrolase, family 35; TIM barrel, beta-propeller, glycohydrolase; 1.80A {Streptococcus pneumoniae} PDB: 4e8c_A Back     alignment and structure
>1qwg_A PSL synthase;, (2R)-phospho-3-sulfolactate synthase; beta-alpha-barrel, lyase; 1.60A {Methanocaldococcus jannaschii} SCOP: c.1.27.1 Back     alignment and structure
>2y8k_A Arabinoxylanase, carbohydrate binding family 6; hydrolase; 1.47A {Clostridium thermocellum} Back     alignment and structure
>2osx_A Endoglycoceramidase II; (alpha/beta)8 (TIM) barrel, hydrolase; HET: SIA GAL BGC 16C; 1.10A {Rhodococcus SP} PDB: 2oyk_A* 2osw_A* 2oyl_A* 2oym_A* 2osy_A* Back     alignment and structure
>3bmv_A Cyclomaltodextrin glucanotransferase; glycosidase, thermostable, family 13 glycosyl hydrolas; 1.60A {Thermoanaerobacterium thermosulfurigenorganism_taxid} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 PDB: 3bmw_A* 1ciu_A 1a47_A 1pj9_A* 1cgt_A Back     alignment and structure
>2ya0_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; 1.85A {Streptococcus pneumoniae} PDB: 2ya2_A* Back     alignment and structure
>2vr5_A Glycogen operon protein GLGX; hydrolase, glycosidase, glycosyl hydrolase, glycogen debraching; HET: GLC A16; 2.8A {Sulfolobus solfataricus} PDB: 2vnc_A* 2vuy_A Back     alignment and structure
>1jz7_A Lactase, beta-galactosidase, LACZ; TIM barrel (alpha/beta barrel), jelly-roll barrel, immunoglobulin, beta supersandwich, hydrolase; HET: GAL; 1.50A {Escherichia coli} SCOP: b.1.4.1 b.1.4.1 b.18.1.5 b.30.5.1 c.1.8.3 PDB: 1hn1_A 1jyx_A* 1jz3_A* 1jz4_A* 1jz5_A* 1jz6_A* 1dp0_A* 3iap_A* 1jz8_A* 1jyn_A* 1jyv_A* 1jyw_A* 3iaq_A* 1px3_A 1px4_A* 3czj_A* 3i3e_A 3i3d_A* 3i3b_A 3dym_A ... Back     alignment and structure
>3cmg_A Putative beta-galactosidase; structural genomics, PSI-2, Pro structure initiative, NEW YORK SGX research center for STRU genomics, nysgxrc; 1.90A {Bacteroides fragilis} Back     alignment and structure
>1cyg_A Cyclodextrin glucanotransferase; glycosyltransferase; 2.50A {Geobacillus stearothermophilus} SCOP: b.1.18.2 b.3.1.1 b.71.1.1 c.1.8.1 Back     alignment and structure
>1iv8_A Maltooligosyl trehalose synthase; beta alpha barrel, intramolecular transglucosylation, isomerase; HET: MLZ MLY; 1.90A {Sulfolobus acidocaldarius} SCOP: b.71.1.1 c.1.8.1 Back     alignment and structure
>1gqi_A Alpha-glucuronidase; (alpha-beta)8 barrel, glycoside hydrolase; 1.48A {Pseudomonas cellulosa} SCOP: c.1.8.10 d.92.2.2 PDB: 1gqj_A* 1gqk_A* 1gql_A* 1h41_A* Back     alignment and structure
>2cks_A Endoglucanase E-5; carbohydrate metabolism, polysaccharide degradation, glycoside hydrolase family 5, hydrolase, glycosidase; HET: BEN; 1.6A {Thermobifida fusca} PDB: 2ckr_A* Back     alignment and structure
>2wqp_A Polysialic acid capsule biosynthesis protein SIAC; NEUB, inhibitor, TIM barrel, sialic acid synthase, transfera; HET: WQP; 1.75A {Neisseria meningitidis} PDB: 2zdr_A 1xuz_A* 1xuu_A 3cm4_A Back     alignment and structure
>3thd_A Beta-galactosidase; TIM-barrel domain, glycosyl hydrolase, glycosylation, hydrolase; HET: NAG DGJ; 1.79A {Homo sapiens} PDB: 3thc_A* Back     alignment and structure
>3aie_A Glucosyltransferase-SI; beta-alpha-barrels; HET: MES; 2.10A {Streptococcus mutans} PDB: 3aic_A* 3aib_A* Back     alignment and structure
>3ttq_A Dextransucrase; (beta/alpha)8 barrel, transferase; HET: PG4; 1.90A {Leuconostoc mesenteroides} PDB: 3tto_A* Back     alignment and structure
>1zy9_A Alpha-galactosidase; TM1192, struc genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI, hydrolase; 2.34A {Thermotoga maritima} SCOP: b.30.5.11 c.1.8.13 Back     alignment and structure
>4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Back     alignment and structure
>1vli_A Spore coat polysaccharide biosynthesis protein SP; 2636322, JCSG, protein structure initiative, BS SPSE, PSI; 2.38A {Bacillus subtilis} SCOP: b.85.1.1 c.1.10.6 Back     alignment and structure
>2ya1_A Putative alkaline amylopullulanase; hydrolase, glycoside hydrolase; HET: BGC GLC; 2.25A {Streptococcus pneumoniae} Back     alignment and structure
>3oba_A Beta-galactosidase; TIM barrel, tetramer, GH2, glycosidase, hydrolase; 2.75A {Kluyveromyces lactis} PDB: 3ob8_A Back     alignment and structure
>1qtw_A Endonuclease IV; DNA repair enzyme, TIM barrel, trinuclear Zn cluster, hydrolase; 1.02A {Escherichia coli} SCOP: c.1.15.1 PDB: 1qum_A* 2nqh_A 2nqj_A* 2nq9_A* Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>4f9d_A Poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylas; family 4 carbohydrate esterase, TIM barrel, hydrolase, deace carbohydrate/sugar binding; HET: MES; 1.90A {Escherichia coli} PDB: 4f9j_A* Back     alignment and structure
>3s5u_A Putative uncharacterized protein; crispr, crispr adaptation mechanism, NEW spacer aquisition, binding, DNA binding protein; 2.70A {Enterococcus faecalis} Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query164
d1nowa1 353 beta-hexosaminidase B {Human (Homo sapiens) [TaxId 100.0
d2gjxa1 362 beta-hexosaminidase A {Human (Homo sapiens) [TaxId 100.0
d1qbaa3 443 Bacterial chitobiase (beta-N-acetylhexosaminidase) 100.0
d1jaka1 356 beta-N-acetylhexosaminidase {Streptomyces plicatus 100.0
d1yhta1 344 Dispersin B, DspB {Actinobacillus actinomycetemcom 100.0
d1rh9a1 370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 97.09
d1wkya2 297 Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 2449 96.97
d1eh9a3 400 Glycosyltrehalose trehalohydrolase, central domain 96.64
d2bhua3 420 Glycosyltrehalose trehalohydrolase, central domain 96.63
d1gcya2 357 G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase 96.08
d1uuqa_ 410 Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} 96.03
d1bqca_ 302 Beta-mannanase {Thermomonospora fusca [TaxId: 2021 96.02
d1m7xa3 396 1,4-alpha-glucan branching enzyme, central domain 95.84
d1ceoa_ 340 Endoglucanase CelC {Clostridium thermocellum [TaxI 95.83
d1ud2a2 390 Bacterial alpha-amylase {Bacillus sp., ksm-k38 [Ta 95.81
d1qnra_ 344 Beta-mannanase {Trichoderma reesei [TaxId: 51453]} 95.71
d1wzaa2 409 Bacterial alpha-amylase {Halothermothrix orenii [T 95.69
d2c0ha1 350 endo-1,4-beta-mannosidase {Blue mussel (Mytilus ed 95.65
d2d3na2 394 Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 95.62
d1j0ha3 382 Neopullulanase, central domain {Bacillus stearothe 95.6
d1lwha2 391 4-alpha-glucanotransferase {Thermotoga maritima [T 95.34
d1ht6a2 347 Plant alpha-amylase {Barley (Hordeum vulgare), AMY 95.33
d1kwga2 393 A4 beta-galactosidase {Thermus thermophilus [TaxId 95.16
d1bf2a3 475 Isoamylase, central domain {Pseudomonas amyloderam 95.11
d1vjza_ 325 Endoglucanase homologue TM1752 {Thermotoga maritim 95.0
d1hvxa2 393 Bacterial alpha-amylase {Bacillus stearothermophil 94.96
d2aaaa2 381 Fungal alpha-amylases {Aspergillus niger, acid amy 94.92
d1wzla3 382 Maltogenic amylase, central domain {Thermoactinomy 94.78
d1ua7a2 344 Bacterial alpha-amylase {Bacillus subtilis [TaxId: 94.66
d1mxga2 361 Bacterial alpha-amylase {Archaeon Pyrococcus woese 94.59
d1ea9c3 382 Maltogenic amylase, central domain {Bacillus sp., 94.38
d1h3ga3 422 Cyclomaltodextrinase, central domain {Flavobacteri 94.31
d1tg7a5 354 Beta-galactosidase LacA, N-terminal domain {Penici 94.31
d1qhoa4 407 Cyclodextrin glycosyltransferase {Bacillus stearot 94.24
d1e43a2 393 Bacterial alpha-amylase {Chimera (Bacillus amyloli 94.21
d1g94a2 354 Bacterial alpha-amylase {Pseudoalteromonas halopla 94.19
d3bmva4 406 Cyclodextrin glycosyltransferase {Thermoanaerobact 94.18
d2vzsa5 339 Exochitosanase CsxA {Amycolatopsis orientalis [Tax 93.89
d2guya2 381 Fungal alpha-amylases {Aspergillus oryzae, Taka-am 93.87
d1g5aa2 554 Amylosucrase {Neisseria polysaccharea [TaxId: 489] 93.75
d1uoka2 479 Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 13 93.53
d1ur4a_ 387 Beta-1,4-galactanase {Bacillus licheniformis [TaxI 93.47
d1tvna1 293 Endoglucanase Cel5a {Pseudoalteromonas haloplankti 93.39
d1hjsa_ 332 Beta-1,4-galactanase {Thielavia heterothallica, ak 93.35
d1m53a2 478 Isomaltulose synthase PalI {Klebsiella sp., lx3 [T 93.3
d1qwga_251 (2r)-phospho-3-sulfolactate synthase ComA {Archaeo 93.02
d1ecea_ 358 Endocellulase E1 {Acidothermus cellulolyticus [Tax 92.99
d1edga_ 380 Endoglucanase CelA {Clostridium cellulolyticum [Ta 92.77
d1jaea2 378 Animal alpha-amylase {Yellow mealworm (Tenebrio mo 92.35
d1h4pa_ 408 Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharom 92.27
d1iv8a2 653 Maltooligosyl trehalose synthase {Archaeon Sulfolo 92.12
d1gjwa2 572 Maltosyltransferase {Thermotoga maritima [TaxId: 2 91.69
d1yq2a5 297 beta-Galactosidase, domain 3 {Arthrobacter sp. c2- 91.61
d1hx0a2 403 Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 982 91.51
d1bhga3 304 beta-Glucuronidase, domain 3 {Human (Homo sapiens) 91.44
d2pb1a1 394 Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) 91.16
d1x7fa2244 Outer surface protein, N-terminal domain {Bacillus 90.81
d2cbia2 317 Hyaluronidase catalytic domain {Clostridium perfri 90.2
d2choa2 310 Glucosaminidase GH84, catalytic domain {Bacteroide 90.1
d1foba_ 334 Beta-1,4-galactanase {Fungus (Aspergillus aculeatu 90.09
d7a3ha_ 300 Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId 90.05
d1jz8a5 292 beta-Galactosidase, domain 3 {Escherichia coli [Ta 90.03
d2je8a5 348 Five-domain beta-mannosidase, domain 3 {Bacteroide 89.4
d1zy9a2 348 Alpha-galactosidase GalA catalytic domain {Thermot 88.52
d1h1na_ 305 Endocellulase EngI {Thermoascus aurantiacus [TaxId 88.31
d1vhca_212 Hypothetical protein HI0047 {Haemophilus influenza 86.78
d1ji1a3 432 Maltogenic amylase, central domain {Thermoactinomy 86.22
d1qtwa_ 285 Endonuclease IV {Escherichia coli [TaxId: 562]} 86.15
d1vlia2 295 Spore coat polysaccharide biosynthesis protein Sps 85.67
d1wa3a1202 KDPG aldolase {Thermotoga maritima [TaxId: 2336]} 85.33
d1g01a_ 357 Alkaline cellulase K catalytic domain {Bacillus sp 84.54
d1egza_ 291 Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 84.04
d1m7ya_ 431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 83.52
d1r7aa2 434 Sucrose phosphorylase {Bifidobacterium adolescenti 83.27
d1mxsa_216 KDPG aldolase {Pseudomonas putida [TaxId: 303]} 83.18
d1iaya_ 428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 82.9
d2q07a2150 Uncharacterized protein AF0587 {Archaeoglobus fulg 82.38
d2q02a1271 Putative cytoplasmic protein STM4435 {Salmonella t 81.82
d2fhfa5 563 Pullulanase PulA {Klebsiella pneumoniae [TaxId: 57 81.33
d1wbha1213 KDPG aldolase {Escherichia coli [TaxId: 562]} 81.24
d1i4na_251 Indole-3-glycerophosphate synthase, IPGS {Thermoto 80.54
>d1nowa1 c.1.8.6 (A:200-552) beta-hexosaminidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: beta-N-acetylhexosaminidase catalytic domain
domain: beta-hexosaminidase B
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=4.7e-47  Score=320.10  Aligned_cols=155  Identities=10%  Similarity=0.087  Sum_probs=135.5

Q ss_pred             CCceeEEEeCCCCCCCHHHHHHHHHHHHhcCCCEEEEEeecc--CCCCCC----------CCCCCCCCHHHHHHHHHHHH
Q psy2349           7 FKEVLVHLDLKGAPPSLTYLKEILPILAYTGATSLLIEWEDT--LPYSLG----------FDNTNPFRETEIFIILAAAE   74 (164)
Q Consensus         7 ~~~Rg~~lD~~r~~~~~~~lk~~i~~la~~k~N~l~l~~ed~--~p~~~~----------~~~~~~yT~~dir~iv~yA~   74 (164)
                      |+|||+|||++|+++++++||++|+.||.+|+|.||||++|+  |++++.          .+.+++||++|+|+||+||+
T Consensus         1 f~~RG~mlD~aR~~~~~~~lk~~id~ma~~K~N~lhlHl~D~~~~~~e~~~~P~l~~~g~~~~~~~yT~~d~~~lv~yA~   80 (353)
T d1nowa1           1 FSHRGILIDTSRHYLPVKIILKTLDAMAFNKFNVLHWHIVDDQSFPYQSITFPELSNKGSYSLSHVYTPNDVRMVIEYAR   80 (353)
T ss_dssp             CSEEEEEEESSSSCCCHHHHHHHHHHHHHTTCCEEEEECCCSSCCCBCCSSCHHHHHHHSSSTTSCBCHHHHHHHHHHHH
T ss_pred             CCccCeEEEcCCCCcCHHHHHHHHHHHHHcCCcEEEEEEecCCCceeccCCCcchhhcCCCCCCCCcCHHHHHHHHHHHH
Confidence            799999999999999999999999999999999999999885  666654          34578999999999999999


Q ss_pred             HcCCeEeeccCCcchHHHHhc-Cccchhhh----cCCCCCCcccCCChhhHHHHHHHHHhc-ccCCCCCeeeccCCccCC
Q psy2349          75 SNGLASIPLVPLYSDMDFVLK-VKEFAKMR----QNFNDTRFICPNARSSLDLVFKMIGRM-RFVLGTPISPLFCPPSAL  148 (164)
Q Consensus        75 ~~gI~VIPeid~pGH~~~~l~-~~~~~~l~----~~~~~~~~l~p~~~~t~~~~~~l~~E~-~lf~~s~~iHiGg~DE~~  148 (164)
                      +|||+||||||+|||+.++++ +|++..-.    ......++|||++|+|++|+++|++|+ ++|| ++|||||| ||+.
T Consensus        81 ~rgI~iiPEid~PGH~~~~~~~~pel~~~~~~~~~~~~~~~~l~~~~~~t~~~~~~v~~e~~~~F~-~~~~HiGg-DE~~  158 (353)
T d1nowa1          81 LRGIRVLPEFDTPGHTLSWGKGQKDLLTPCYSRQNKLDSFGPINPTLNTTYSFLTTFFKEISEVFP-DQFIHLGG-DEVE  158 (353)
T ss_dssp             HTTCEEEEEEEESSSCTTHHHHSTTCEEECCC----CCSEEEECTTCHHHHHHHHHHHHHHHHHCC-SSEEEEEC-CSCC
T ss_pred             HCCCEEEecccchhhHHHHHHHhhhhcCCccccCCcCCCccccCCCchhhHHHHHHHHHHHHHhhc-cceeeeec-cccc
Confidence            999999999999999999987 45542111    111234689999999999999999999 9999 99999999 9998


Q ss_pred             C--CCCCHHHHHHHHhC
Q psy2349         149 N--FGTCRDDKISVVAF  163 (164)
Q Consensus       149 ~--~~~~~~~~~~m~~~  163 (164)
                      .  |..|+.|+++|++.
T Consensus       159 ~~~w~~~~~~~~~~~~~  175 (353)
T d1nowa1         159 FKCWESNPKIQDFMRQK  175 (353)
T ss_dssp             CHHHHTCHHHHHHHHHT
T ss_pred             ccccccChHHHHHHHHc
Confidence            7  58999999999874



>d2gjxa1 c.1.8.6 (A:167-528) beta-hexosaminidase A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qbaa3 c.1.8.6 (A:338-780) Bacterial chitobiase (beta-N-acetylhexosaminidase) {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d1jaka1 c.1.8.6 (A:151-506) beta-N-acetylhexosaminidase {Streptomyces plicatus [TaxId: 1922]} Back     information, alignment and structure
>d1yhta1 c.1.8.6 (A:16-359) Dispersin B, DspB {Actinobacillus actinomycetemcomitans [TaxId: 714]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1wkya2 c.1.8.3 (A:34-330) Beta-mannanase {Bacillus sp. JAMB-602 [TaxId: 244966]} Back     information, alignment and structure
>d1eh9a3 c.1.8.1 (A:91-490) Glycosyltrehalose trehalohydrolase, central domain {Archaeon Sulfolobus solfataricus, km1 [TaxId: 2287]} Back     information, alignment and structure
>d2bhua3 c.1.8.1 (A:111-530) Glycosyltrehalose trehalohydrolase, central domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1gcya2 c.1.8.1 (A:1-357) G4-amylase (1,4-alpha-D-glucan maltotetrahydrolase) {Pseudomonas stutzeri [TaxId: 316]} Back     information, alignment and structure
>d1uuqa_ c.1.8.3 (A:) Exomannosidase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1bqca_ c.1.8.3 (A:) Beta-mannanase {Thermomonospora fusca [TaxId: 2021]} Back     information, alignment and structure
>d1m7xa3 c.1.8.1 (A:227-622) 1,4-alpha-glucan branching enzyme, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ceoa_ c.1.8.3 (A:) Endoglucanase CelC {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1ud2a2 c.1.8.1 (A:1-390) Bacterial alpha-amylase {Bacillus sp., ksm-k38 [TaxId: 1409]} Back     information, alignment and structure
>d1qnra_ c.1.8.3 (A:) Beta-mannanase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d1wzaa2 c.1.8.1 (A:28-436) Bacterial alpha-amylase {Halothermothrix orenii [TaxId: 31909]} Back     information, alignment and structure
>d2c0ha1 c.1.8.3 (A:18-367) endo-1,4-beta-mannosidase {Blue mussel (Mytilus edulis) [TaxId: 6550]} Back     information, alignment and structure
>d2d3na2 c.1.8.1 (A:5-398) Bacterial alpha-amylase {Bacillus sp. 707 [TaxId: 1416]} Back     information, alignment and structure
>d1j0ha3 c.1.8.1 (A:124-505) Neopullulanase, central domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lwha2 c.1.8.1 (A:1-391) 4-alpha-glucanotransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ht6a2 c.1.8.1 (A:1-347) Plant alpha-amylase {Barley (Hordeum vulgare), AMY1 isozyme [TaxId: 4513]} Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bf2a3 c.1.8.1 (A:163-637) Isoamylase, central domain {Pseudomonas amyloderamosa [TaxId: 32043]} Back     information, alignment and structure
>d1vjza_ c.1.8.3 (A:) Endoglucanase homologue TM1752 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hvxa2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2aaaa2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus niger, acid amylase [TaxId: 5061]} Back     information, alignment and structure
>d1wzla3 c.1.8.1 (A:121-502) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAII [TaxId: 2026]} Back     information, alignment and structure
>d1ua7a2 c.1.8.1 (A:4-347) Bacterial alpha-amylase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mxga2 c.1.8.1 (A:1-361) Bacterial alpha-amylase {Archaeon Pyrococcus woesei [TaxId: 2262]} Back     information, alignment and structure
>d1ea9c3 c.1.8.1 (C:122-503) Maltogenic amylase, central domain {Bacillus sp., cyclomaltodextrinase [TaxId: 1409]} Back     information, alignment and structure
>d1h3ga3 c.1.8.1 (A:96-517) Cyclomaltodextrinase, central domain {Flavobacterium sp. 92 [TaxId: 197856]} Back     information, alignment and structure
>d1tg7a5 c.1.8.14 (A:41-394) Beta-galactosidase LacA, N-terminal domain {Penicillium sp. [TaxId: 5081]} Back     information, alignment and structure
>d1qhoa4 c.1.8.1 (A:1-407) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]} Back     information, alignment and structure
>d1e43a2 c.1.8.1 (A:1-393) Bacterial alpha-amylase {Chimera (Bacillus amyloliquefaciens) and (Bacillus licheniformis) [TaxId: 1390]} Back     information, alignment and structure
>d1g94a2 c.1.8.1 (A:1-354) Bacterial alpha-amylase {Pseudoalteromonas haloplanktis (Alteromonas haloplanktis) [TaxId: 228]} Back     information, alignment and structure
>d3bmva4 c.1.8.1 (A:1-406) Cyclodextrin glycosyltransferase {Thermoanaerobacterium [TaxId: 28895]} Back     information, alignment and structure
>d2vzsa5 c.1.8.3 (A:336-674) Exochitosanase CsxA {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d2guya2 c.1.8.1 (A:1-381) Fungal alpha-amylases {Aspergillus oryzae, Taka-amylase [TaxId: 5062]} Back     information, alignment and structure
>d1g5aa2 c.1.8.1 (A:1-554) Amylosucrase {Neisseria polysaccharea [TaxId: 489]} Back     information, alignment and structure
>d1uoka2 c.1.8.1 (A:1-479) Oligo-1,6, glucosidase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1ur4a_ c.1.8.3 (A:) Beta-1,4-galactanase {Bacillus licheniformis [TaxId: 1402]} Back     information, alignment and structure
>d1tvna1 c.1.8.3 (A:1-293) Endoglucanase Cel5a {Pseudoalteromonas haloplanktis [TaxId: 228]} Back     information, alignment and structure
>d1hjsa_ c.1.8.3 (A:) Beta-1,4-galactanase {Thielavia heterothallica, aka Myceliophthora thermophila [TaxId: 78579]} Back     information, alignment and structure
>d1m53a2 c.1.8.1 (A:43-520) Isomaltulose synthase PalI {Klebsiella sp., lx3 [TaxId: 576]} Back     information, alignment and structure
>d1qwga_ c.1.27.1 (A:) (2r)-phospho-3-sulfolactate synthase ComA {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ecea_ c.1.8.3 (A:) Endocellulase E1 {Acidothermus cellulolyticus [TaxId: 28049]} Back     information, alignment and structure
>d1edga_ c.1.8.3 (A:) Endoglucanase CelA {Clostridium cellulolyticum [TaxId: 1521]} Back     information, alignment and structure
>d1jaea2 c.1.8.1 (A:1-378) Animal alpha-amylase {Yellow mealworm (Tenebrio molitor), larva [TaxId: 7067]} Back     information, alignment and structure
>d1h4pa_ c.1.8.3 (A:) Exo-beta-(1,3)-glucanase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iv8a2 c.1.8.1 (A:1-653) Maltooligosyl trehalose synthase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d1gjwa2 c.1.8.1 (A:1-572) Maltosyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yq2a5 c.1.8.3 (A:313-609) beta-Galactosidase, domain 3 {Arthrobacter sp. c2-2 [TaxId: 192168]} Back     information, alignment and structure
>d1hx0a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pb1a1 c.1.8.3 (A:7-400) Exo-beta-(1,3)-glucanase {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1x7fa2 c.1.8.12 (A:1-244) Outer surface protein, N-terminal domain {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2cbia2 c.1.8.10 (A:179-495) Hyaluronidase catalytic domain {Clostridium perfringens [TaxId: 1502]} Back     information, alignment and structure
>d2choa2 c.1.8.10 (A:127-436) Glucosaminidase GH84, catalytic domain {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1foba_ c.1.8.3 (A:) Beta-1,4-galactanase {Fungus (Aspergillus aculeatus) [TaxId: 5053]} Back     information, alignment and structure
>d7a3ha_ c.1.8.3 (A:) Endoglucanase Cel5a {Bacillus agaradhaerens [TaxId: 76935]} Back     information, alignment and structure
>d1jz8a5 c.1.8.3 (A:334-625) beta-Galactosidase, domain 3 {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2je8a5 c.1.8.3 (A:331-678) Five-domain beta-mannosidase, domain 3 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1zy9a2 c.1.8.13 (A:178-525) Alpha-galactosidase GalA catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h1na_ c.1.8.3 (A:) Endocellulase EngI {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1vhca_ c.1.10.1 (A:) Hypothetical protein HI0047 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1ji1a3 c.1.8.1 (A:123-554) Maltogenic amylase, central domain {Thermoactinomyces vulgaris, TVAI [TaxId: 2026]} Back     information, alignment and structure
>d1qtwa_ c.1.15.1 (A:) Endonuclease IV {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vlia2 c.1.10.6 (A:2-296) Spore coat polysaccharide biosynthesis protein SpsE, N-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g01a_ c.1.8.3 (A:) Alkaline cellulase K catalytic domain {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1egza_ c.1.8.3 (A:) Endoglucanase Cel5a {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1r7aa2 c.1.8.1 (A:1-434) Sucrose phosphorylase {Bifidobacterium adolescentis [TaxId: 1680]} Back     information, alignment and structure
>d1mxsa_ c.1.10.1 (A:) KDPG aldolase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d2q07a2 c.18.1.4 (A:244-393) Uncharacterized protein AF0587 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2q02a1 c.1.15.4 (A:1-271) Putative cytoplasmic protein STM4435 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2fhfa5 c.1.8.1 (A:403-965) Pullulanase PulA {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1wbha1 c.1.10.1 (A:1-213) KDPG aldolase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i4na_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure