Psyllid ID: psy2376
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 896 | 2.2.26 [Sep-21-2011] | |||||||
| A6T2G6 | 322 | Ribosomal RNA small subun | no | N/A | 0.310 | 0.863 | 0.537 | 2e-87 | |
| A4G8U6 | 321 | Ribosomal RNA small subun | yes | N/A | 0.310 | 0.866 | 0.534 | 3e-87 | |
| C6BEJ1 | 319 | Ribosomal RNA small subun | no | N/A | 0.304 | 0.855 | 0.474 | 4e-76 | |
| B2UCY5 | 319 | Ribosomal RNA small subun | no | N/A | 0.304 | 0.855 | 0.470 | 4e-76 | |
| Q8XVH9 | 319 | Ribosomal RNA small subun | no | N/A | 0.304 | 0.855 | 0.481 | 1e-75 | |
| Q13TY4 | 317 | Ribosomal RNA small subun | no | N/A | 0.304 | 0.861 | 0.480 | 1e-74 | |
| Q7N139 | 314 | Ribosomal RNA small subun | yes | N/A | 0.310 | 0.885 | 0.5 | 2e-74 | |
| B1YSR6 | 313 | Ribosomal RNA small subun | no | N/A | 0.309 | 0.884 | 0.477 | 2e-74 | |
| B2JHG8 | 317 | Ribosomal RNA small subun | no | N/A | 0.304 | 0.861 | 0.483 | 2e-74 | |
| Q0BIK9 | 313 | Ribosomal RNA small subun | no | N/A | 0.309 | 0.884 | 0.477 | 2e-74 |
| >sp|A6T2G6|RSMH_JANMA Ribosomal RNA small subunit methyltransferase H OS=Janthinobacterium sp. (strain Marseille) GN=rsmH PE=3 SV=1 | Back alignment and function desciption |
|---|
Score = 324 bits (830), Expect = 2e-87, Method: Compositional matrix adjust.
Identities = 150/279 (53%), Positives = 202/279 (72%), Gaps = 1/279 (0%)
Query: 390 LFLNEAINWLNIENERINGIYIDATFGQGGHSCKILERLGKKGRLIAIDKDTESVSLGNK 449
+ L+EA++ L + ER NG+Y+D TFG+GGHS KIL++LG RL+A DKDT++++
Sbjct: 14 VLLDEAVDALALGGERANGVYVDGTFGRGGHSRKILQQLGSGARLLAFDKDTQAIANAAT 73
Query: 450 ITDSRFSIIHNCFTELDIILKKYNIKKIDGILFDLGISSNQINNELRGFSFLLDGPLDMR 509
I D RF I H+ F L L IK++DG+L DLGISS Q+++ RGFSF DGPLDMR
Sbjct: 74 IDDQRFEIAHDSFATLSEALAVRGIKQVDGVLLDLGISSPQVDDATRGFSFRADGPLDMR 133
Query: 510 MDITRGISASKWLANATEFNIKKVIQDYGEERFAKKIAKEIVHYRSITPITRTKQLVEII 569
MD TRG+SA++WLA TE I+KVI++YGEERFA +IAK IV R++ PI+ T+QL EI+
Sbjct: 134 MDTTRGMSAAEWLATETEQKIEKVIREYGEERFAFQIAKAIVARRAVEPISSTRQLAEIV 193
Query: 570 LKSIRGNKRYKNPATRTFQAIRIYINQELKNLSIALKIGFKKLNIKGRIVVISFHSLEDR 629
++++ ++ K+PATRTFQAIRI+INQEL+ L + L ++ L GR+VVISFHSLEDR
Sbjct: 194 ARTVKTREKGKDPATRTFQAIRIFINQELEELEVVLNEAYRYLAPHGRLVVISFHSLEDR 253
Query: 630 IVKNFINFNTKIPHIDRRLPIYNY-LFEPKMKFLARCKP 667
IVK F+ +P DRRLPI L +P+MK L+R KP
Sbjct: 254 IVKQFMAGKANVPQPDRRLPIRAIDLPQPEMKLLSRVKP 292
|
Specifically methylates the N4 position of cytidine in position 1402 (C1402) of 16S rRNA. Janthinobacterium sp. (strain Marseille) (taxid: 375286) EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 9EC: 9 |
| >sp|A4G8U6|RSMH_HERAR Ribosomal RNA small subunit methyltransferase H OS=Herminiimonas arsenicoxydans GN=rsmH PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|C6BEJ1|RSMH_RALP1 Ribosomal RNA small subunit methyltransferase H OS=Ralstonia pickettii (strain 12D) GN=rsmH PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|B2UCY5|RSMH_RALPJ Ribosomal RNA small subunit methyltransferase H OS=Ralstonia pickettii (strain 12J) GN=rsmH PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q8XVH9|RSMH_RALSO Ribosomal RNA small subunit methyltransferase H OS=Ralstonia solanacearum (strain GMI1000) GN=rsmH PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q13TY4|RSMH_BURXL Ribosomal RNA small subunit methyltransferase H OS=Burkholderia xenovorans (strain LB400) GN=rsmH PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q7N139|RSMH_PHOLL Ribosomal RNA small subunit methyltransferase H OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rsmH PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|B1YSR6|RSMH_BURA4 Ribosomal RNA small subunit methyltransferase H OS=Burkholderia ambifaria (strain MC40-6) GN=rsmH PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|B2JHG8|RSMH_BURP8 Ribosomal RNA small subunit methyltransferase H OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rsmH PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q0BIK9|RSMH_BURCM Ribosomal RNA small subunit methyltransferase H OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rsmH PE=3 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 896 | ||||||
| 152979789 | 516 | virulence factor MviN [Janthinobacterium | 0.321 | 0.558 | 0.607 | 1e-106 | |
| 193222388 | 516 | Virulence factor MviN homolog [Herminiim | 0.321 | 0.558 | 0.607 | 1e-105 | |
| 399019580 | 516 | integral membrane protein MviN [Herbaspi | 0.321 | 0.558 | 0.610 | 1e-104 | |
| 398837023 | 517 | integral membrane protein MviN [Herbaspi | 0.321 | 0.557 | 0.603 | 1e-104 | |
| 340788455 | 516 | Virulence factor, mviN-like protein [Col | 0.321 | 0.558 | 0.581 | 1e-104 | |
| 300310724 | 517 | virulence factor transmembrane protein [ | 0.321 | 0.557 | 0.603 | 1e-104 | |
| 409405184 | 517 | virulence factor transmembrane protein [ | 0.321 | 0.557 | 0.607 | 1e-103 | |
| 415940644 | 517 | Virulence factor [Herbaspirillum frising | 0.321 | 0.557 | 0.597 | 1e-102 | |
| 445495622 | 516 | virulence factor MviN [Janthinobacterium | 0.321 | 0.558 | 0.587 | 1e-100 | |
| 395761381 | 515 | virulence factor MviN [Janthinobacterium | 0.321 | 0.559 | 0.571 | 1e-98 |
| >gi|152979789|ref|YP_001354210.1| virulence factor MviN [Janthinobacterium sp. Marseille] gi|151279866|gb|ABR88276.1| MviN, virulence factor (MOP family) [Janthinobacterium sp. Marseille] | Back alignment and taxonomy information |
|---|
Score = 392 bits (1007), Expect = e-106, Method: Compositional matrix adjust.
Identities = 190/313 (60%), Positives = 230/313 (73%), Gaps = 25/313 (7%)
Query: 1 MSLHKTFITISSITLFSRITGLFREILFARVFGASIYTDAFNIAFRIPNLLRRLFAEGAF 60
M+LHKT +S +T+ SR+TGL REILFAR FGAS YTDAFNIAFRIPNLLRRLFAEGAF
Sbjct: 1 MNLHKTLAAVSGMTMVSRVTGLIREILFARAFGASAYTDAFNIAFRIPNLLRRLFAEGAF 60
Query: 61 SQAFVPILTEYKNKRGNIATKKLIDHVATVLIWFMFFICVFGIIMAPIIVYLVATGFIDN 120
SQAFVPIL EYK+++G ATK L+DHVATVLIW M CV G+I +P IVYL+ATG
Sbjct: 61 SQAFVPILAEYKSQKGEEATKSLVDHVATVLIWTMLLTCVLGVIGSPFIVYLIATGLKTK 120
Query: 121 YKIFNITVSLTRIMFPYVGFMAFITLASSILNIWSQFKIPAFTPILLNIS---------- 170
+ F+ +V +TR+MFPY+GFMAF+ L+ ILN W +FKIPAFTP+LLN+S
Sbjct: 121 SEAFDASVWMTRVMFPYIGFMAFVALSGGILNTWREFKIPAFTPVLLNLSFIVATLFLAP 180
Query: 171 ---------------CGALQIIIQIPSLIKIGMFPHIKLNPSHGFKNIAVRRILKKMGPS 215
G LQ+ IQ+P+L+KIGM P + NP + VR++L KMGP+
Sbjct: 181 YLDQPIYAMAIAVVVGGVLQMAIQVPALLKIGMLPRVSRNPFASLGDAGVRKVLSKMGPA 240
Query: 216 VFSVFAAQISLMLNTNIASQMREGSLSCLSYADRLMEFPTTLLGVTFNTILLPNLSKARI 275
VF+V AAQISLM+NTNIAS++ GS+S LSYADRLMEFPT LLGV TILLP+LSKA
Sbjct: 241 VFAVSAAQISLMINTNIASRLESGSVSWLSYADRLMEFPTALLGVALGTILLPSLSKANF 300
Query: 276 ENNTEEYSAILDW 288
E NTEEYS++LDW
Sbjct: 301 EGNTEEYSSLLDW 313
|
Source: Janthinobacterium sp. Marseille Species: Janthinobacterium sp. Marseille Genus: Janthinobacterium Family: Oxalobacteraceae Order: Burkholderiales Class: Betaproteobacteria Phylum: Proteobacteria Superkingdom: Bacteria |
| >gi|193222388|emb|CAL62581.2| Virulence factor MviN homolog [Herminiimonas arsenicoxydans] | Back alignment and taxonomy information |
|---|
| >gi|399019580|ref|ZP_10721726.1| integral membrane protein MviN [Herbaspirillum sp. CF444] gi|398097471|gb|EJL87775.1| integral membrane protein MviN [Herbaspirillum sp. CF444] | Back alignment and taxonomy information |
|---|
| >gi|398837023|ref|ZP_10594336.1| integral membrane protein MviN [Herbaspirillum sp. YR522] gi|398209592|gb|EJM96262.1| integral membrane protein MviN [Herbaspirillum sp. YR522] | Back alignment and taxonomy information |
|---|
| >gi|340788455|ref|YP_004753920.1| Virulence factor, mviN-like protein [Collimonas fungivorans Ter331] gi|340553722|gb|AEK63097.1| Virulence factor, mviN-like protein [Collimonas fungivorans Ter331] | Back alignment and taxonomy information |
|---|
| >gi|300310724|ref|YP_003774816.1| virulence factor transmembrane protein [Herbaspirillum seropedicae SmR1] gi|300073509|gb|ADJ62908.1| virulence factor transmembrane protein [Herbaspirillum seropedicae SmR1] | Back alignment and taxonomy information |
|---|
| >gi|409405184|ref|ZP_11253646.1| virulence factor transmembrane protein [Herbaspirillum sp. GW103] gi|386433733|gb|EIJ46558.1| virulence factor transmembrane protein [Herbaspirillum sp. GW103] | Back alignment and taxonomy information |
|---|
| >gi|415940644|ref|ZP_11555681.1| Virulence factor [Herbaspirillum frisingense GSF30] gi|407759139|gb|EKF68875.1| Virulence factor [Herbaspirillum frisingense GSF30] | Back alignment and taxonomy information |
|---|
| >gi|445495622|ref|ZP_21462666.1| virulence factor MviN [Janthinobacterium sp. HH01] gi|444791783|gb|ELX13330.1| virulence factor MviN [Janthinobacterium sp. HH01] | Back alignment and taxonomy information |
|---|
| >gi|395761381|ref|ZP_10442050.1| virulence factor MviN [Janthinobacterium lividum PAMC 25724] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 896 | ||||||
| UNIPROTKB|P0AF16 | 511 | murJ "lipid II flippase" [Esch | 0.189 | 0.332 | 0.482 | 2.6e-76 | |
| UNIPROTKB|P60390 | 313 | rsmH "16S rRNA m4C1402 methylt | 0.287 | 0.824 | 0.515 | 8.5e-65 | |
| UNIPROTKB|Q83F35 | 307 | rsmH "Ribosomal RNA small subu | 0.301 | 0.879 | 0.463 | 3.4e-58 | |
| TIGR_CMR|CBU_0116 | 307 | CBU_0116 "S-adenosyl-methyltra | 0.301 | 0.879 | 0.463 | 3.4e-58 | |
| UNIPROTKB|Q87WX7 | 313 | rsmH "Ribosomal RNA small subu | 0.299 | 0.856 | 0.456 | 1.7e-57 | |
| UNIPROTKB|Q9KPF9 | 316 | rsmH "Ribosomal RNA small subu | 0.306 | 0.870 | 0.454 | 2.9e-57 | |
| TIGR_CMR|VC_2409 | 316 | VC_2409 "conserved hypothetica | 0.306 | 0.870 | 0.454 | 2.9e-57 | |
| UNIPROTKB|Q8E9P0 | 313 | rsmH "Ribosomal RNA small subu | 0.287 | 0.824 | 0.479 | 3.9e-57 | |
| TIGR_CMR|SO_4227 | 313 | SO_4227 "conserved hypothetica | 0.287 | 0.824 | 0.479 | 3.9e-57 | |
| UNIPROTKB|Q47VQ1 | 316 | rsmH "Ribosomal RNA small subu | 0.287 | 0.816 | 0.479 | 7.5e-55 |
| UNIPROTKB|P0AF16 murJ "lipid II flippase" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
Score = 430 (156.4 bits), Expect = 2.6e-76, Sum P(3) = 2.6e-76
Identities = 82/170 (48%), Positives = 119/170 (70%)
Query: 1 MSLHKTFITISSITLFSRITGLFREILFARVFGASIYTDAFNIAFRIPNLLRRLFAEGAF 60
M+L K+ +SS+T+FSR+ G R+ + AR+FGA + TDAF +AF++PNLLRR+FAEGAF
Sbjct: 1 MNLLKSLAAVSSMTMFSRVLGFARDAIVARIFGAGMATDAFFVAFKLPNLLRRIFAEGAF 60
Query: 61 SQAFVPILTEYKNKRGNIATKKLIDHVATVLIWFMFFICVFGIIMAPIIVYLVATGFIDN 120
SQAFVPIL EYK+K+G AT+ + +V+ +L + + V G++ AP ++ + A GF D
Sbjct: 61 SQAFVPILAEYKSKQGEDATRVFVSYVSGLLTLALAVVTVAGMLAAPWVIMVTAPGFADT 120
Query: 121 YKIFNITVSLTRIMFPYVGFMAFITLASSILNIWSQFKIPAFTPILLNIS 170
F +T L +I FPY+ ++ +L +ILN W++F IPAF P LLNIS
Sbjct: 121 ADKFALTSQLLKITFPYILLISLASLVGAILNTWNRFSIPAFAPTLLNIS 170
|
|
| UNIPROTKB|P60390 rsmH "16S rRNA m4C1402 methyltransferase" [Escherichia coli K-12 (taxid:83333)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q83F35 rsmH "Ribosomal RNA small subunit methyltransferase H" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|CBU_0116 CBU_0116 "S-adenosyl-methyltransferase MraW" [Coxiella burnetii RSA 493 (taxid:227377)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q87WX7 rsmH "Ribosomal RNA small subunit methyltransferase H" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9KPF9 rsmH "Ribosomal RNA small subunit methyltransferase H" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|VC_2409 VC_2409 "conserved hypothetical protein" [Vibrio cholerae O1 biovar El Tor (taxid:686)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8E9P0 rsmH "Ribosomal RNA small subunit methyltransferase H" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| TIGR_CMR|SO_4227 SO_4227 "conserved hypothetical protein TIGR00006" [Shewanella oneidensis MR-1 (taxid:211586)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q47VQ1 rsmH "Ribosomal RNA small subunit methyltransferase H" [Colwellia psychrerythraea 34H (taxid:167879)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
| ID | Name | Annotated EC number | Identity | Query coverage | Hit coverage | RBH(Q2H) | RBH(H2Q) |
| B1IR96 | RSMH_ECOLC | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5152 | 0.2879 | 0.8242 | yes | N/A |
| C5W331 | RSMH_ECOBD | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5152 | 0.2879 | 0.8242 | yes | N/A |
| B7UID2 | RSMH_ECO27 | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5152 | 0.2879 | 0.8242 | yes | N/A |
| B7NHI8 | RSMH_ECO7I | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5152 | 0.2879 | 0.8242 | yes | N/A |
| A4G8U6 | RSMH_HERAR | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5340 | 0.3102 | 0.8660 | yes | N/A |
| B7LFV2 | RSMH_ECO55 | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5152 | 0.2879 | 0.8242 | yes | N/A |
| A7ZHH3 | RSMH_ECO24 | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5152 | 0.2879 | 0.8242 | yes | N/A |
| Q8FL68 | RSMH_ECOL6 | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5152 | 0.2879 | 0.8242 | yes | N/A |
| B7M125 | RSMH_ECO8A | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5152 | 0.2879 | 0.8242 | yes | N/A |
| Q0TLQ7 | RSMH_ECOL5 | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5152 | 0.2879 | 0.8242 | yes | N/A |
| C6UM45 | RSMH_ECOBR | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5152 | 0.2879 | 0.8242 | yes | N/A |
| B7LWH0 | RSMH_ESCF3 | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5152 | 0.2879 | 0.8242 | yes | N/A |
| B2U287 | RSMH_SHIB3 | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5152 | 0.2879 | 0.8242 | yes | N/A |
| B5Y1V5 | RSMH_KLEP3 | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5114 | 0.2879 | 0.8242 | yes | N/A |
| A8ALL4 | RSMH_CITK8 | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5152 | 0.2879 | 0.8216 | yes | N/A |
| B1XC59 | RSMH_ECODH | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5152 | 0.2879 | 0.8242 | yes | N/A |
| A7ZW34 | RSMH_ECOHS | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5152 | 0.2879 | 0.8242 | yes | N/A |
| Q326F3 | RSMH_SHIBS | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5152 | 0.2879 | 0.8242 | yes | N/A |
| A1A7C7 | RSMH_ECOK1 | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5152 | 0.2879 | 0.8242 | yes | N/A |
| B7N7V5 | RSMH_ECOLU | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5152 | 0.2879 | 0.8242 | yes | N/A |
| C4ZQ04 | RSMH_ECOBW | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5152 | 0.2879 | 0.8242 | yes | N/A |
| B5YZB8 | RSMH_ECO5E | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5152 | 0.2879 | 0.8242 | yes | N/A |
| B7MAK5 | RSMH_ECO45 | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5152 | 0.2879 | 0.8242 | yes | N/A |
| Q1RGB3 | RSMH_ECOUT | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5152 | 0.2879 | 0.8242 | yes | N/A |
| B1LG19 | RSMH_ECOSM | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5152 | 0.2879 | 0.8242 | yes | N/A |
| B6HZ59 | RSMH_ECOSE | 2, ., 1, ., 1, ., 1, 9, 9 | 0.5152 | 0.2879 | 0.8242 | yes | N/A |
EC Number Prediction by EFICAz Software
| Prediction Level | EC number | Confidence of Prediction |
| 3rd Layer | 2.1.1 | 0.691 |
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 896 | |||
| PRK00050 | 296 | PRK00050, PRK00050, 16S rRNA m(4)C1402 methyltrans | 1e-115 | |
| COG0275 | 314 | COG0275, COG0275, Predicted S-adenosylmethionine-d | 1e-111 | |
| pfam01795 | 310 | pfam01795, Methyltransf_5, MraW methylase family | 1e-100 | |
| cd13123 | 420 | cd13123, MATE_MurJ_like, MurJ/MviN, a subfamily of | 2e-88 | |
| TIGR00006 | 307 | TIGR00006, TIGR00006, 16S rRNA (cytosine(1402)-N(4 | 2e-88 | |
| COG0728 | 518 | COG0728, MviN, Uncharacterized membrane protein, p | 7e-86 | |
| PRK10799 | 247 | PRK10799, PRK10799, metal-binding protein; Provisi | 8e-73 | |
| TIGR01695 | 502 | TIGR01695, mviN, integral membrane protein MviN | 2e-65 | |
| pfam03023 | 452 | pfam03023, MVIN, MviN-like protein | 2e-57 | |
| COG0327 | 250 | COG0327, COG0327, Uncharacterized conserved protei | 2e-56 | |
| TIGR00486 | 249 | TIGR00486, YbgI_SA1388, dinuclear metal center pro | 2e-52 | |
| pfam01784 | 237 | pfam01784, NIF3, NIF3 (NGG1p interacting factor 3) | 6e-52 | |
| COG0728 | 518 | COG0728, MviN, Uncharacterized membrane protein, p | 3e-10 | |
| TIGR01695 | 502 | TIGR01695, mviN, integral membrane protein MviN | 5e-10 | |
| pfam03023 | 452 | pfam03023, MVIN, MviN-like protein | 4e-06 | |
| COG2244 | 480 | COG2244, RfbX, Membrane protein involved in the ex | 0.001 |
| >gnl|CDD|234597 PRK00050, PRK00050, 16S rRNA m(4)C1402 methyltranserfase; Provisional | Back alignment and domain information |
|---|
Score = 352 bits (907), Expect = e-115
Identities = 118/253 (46%), Positives = 169/253 (66%), Gaps = 6/253 (2%)
Query: 392 LNEAINWLNIENERINGIYIDATFGQGGHSCKILERLGKKGRLIAIDKDTESVSLGNK-- 449
L+E ++ L I + +GIY+D TFG GGHS ILERLG KGRLIAID+D ++++
Sbjct: 8 LDEVVDALAI---KPDGIYVDGTFGGGGHSRAILERLGPKGRLIAIDRDPDAIAAAKDRL 64
Query: 450 ITDSRFSIIHNCFTELDIILKKYNIKKIDGILFDLGISSNQINNELRGFSFLLDGPLDMR 509
RF+++H F+ L +L + + K+DGIL DLG+SS Q+++ RGFSF DGPLDMR
Sbjct: 65 KPFGRFTLVHGNFSNLKEVLAE-GLGKVDGILLDLGVSSPQLDDAERGFSFRKDGPLDMR 123
Query: 510 MDITRGISASKWLANATEFNIKKVIQDYGEERFAKKIAKEIVHYRSITPITRTKQLVEII 569
MD ++G++A++ + +E + ++ ++YGEERFA++IA+ IV R PIT T +L EII
Sbjct: 124 MDQSQGLTAAEVVNTYSEEELARIFKEYGEERFARRIARAIVEARPKKPITTTGELAEII 183
Query: 570 LKSIRGNKRYKNPATRTFQAIRIYINQELKNLSIALKIGFKKLNIKGRIVVISFHSLEDR 629
++ ++ +PATRTFQA+RI +N EL+ L AL+ L GR+ VISFHSLEDR
Sbjct: 184 KSAVPPRRKGIHPATRTFQALRIEVNDELEELERALEAALDLLKPGGRLAVISFHSLEDR 243
Query: 630 IVKNFINFNTKIP 642
IVK F +K
Sbjct: 244 IVKRFFRELSKGC 256
|
Length = 296 |
| >gnl|CDD|223352 COG0275, COG0275, Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|216706 pfam01795, Methyltransf_5, MraW methylase family | Back alignment and domain information |
|---|
| >gnl|CDD|240528 cd13123, MATE_MurJ_like, MurJ/MviN, a subfamily of the multidrug and toxic compound extrusion (MATE)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|232778 TIGR00006, TIGR00006, 16S rRNA (cytosine(1402)-N(4))-methyltransferase | Back alignment and domain information |
|---|
| >gnl|CDD|223800 COG0728, MviN, Uncharacterized membrane protein, putative virulence factor [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|182741 PRK10799, PRK10799, metal-binding protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|233536 TIGR01695, mviN, integral membrane protein MviN | Back alignment and domain information |
|---|
| >gnl|CDD|217323 pfam03023, MVIN, MviN-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|223404 COG0327, COG0327, Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|213534 TIGR00486, YbgI_SA1388, dinuclear metal center protein, YbgI/SA1388 family | Back alignment and domain information |
|---|
| >gnl|CDD|216697 pfam01784, NIF3, NIF3 (NGG1p interacting factor 3) | Back alignment and domain information |
|---|
| >gnl|CDD|223800 COG0728, MviN, Uncharacterized membrane protein, putative virulence factor [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|233536 TIGR01695, mviN, integral membrane protein MviN | Back alignment and domain information |
|---|
| >gnl|CDD|217323 pfam03023, MVIN, MviN-like protein | Back alignment and domain information |
|---|
| >gnl|CDD|225153 COG2244, RfbX, Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 896 | |||
| COG0275 | 314 | Predicted S-adenosylmethionine-dependent methyltra | 100.0 | |
| PF01795 | 310 | Methyltransf_5: MraW methylase family; InterPro: I | 100.0 | |
| TIGR00006 | 305 | S-adenosyl-methyltransferase MraW. Genetics paper | 100.0 | |
| PRK00050 | 296 | 16S rRNA m(4)C1402 methyltranserfase; Provisional | 100.0 | |
| KOG2782|consensus | 303 | 100.0 | ||
| TIGR00486 | 249 | YbgI_SA1388 dinuclear metal center protein, YbgI/S | 100.0 | |
| PF01784 | 241 | NIF3: NIF3 (NGG1p interacting factor 3); InterPro: | 100.0 | |
| PRK10799 | 247 | metal-binding protein; Provisional | 100.0 | |
| COG0327 | 250 | Uncharacterized conserved protein [Function unknow | 100.0 | |
| COG0728 | 518 | MviN Uncharacterized membrane protein, putative vi | 100.0 | |
| TIGR01695 | 502 | mviN integral membrane protein MviN. This model re | 100.0 | |
| KOG4131|consensus | 272 | 100.0 | ||
| PF03023 | 451 | MVIN: MviN-like protein; InterPro: IPR004268 This | 100.0 | |
| PRK10459 | 492 | colanic acid exporter; Provisional | 99.96 | |
| TIGR02900 | 488 | spore_V_B stage V sporulation protein B. SpoVB is | 99.95 | |
| COG0534 | 455 | NorM Na+-driven multidrug efflux pump [Defense mec | 99.93 | |
| PRK09575 | 453 | vmrA multidrug efflux pump VmrA; Reviewed | 99.91 | |
| PRK10367 | 441 | DNA-damage-inducible SOS response protein; Provisi | 99.91 | |
| PRK10189 | 478 | MATE family multidrug exporter; Provisional | 99.9 | |
| PRK15099 | 416 | O-antigen translocase; Provisional | 99.9 | |
| PRK00187 | 464 | multidrug efflux protein NorA; Provisional | 99.9 | |
| PRK01766 | 456 | multidrug efflux protein; Reviewed | 99.89 | |
| TIGR00797 | 342 | matE putative efflux protein, MATE family. The MAT | 99.87 | |
| COG2244 | 480 | RfbX Membrane protein involved in the export of O- | 99.81 | |
| PF01943 | 273 | Polysacc_synt: Polysaccharide biosynthesis protein | 99.64 | |
| PF13440 | 251 | Polysacc_synt_3: Polysaccharide biosynthesis prote | 99.37 | |
| PRK00187 | 464 | multidrug efflux protein NorA; Provisional | 98.96 | |
| PRK09575 | 453 | vmrA multidrug efflux pump VmrA; Reviewed | 98.92 | |
| TIGR01695 | 502 | mviN integral membrane protein MviN. This model re | 98.91 | |
| PRK01766 | 456 | multidrug efflux protein; Reviewed | 98.9 | |
| PRK10189 | 478 | MATE family multidrug exporter; Provisional | 98.9 | |
| PF01554 | 162 | MatE: MatE; InterPro: IPR002528 Characterised memb | 98.86 | |
| COG0534 | 455 | NorM Na+-driven multidrug efflux pump [Defense mec | 98.83 | |
| PF03023 | 451 | MVIN: MviN-like protein; InterPro: IPR004268 This | 98.77 | |
| KOG1347|consensus | 473 | 98.71 | ||
| COG0728 | 518 | MviN Uncharacterized membrane protein, putative vi | 98.65 | |
| PF06962 | 140 | rRNA_methylase: Putative rRNA methylase; InterPro: | 98.64 | |
| PRK10459 | 492 | colanic acid exporter; Provisional | 98.57 | |
| PRK10367 | 441 | DNA-damage-inducible SOS response protein; Provisi | 98.57 | |
| TIGR02900 | 488 | spore_V_B stage V sporulation protein B. SpoVB is | 98.49 | |
| PF14667 | 146 | Polysacc_synt_C: Polysaccharide biosynthesis C-ter | 98.45 | |
| TIGR00797 | 342 | matE putative efflux protein, MATE family. The MAT | 98.28 | |
| PRK15099 | 416 | O-antigen translocase; Provisional | 98.07 | |
| PF13659 | 117 | Methyltransf_26: Methyltransferase domain; PDB: 3G | 98.07 | |
| COG2244 | 480 | RfbX Membrane protein involved in the export of O- | 98.07 | |
| TIGR00446 | 264 | nop2p NOL1/NOP2/sun family putative RNA methylase. | 97.93 | |
| PRK14903 | 431 | 16S rRNA methyltransferase B; Provisional | 97.91 | |
| PF01209 | 233 | Ubie_methyltran: ubiE/COQ5 methyltransferase famil | 97.91 | |
| PF05175 | 170 | MTS: Methyltransferase small domain; InterPro: IPR | 97.78 | |
| PRK14902 | 444 | 16S rRNA methyltransferase B; Provisional | 97.75 | |
| PF04506 | 549 | Rft-1: Rft protein; InterPro: IPR007594 Asymmetric | 97.75 | |
| PF09445 | 163 | Methyltransf_15: RNA cap guanine-N2 methyltransfer | 97.75 | |
| TIGR01934 | 223 | MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis | 97.56 | |
| TIGR03533 | 284 | L3_gln_methyl protein-(glutamine-N5) methyltransfe | 97.44 | |
| PRK00107 | 187 | gidB 16S rRNA methyltransferase GidB; Reviewed | 97.44 | |
| PF12847 | 112 | Methyltransf_18: Methyltransferase domain; PDB: 3G | 97.42 | |
| PRK14901 | 434 | 16S rRNA methyltransferase B; Provisional | 97.41 | |
| PF01554 | 162 | MatE: MatE; InterPro: IPR002528 Characterised memb | 97.38 | |
| KOG2864|consensus | 530 | 97.38 | ||
| PRK11805 | 307 | N5-glutamine S-adenosyl-L-methionine-dependent met | 97.24 | |
| TIGR00138 | 181 | gidB 16S rRNA methyltransferase GidB. GidB (glucos | 97.1 | |
| PF13847 | 152 | Methyltransf_31: Methyltransferase domain; PDB: 3T | 97.09 | |
| PRK00377 | 198 | cbiT cobalt-precorrin-6Y C(15)-methyltransferase; | 97.07 | |
| TIGR02752 | 231 | MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me | 97.06 | |
| PRK13944 | 205 | protein-L-isoaspartate O-methyltransferase; Provis | 97.01 | |
| TIGR00080 | 215 | pimt protein-L-isoaspartate(D-aspartate) O-methylt | 96.99 | |
| PRK14968 | 188 | putative methyltransferase; Provisional | 96.94 | |
| COG2226 | 238 | UbiE Methylase involved in ubiquinone/menaquinone | 96.94 | |
| PRK14966 | 423 | unknown domain/N5-glutamine S-adenosyl-L-methionin | 96.92 | |
| TIGR02469 | 124 | CbiT precorrin-6Y C5,15-methyltransferase (decarbo | 96.9 | |
| COG2242 | 187 | CobL Precorrin-6B methylase 2 [Coenzyme metabolism | 96.83 | |
| TIGR01177 | 329 | conserved hypothetical protein TIGR01177. This fam | 96.83 | |
| PLN02233 | 261 | ubiquinone biosynthesis methyltransferase | 96.83 | |
| PRK11188 | 209 | rrmJ 23S rRNA methyltransferase J; Provisional | 96.8 | |
| TIGR03534 | 251 | RF_mod_PrmC protein-(glutamine-N5) methyltransfera | 96.8 | |
| PF13649 | 101 | Methyltransf_25: Methyltransferase domain; PDB: 3B | 96.8 | |
| PRK00121 | 202 | trmB tRNA (guanine-N(7)-)-methyltransferase; Revie | 96.74 | |
| cd02440 | 107 | AdoMet_MTases S-adenosylmethionine-dependent methy | 96.71 | |
| PRK13942 | 212 | protein-L-isoaspartate O-methyltransferase; Provis | 96.7 | |
| TIGR00406 | 288 | prmA ribosomal protein L11 methyltransferase. Ribo | 96.52 | |
| PRK00517 | 250 | prmA ribosomal protein L11 methyltransferase; Revi | 96.51 | |
| PTZ00146 | 293 | fibrillarin; Provisional | 96.42 | |
| KOG2730|consensus | 263 | 96.41 | ||
| TIGR00537 | 179 | hemK_rel_arch HemK-related putative methylase. The | 96.4 | |
| PF08704 | 247 | GCD14: tRNA methyltransferase complex GCD14 subuni | 96.38 | |
| KOG1347|consensus | 473 | 96.36 | ||
| PRK07402 | 196 | precorrin-6B methylase; Provisional | 96.25 | |
| PRK03612 | 521 | spermidine synthase; Provisional | 96.2 | |
| smart00650 | 169 | rADc Ribosomal RNA adenine dimethylases. | 96.15 | |
| PF07260 | 345 | ANKH: Progressive ankylosis protein (ANKH); InterP | 96.14 | |
| PRK08287 | 187 | cobalt-precorrin-6Y C(15)-methyltransferase; Valid | 96.13 | |
| PRK08317 | 241 | hypothetical protein; Provisional | 96.11 | |
| PRK11036 | 255 | putative S-adenosyl-L-methionine-dependent methylt | 96.09 | |
| PLN02781 | 234 | Probable caffeoyl-CoA O-methyltransferase | 96.07 | |
| PRK00216 | 239 | ubiE ubiquinone/menaquinone biosynthesis methyltra | 96.06 | |
| COG0144 | 355 | Sun tRNA and rRNA cytosine-C5-methylases [Translat | 96.05 | |
| PTZ00338 | 294 | dimethyladenosine transferase-like protein; Provis | 96.05 | |
| PRK13943 | 322 | protein-L-isoaspartate O-methyltransferase; Provis | 95.95 | |
| COG4123 | 248 | Predicted O-methyltransferase [General function pr | 95.93 | |
| TIGR00091 | 194 | tRNA (guanine-N(7)-)-methyltransferase. In E. coli | 95.91 | |
| KOG2915|consensus | 314 | 95.81 | ||
| TIGR00740 | 239 | methyltransferase, putative. A simple BLAST search | 95.78 | |
| PRK10901 | 427 | 16S rRNA methyltransferase B; Provisional | 95.76 | |
| PRK03522 | 315 | rumB 23S rRNA methyluridine methyltransferase; Rev | 95.67 | |
| PRK14121 | 390 | tRNA (guanine-N(7)-)-methyltransferase; Provisiona | 95.65 | |
| PRK14896 | 258 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 95.64 | |
| PRK14904 | 445 | 16S rRNA methyltransferase B; Provisional | 95.59 | |
| COG2519 | 256 | GCD14 tRNA(1-methyladenosine) methyltransferase an | 95.57 | |
| KOG1663|consensus | 237 | 95.55 | ||
| PRK01683 | 258 | trans-aconitate 2-methyltransferase; Provisional | 95.52 | |
| PRK00274 | 272 | ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 | 95.49 | |
| PRK13168 | 443 | rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe | 95.48 | |
| PRK04266 | 226 | fibrillarin; Provisional | 95.44 | |
| TIGR00438 | 188 | rrmJ cell division protein FtsJ. | 95.43 | |
| TIGR03704 | 251 | PrmC_rel_meth putative protein-(glutamine-N5) meth | 95.43 | |
| TIGR00563 | 426 | rsmB ribosomal RNA small subunit methyltransferase | 95.39 | |
| TIGR02021 | 219 | BchM-ChlM magnesium protoporphyrin O-methyltransfe | 95.36 | |
| PF01728 | 181 | FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 | 95.35 | |
| PRK15451 | 247 | tRNA cmo(5)U34 methyltransferase; Provisional | 95.33 | |
| PLN02244 | 340 | tocopherol O-methyltransferase | 95.31 | |
| PRK06922 | 677 | hypothetical protein; Provisional | 95.3 | |
| PRK04457 | 262 | spermidine synthase; Provisional | 95.27 | |
| PRK14103 | 255 | trans-aconitate 2-methyltransferase; Provisional | 95.26 | |
| PRK11873 | 272 | arsM arsenite S-adenosylmethyltransferase; Reviewe | 95.26 | |
| PHA03411 | 279 | putative methyltransferase; Provisional | 95.14 | |
| TIGR00479 | 431 | rumA 23S rRNA (uracil-5-)-methyltransferase RumA. | 95.14 | |
| PF02353 | 273 | CMAS: Mycolic acid cyclopropane synthetase; InterP | 95.11 | |
| PF01596 | 205 | Methyltransf_3: O-methyltransferase; InterPro: IPR | 95.1 | |
| PF01135 | 209 | PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl | 95.1 | |
| PF02475 | 200 | Met_10: Met-10+ like-protein; InterPro: IPR003402 | 95.07 | |
| PLN02476 | 278 | O-methyltransferase | 95.01 | |
| PF04445 | 234 | SAM_MT: Putative SAM-dependent methyltransferase; | 94.99 | |
| PRK10742 | 250 | putative methyltransferase; Provisional | 94.98 | |
| PLN03075 | 296 | nicotianamine synthase; Provisional | 94.93 | |
| TIGR02085 | 374 | meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer | 94.9 | |
| PRK05785 | 226 | hypothetical protein; Provisional | 94.87 | |
| TIGR00536 | 284 | hemK_fam HemK family putative methylases. The gene | 94.87 | |
| PRK11933 | 470 | yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; | 94.85 | |
| COG2265 | 432 | TrmA SAM-dependent methyltransferases related to t | 94.77 | |
| PRK09328 | 275 | N5-glutamine S-adenosyl-L-methionine-dependent met | 94.67 | |
| TIGR02072 | 240 | BioC biotin biosynthesis protein BioC. This enzyme | 94.66 | |
| TIGR03587 | 204 | Pse_Me-ase pseudaminic acid biosynthesis-associate | 94.65 | |
| PF02390 | 195 | Methyltransf_4: Putative methyltransferase ; Inter | 94.57 | |
| COG4267 | 467 | Predicted membrane protein [Function unknown] | 94.46 | |
| TIGR00755 | 253 | ksgA dimethyladenosine transferase. Alternate name | 94.4 | |
| PRK10909 | 199 | rsmD 16S rRNA m(2)G966-methyltransferase; Provisio | 94.36 | |
| COG0293 | 205 | FtsJ 23S rRNA methylase [Translation, ribosomal st | 94.3 | |
| PTZ00098 | 263 | phosphoethanolamine N-methyltransferase; Provision | 94.19 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 94.14 | |
| PRK06202 | 232 | hypothetical protein; Provisional | 94.11 | |
| PRK00312 | 212 | pcm protein-L-isoaspartate O-methyltransferase; Re | 94.03 | |
| TIGR03438 | 301 | probable methyltransferase. This model represents | 94.02 | |
| PF05958 | 352 | tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas | 93.97 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 93.86 | |
| COG4122 | 219 | Predicted O-methyltransferase [General function pr | 93.86 | |
| COG2263 | 198 | Predicted RNA methylase [Translation, ribosomal st | 93.81 | |
| PF01189 | 283 | Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR | 93.7 | |
| PF01170 | 179 | UPF0020: Putative RNA methylase family UPF0020; In | 93.59 | |
| PRK11207 | 197 | tellurite resistance protein TehB; Provisional | 93.48 | |
| PRK14967 | 223 | putative methyltransferase; Provisional | 93.44 | |
| PHA03412 | 241 | putative methyltransferase; Provisional | 93.39 | |
| PLN02589 | 247 | caffeoyl-CoA O-methyltransferase | 93.36 | |
| COG4106 | 257 | Tam Trans-aconitate methyltransferase [General fun | 93.3 | |
| PF08241 | 95 | Methyltransf_11: Methyltransferase domain; InterPr | 93.27 | |
| PRK11088 | 272 | rrmA 23S rRNA methyltransferase A; Provisional | 93.07 | |
| COG2230 | 283 | Cfa Cyclopropane fatty acid synthase and related m | 93.04 | |
| TIGR02716 | 306 | C20_methyl_CrtF C-20 methyltransferase BchU. Membe | 93.01 | |
| TIGR02081 | 194 | metW methionine biosynthesis protein MetW. This pr | 92.98 | |
| PRK05031 | 362 | tRNA (uracil-5-)-methyltransferase; Validated | 92.98 | |
| PLN02396 | 322 | hexaprenyldihydroxybenzoate methyltransferase | 92.75 | |
| COG4262 | 508 | Predicted spermidine synthase with an N-terminal m | 92.7 | |
| PRK00811 | 283 | spermidine synthase; Provisional | 92.64 | |
| COG2890 | 280 | HemK Methylase of polypeptide chain release factor | 92.64 | |
| PRK15001 | 378 | SAM-dependent 23S ribosomal RNA mG1835 methyltrans | 92.53 | |
| TIGR00095 | 189 | RNA methyltransferase, RsmD family. This model rep | 92.37 | |
| PRK11705 | 383 | cyclopropane fatty acyl phospholipid synthase; Pro | 92.31 | |
| PLN02490 | 340 | MPBQ/MSBQ methyltransferase | 92.18 | |
| KOG3420|consensus | 185 | 92.05 | ||
| PRK15128 | 396 | 23S rRNA m(5)C1962 methyltransferase; Provisional | 91.82 | |
| PF03848 | 192 | TehB: Tellurite resistance protein TehB; InterPro: | 91.69 | |
| PLN02585 | 315 | magnesium protoporphyrin IX methyltransferase | 91.49 | |
| TIGR00478 | 228 | tly hemolysin TlyA family protein. Hemolysins are | 91.37 | |
| PLN02366 | 308 | spermidine synthase | 91.26 | |
| PRK10258 | 251 | biotin biosynthesis protein BioC; Provisional | 91.26 | |
| PF03602 | 183 | Cons_hypoth95: Conserved hypothetical protein 95; | 91.24 | |
| PRK07580 | 230 | Mg-protoporphyrin IX methyl transferase; Validated | 91.12 | |
| PRK09489 | 342 | rsmC 16S ribosomal RNA m2G1207 methyltransferase; | 90.88 | |
| PRK15068 | 322 | tRNA mo(5)U34 methyltransferase; Provisional | 90.76 | |
| TIGR02143 | 353 | trmA_only tRNA (uracil-5-)-methyltransferase. This | 90.6 | |
| TIGR00477 | 195 | tehB tellurite resistance protein TehB. Part of a | 90.56 | |
| COG2520 | 341 | Predicted methyltransferase [General function pred | 90.54 | |
| KOG2904|consensus | 328 | 90.15 | ||
| PRK01581 | 374 | speE spermidine synthase; Validated | 90.15 | |
| TIGR02987 | 524 | met_A_Alw26 type II restriction m6 adenine DNA met | 90.05 | |
| COG2521 | 287 | Predicted archaeal methyltransferase [General func | 89.98 | |
| PLN02336 | 475 | phosphoethanolamine N-methyltransferase | 89.97 | |
| COG2264 | 300 | PrmA Ribosomal protein L11 methylase [Translation, | 89.64 | |
| PF03291 | 331 | Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 | 89.45 | |
| TIGR00486 | 249 | YbgI_SA1388 dinuclear metal center protein, YbgI/S | 89.37 | |
| PRK13255 | 218 | thiopurine S-methyltransferase; Reviewed | 89.37 | |
| PRK12335 | 287 | tellurite resistance protein TehB; Provisional | 89.3 | |
| COG2518 | 209 | Pcm Protein-L-isoaspartate carboxylmethyltransfera | 89.2 | |
| PF13578 | 106 | Methyltransf_24: Methyltransferase domain; PDB: 3S | 89.03 | |
| PF06325 | 295 | PrmA: Ribosomal protein L11 methyltransferase (Prm | 88.89 | |
| PF08242 | 99 | Methyltransf_12: Methyltransferase domain; InterPr | 88.74 | |
| PRK11783 | 702 | rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi | 88.65 | |
| PRK11727 | 321 | 23S rRNA mA1618 methyltransferase; Provisional | 88.45 | |
| TIGR03840 | 213 | TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d | 88.27 | |
| COG0742 | 187 | N6-adenine-specific methylase [DNA replication, re | 88.2 | |
| KOG3191|consensus | 209 | 87.82 | ||
| smart00828 | 224 | PKS_MT Methyltransferase in polyketide synthase (P | 87.79 | |
| TIGR00452 | 314 | methyltransferase, putative. Known examples to dat | 87.79 | |
| COG0220 | 227 | Predicted S-adenosylmethionine-dependent methyltra | 87.4 | |
| PF04506 | 549 | Rft-1: Rft protein; InterPro: IPR007594 Asymmetric | 87.18 | |
| TIGR00417 | 270 | speE spermidine synthase. the SpeE subunit of sper | 86.51 | |
| KOG0820|consensus | 315 | 86.24 | ||
| PRK10799 | 247 | metal-binding protein; Provisional | 85.91 | |
| PF02254 | 116 | TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg | 85.74 | |
| PRK01544 | 506 | bifunctional N5-glutamine S-adenosyl-L-methionine- | 85.4 | |
| PF01564 | 246 | Spermine_synth: Spermine/spermidine synthase; Inte | 85.3 | |
| PF01784 | 241 | NIF3: NIF3 (NGG1p interacting factor 3); InterPro: | 84.49 | |
| TIGR01444 | 143 | fkbM_fam methyltransferase, FkbM family. Members o | 84.3 | |
| PF00398 | 262 | RrnaAD: Ribosomal RNA adenine dimethylase; InterPr | 84.18 | |
| PRK04148 | 134 | hypothetical protein; Provisional | 83.97 | |
| PF03059 | 276 | NAS: Nicotianamine synthase protein; InterPro: IPR | 83.58 | |
| KOG4589|consensus | 232 | 83.5 | ||
| PRK05134 | 233 | bifunctional 3-demethylubiquinone-9 3-methyltransf | 83.19 | |
| PLN02823 | 336 | spermine synthase | 82.92 | |
| PLN02672 | 1082 | methionine S-methyltransferase | 82.8 | |
| TIGR03439 | 319 | methyl_EasF probable methyltransferase domain, Eas | 81.66 | |
| PF01943 | 273 | Polysacc_synt: Polysaccharide biosynthesis protein | 80.82 |
| >COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.9e-99 Score=778.07 Aligned_cols=274 Identities=47% Similarity=0.748 Sum_probs=260.5
Q ss_pred cchHHHhhhccccccccCcEEEEEccCCChhHHHHHHHcCCCcEEEEEeCCHHHHHHhhcc---cCCCeEEEccChhcHH
Q psy2376 390 LFLNEAINWLNIENERINGIYIDATFGQGGHSCKILERLGKKGRLIAIDKDTESVSLGNKI---TDSRFSIIHNCFTELD 466 (896)
Q Consensus 390 ~m~~e~l~~L~~~~~~~~~~~vD~T~G~Gghs~~ll~~~~~~~~~~~~D~d~~a~~~~~~~---~~~~~~~~~~~~~~~~ 466 (896)
.+++|+++.|.++| +++|||||||.||||++||+++++.++++|+|+||+|++.|+++ +++|++++|+||+++.
T Consensus 10 VLl~E~i~~L~~~~---~giyiD~TlG~GGHS~~iL~~l~~~~~li~~DrD~~Ai~~a~~~l~~~~~r~~~v~~~F~~l~ 86 (314)
T COG0275 10 VLLNEVVELLAPKP---DGIYIDGTLGAGGHSRAILEKLPDLGRLIGIDRDPQAIAIAKERLKEFDGRVTLVHGNFANLA 86 (314)
T ss_pred hHHHHHHHhcccCC---CcEEEEecCCCcHhHHHHHHhCCCCCeEEEEcCCHHHHHHHHHHhhccCCcEEEEeCcHHHHH
Confidence 47899999999974 89999999999999999999999999999999999999999885 4789999999999999
Q ss_pred HHHHhcCCCcccEEEEecccCccccCCCCCCccCCCCCCccccCCCCCCCCHHHHHhccCHHHHHHHHHHhcCcccHHHH
Q psy2376 467 IILKKYNIKKIDGILFDLGISSNQINNELRGFSFLLDGPLDMRMDITRGISASKWLANATEFNIKKVIQDYGEERFAKKI 546 (896)
Q Consensus 467 ~~l~~~~~~~~d~il~dlG~ss~q~~~~~rgfs~~~~~~ldmrm~~~~~~~a~~~~~~~~~~~l~~i~~~yg~~~~~~~~ 546 (896)
.++++.++++|||||+||||||||||++||||||++||||||||||++++||+||||+|+|+||++||++|||||+||||
T Consensus 87 ~~l~~~~i~~vDGiL~DLGVSS~QLD~~eRGFSf~~d~pLDMRMd~~~~lsA~evvN~~~e~~L~~I~~~yGEEr~arrI 166 (314)
T COG0275 87 EALKELGIGKVDGILLDLGVSSPQLDDAERGFSFRKDGPLDMRMDQTQGLSAAEVVNTYSEEDLARIFKEYGEERFAKRI 166 (314)
T ss_pred HHHHhcCCCceeEEEEeccCCccccCCCcCCcccCCCCCcccCcCCCCCCCHHHHHhcCCHHHHHHHHHHhccHhhHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHhccCCCcchHHHHHHHHhhccCCC--CCCChhhHHHHHHHHHHhhhHHHHHHHHHHHHhccccCceEEEEeec
Q psy2376 547 AKEIVHYRSITPITRTKQLVEIILKSIRGNK--RYKNPATRTFQAIRIYINQELKNLSIALKIGFKKLNIKGRIVVISFH 624 (896)
Q Consensus 547 a~~i~~~r~~~~~~~t~~l~~~~~~~~~~~~--~~~~~~~~~fqalri~vn~el~~l~~~l~~~~~~l~~~g~~~visfh 624 (896)
|++||++|+++||+||.||+|+|++++|... +++||||||||||||+|||||++|+++|++|.++|+||||++|||||
T Consensus 167 A~aIv~~R~~~pi~tT~eLaeiI~~~~p~~~~~k~~hPAtr~FQAiRI~VNdEL~~L~~~L~~a~~~L~~gGRl~VIsFH 246 (314)
T COG0275 167 ARAIVERRKKKPIETTKELAEIIKSAIPAKEKRKKIHPATRTFQAIRIYVNDELEELEEALEAALDLLKPGGRLAVISFH 246 (314)
T ss_pred HHHHHHHhccCCCccHHHHHHHHHHhCCchhcccCCCcchhhhhhheeeehhHHHHHHHHHHHHHHhhCCCcEEEEEEec
Confidence 9999999999999999999999999999654 34699999999999999999999999999999999999999999999
Q ss_pred chhHHHHHHHHhhcCCCCCCCCCCCccccCCcccchhhccccc
Q psy2376 625 SLEDRIVKNFINFNTKIPHIDRRLPIYNYLFEPKMKFLARCKP 667 (896)
Q Consensus 625 sledr~vk~~~~~~~~~~~~~~~~~~~~~~~~p~~~~l~~~~~ 667 (896)
||||||||+||+++++ |.+|+++|+++++..++++.+|++-+
T Consensus 247 SLEDRiVK~ff~~~s~-~~~p~~lP~~~~~~~~~~~~itkK~i 288 (314)
T COG0275 247 SLEDRIVKNFFKELSK-PGVPKGLPVTEEGPALKFKLITKKPI 288 (314)
T ss_pred chHHHHHHHHHHHhcc-cCCCCCCCcccccccchhhhccCCCc
Confidence 9999999999999998 89999999999984444788876643
|
|
| >PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria | Back alignment and domain information |
|---|
| >TIGR00006 S-adenosyl-methyltransferase MraW | Back alignment and domain information |
|---|
| >PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional | Back alignment and domain information |
|---|
| >KOG2782|consensus | Back alignment and domain information |
|---|
| >TIGR00486 YbgI_SA1388 dinuclear metal center protein, YbgI/SA1388 family | Back alignment and domain information |
|---|
| >PF01784 NIF3: NIF3 (NGG1p interacting factor 3); InterPro: IPR002678 This family contains several NIF3 (NGG1p interacting factor 3) protein homologues | Back alignment and domain information |
|---|
| >PRK10799 metal-binding protein; Provisional | Back alignment and domain information |
|---|
| >COG0327 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >COG0728 MviN Uncharacterized membrane protein, putative virulence factor [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01695 mviN integral membrane protein MviN | Back alignment and domain information |
|---|
| >KOG4131|consensus | Back alignment and domain information |
|---|
| >PF03023 MVIN: MviN-like protein; InterPro: IPR004268 This entry represents MviN, a family of integral membrane proteins predicted to have ten or more transmembrane regions | Back alignment and domain information |
|---|
| >PRK10459 colanic acid exporter; Provisional | Back alignment and domain information |
|---|
| >TIGR02900 spore_V_B stage V sporulation protein B | Back alignment and domain information |
|---|
| >COG0534 NorM Na+-driven multidrug efflux pump [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK09575 vmrA multidrug efflux pump VmrA; Reviewed | Back alignment and domain information |
|---|
| >PRK10367 DNA-damage-inducible SOS response protein; Provisional | Back alignment and domain information |
|---|
| >PRK10189 MATE family multidrug exporter; Provisional | Back alignment and domain information |
|---|
| >PRK15099 O-antigen translocase; Provisional | Back alignment and domain information |
|---|
| >PRK00187 multidrug efflux protein NorA; Provisional | Back alignment and domain information |
|---|
| >PRK01766 multidrug efflux protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00797 matE putative efflux protein, MATE family | Back alignment and domain information |
|---|
| >COG2244 RfbX Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] | Back alignment and domain information |
|---|
| >PF01943 Polysacc_synt: Polysaccharide biosynthesis protein; InterPro: IPR002797 Members of this family are integral membrane proteins [], and many are implicated in the production of polysaccharide | Back alignment and domain information |
|---|
| >PF13440 Polysacc_synt_3: Polysaccharide biosynthesis protein | Back alignment and domain information |
|---|
| >PRK00187 multidrug efflux protein NorA; Provisional | Back alignment and domain information |
|---|
| >PRK09575 vmrA multidrug efflux pump VmrA; Reviewed | Back alignment and domain information |
|---|
| >TIGR01695 mviN integral membrane protein MviN | Back alignment and domain information |
|---|
| >PRK01766 multidrug efflux protein; Reviewed | Back alignment and domain information |
|---|
| >PRK10189 MATE family multidrug exporter; Provisional | Back alignment and domain information |
|---|
| >PF01554 MatE: MatE; InterPro: IPR002528 Characterised members of the Multi Antimicrobial Extrusion (MATE) family function as drug/sodium antiporters | Back alignment and domain information |
|---|
| >COG0534 NorM Na+-driven multidrug efflux pump [Defense mechanisms] | Back alignment and domain information |
|---|
| >PF03023 MVIN: MviN-like protein; InterPro: IPR004268 This entry represents MviN, a family of integral membrane proteins predicted to have ten or more transmembrane regions | Back alignment and domain information |
|---|
| >KOG1347|consensus | Back alignment and domain information |
|---|
| >COG0728 MviN Uncharacterized membrane protein, putative virulence factor [General function prediction only] | Back alignment and domain information |
|---|
| >PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases | Back alignment and domain information |
|---|
| >PRK10459 colanic acid exporter; Provisional | Back alignment and domain information |
|---|
| >PRK10367 DNA-damage-inducible SOS response protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02900 spore_V_B stage V sporulation protein B | Back alignment and domain information |
|---|
| >PF14667 Polysacc_synt_C: Polysaccharide biosynthesis C-terminal domain | Back alignment and domain information |
|---|
| >TIGR00797 matE putative efflux protein, MATE family | Back alignment and domain information |
|---|
| >PRK15099 O-antigen translocase; Provisional | Back alignment and domain information |
|---|
| >PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A | Back alignment and domain information |
|---|
| >COG2244 RfbX Membrane protein involved in the export of O-antigen and teichoic acid [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase | Back alignment and domain information |
|---|
| >PRK14903 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] | Back alignment and domain information |
|---|
| >PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases | Back alignment and domain information |
|---|
| >PRK14902 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PF04506 Rft-1: Rft protein; InterPro: IPR007594 Asymmetric lipid distribution is a fundamental characteristic of biological lipid bilayers, one such axample is the translocation of the Man5GlcNAc2-PP-Dol intermediate from the cytosolic side of the ER membrane to the lumen before the completion of the biosynthesis of Glc3Man9GlcNAc2-PP-Dol [] | Back alignment and domain information |
|---|
| >PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] | Back alignment and domain information |
|---|
| >TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases | Back alignment and domain information |
|---|
| >TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific | Back alignment and domain information |
|---|
| >PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed | Back alignment and domain information |
|---|
| >PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A | Back alignment and domain information |
|---|
| >PRK14901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PF01554 MatE: MatE; InterPro: IPR002528 Characterised members of the Multi Antimicrobial Extrusion (MATE) family function as drug/sodium antiporters | Back alignment and domain information |
|---|
| >KOG2864|consensus | Back alignment and domain information |
|---|
| >PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00138 gidB 16S rRNA methyltransferase GidB | Back alignment and domain information |
|---|
| >PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A | Back alignment and domain information |
|---|
| >PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase | Back alignment and domain information |
|---|
| >PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase | Back alignment and domain information |
|---|
| >PRK14968 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit | Back alignment and domain information |
|---|
| >COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR01177 conserved hypothetical protein TIGR01177 | Back alignment and domain information |
|---|
| >PLN02233 ubiquinone biosynthesis methyltransferase | Back alignment and domain information |
|---|
| >PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional | Back alignment and domain information |
|---|
| >TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific | Back alignment and domain information |
|---|
| >PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A | Back alignment and domain information |
|---|
| >PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) | Back alignment and domain information |
|---|
| >PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00406 prmA ribosomal protein L11 methyltransferase | Back alignment and domain information |
|---|
| >PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00146 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >KOG2730|consensus | Back alignment and domain information |
|---|
| >TIGR00537 hemK_rel_arch HemK-related putative methylase | Back alignment and domain information |
|---|
| >PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] | Back alignment and domain information |
|---|
| >KOG1347|consensus | Back alignment and domain information |
|---|
| >PRK07402 precorrin-6B methylase; Provisional | Back alignment and domain information |
|---|
| >PRK03612 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >smart00650 rADc Ribosomal RNA adenine dimethylases | Back alignment and domain information |
|---|
| >PF07260 ANKH: Progressive ankylosis protein (ANKH); InterPro: IPR009887 This family consists of several progressive ankylosis protein (ANK or ANKH) sequences | Back alignment and domain information |
|---|
| >PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK08317 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02781 Probable caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PTZ00338 dimethyladenosine transferase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG4123 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00091 tRNA (guanine-N(7)-)-methyltransferase | Back alignment and domain information |
|---|
| >KOG2915|consensus | Back alignment and domain information |
|---|
| >TIGR00740 methyltransferase, putative | Back alignment and domain information |
|---|
| >PRK10901 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional | Back alignment and domain information |
|---|
| >PRK14904 16S rRNA methyltransferase B; Provisional | Back alignment and domain information |
|---|
| >COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1663|consensus | Back alignment and domain information |
|---|
| >PRK01683 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed | Back alignment and domain information |
|---|
| >PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK04266 fibrillarin; Provisional | Back alignment and domain information |
|---|
| >TIGR00438 rrmJ cell division protein FtsJ | Back alignment and domain information |
|---|
| >TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific | Back alignment and domain information |
|---|
| >TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB | Back alignment and domain information |
|---|
| >TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase | Back alignment and domain information |
|---|
| >PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes | Back alignment and domain information |
|---|
| >PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02244 tocopherol O-methyltransferase | Back alignment and domain information |
|---|
| >PRK06922 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04457 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >PRK14103 trans-aconitate 2-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PHA03411 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA | Back alignment and domain information |
|---|
| >PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) | Back alignment and domain information |
|---|
| >PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases | Back alignment and domain information |
|---|
| >PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 | Back alignment and domain information |
|---|
| >PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family | Back alignment and domain information |
|---|
| >PLN02476 O-methyltransferase | Back alignment and domain information |
|---|
| >PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised | Back alignment and domain information |
|---|
| >PRK10742 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN03075 nicotianamine synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB | Back alignment and domain information |
|---|
| >PRK05785 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00536 hemK_fam HemK family putative methylases | Back alignment and domain information |
|---|
| >PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed | Back alignment and domain information |
|---|
| >COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02072 BioC biotin biosynthesis protein BioC | Back alignment and domain information |
|---|
| >TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase | Back alignment and domain information |
|---|
| >PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 | Back alignment and domain information |
|---|
| >COG4267 Predicted membrane protein [Function unknown] | Back alignment and domain information |
|---|
| >TIGR00755 ksgA dimethyladenosine transferase | Back alignment and domain information |
|---|
| >PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PTZ00098 phosphoethanolamine N-methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK06202 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03438 probable methyltransferase | Back alignment and domain information |
|---|
| >PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >COG4122 Predicted O-methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins | Back alignment and domain information |
|---|
| >PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase | Back alignment and domain information |
|---|
| >PRK11207 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >PRK14967 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PHA03412 putative methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02589 caffeoyl-CoA O-methyltransferase | Back alignment and domain information |
|---|
| >COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK11088 rrmA 23S rRNA methyltransferase A; Provisional | Back alignment and domain information |
|---|
| >COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU | Back alignment and domain information |
|---|
| >TIGR02081 metW methionine biosynthesis protein MetW | Back alignment and domain information |
|---|
| >PRK05031 tRNA (uracil-5-)-methyltransferase; Validated | Back alignment and domain information |
|---|
| >PLN02396 hexaprenyldihydroxybenzoate methyltransferase | Back alignment and domain information |
|---|
| >COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00811 spermidine synthase; Provisional | Back alignment and domain information |
|---|
| >COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00095 RNA methyltransferase, RsmD family | Back alignment and domain information |
|---|
| >PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional | Back alignment and domain information |
|---|
| >PLN02490 MPBQ/MSBQ methyltransferase | Back alignment and domain information |
|---|
| >KOG3420|consensus | Back alignment and domain information |
|---|
| >PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB | Back alignment and domain information |
|---|
| >PLN02585 magnesium protoporphyrin IX methyltransferase | Back alignment and domain information |
|---|
| >TIGR00478 tly hemolysin TlyA family protein | Back alignment and domain information |
|---|
| >PLN02366 spermidine synthase | Back alignment and domain information |
|---|
| >PRK10258 biotin biosynthesis protein BioC; Provisional | Back alignment and domain information |
|---|
| >PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH | Back alignment and domain information |
|---|
| >PRK07580 Mg-protoporphyrin IX methyl transferase; Validated | Back alignment and domain information |
|---|
| >PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK15068 tRNA mo(5)U34 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase | Back alignment and domain information |
|---|
| >TIGR00477 tehB tellurite resistance protein TehB | Back alignment and domain information |
|---|
| >COG2520 Predicted methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2904|consensus | Back alignment and domain information |
|---|
| >PRK01581 speE spermidine synthase; Validated | Back alignment and domain information |
|---|
| >TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family | Back alignment and domain information |
|---|
| >COG2521 Predicted archaeal methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02336 phosphoethanolamine N-methyltransferase | Back alignment and domain information |
|---|
| >COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes | Back alignment and domain information |
|---|
| >TIGR00486 YbgI_SA1388 dinuclear metal center protein, YbgI/SA1388 family | Back alignment and domain information |
|---|
| >PRK13255 thiopurine S-methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PRK12335 tellurite resistance protein TehB; Provisional | Back alignment and domain information |
|---|
| >COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D | Back alignment and domain information |
|---|
| >PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences | Back alignment and domain information |
|---|
| >PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals | Back alignment and domain information |
|---|
| >PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK11727 23S rRNA mA1618 methyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family | Back alignment and domain information |
|---|
| >COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG3191|consensus | Back alignment and domain information |
|---|
| >smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes | Back alignment and domain information |
|---|
| >TIGR00452 methyltransferase, putative | Back alignment and domain information |
|---|
| >COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PF04506 Rft-1: Rft protein; InterPro: IPR007594 Asymmetric lipid distribution is a fundamental characteristic of biological lipid bilayers, one such axample is the translocation of the Man5GlcNAc2-PP-Dol intermediate from the cytosolic side of the ER membrane to the lumen before the completion of the biosynthesis of Glc3Man9GlcNAc2-PP-Dol [] | Back alignment and domain information |
|---|
| >TIGR00417 speE spermidine synthase | Back alignment and domain information |
|---|
| >KOG0820|consensus | Back alignment and domain information |
|---|
| >PRK10799 metal-binding protein; Provisional | Back alignment and domain information |
|---|
| >PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus | Back alignment and domain information |
|---|
| >PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed | Back alignment and domain information |
|---|
| >PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 | Back alignment and domain information |
|---|
| >PF01784 NIF3: NIF3 (NGG1p interacting factor 3); InterPro: IPR002678 This family contains several NIF3 (NGG1p interacting factor 3) protein homologues | Back alignment and domain information |
|---|
| >TIGR01444 fkbM_fam methyltransferase, FkbM family | Back alignment and domain information |
|---|
| >PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e | Back alignment and domain information |
|---|
| >PRK04148 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 | Back alignment and domain information |
|---|
| >KOG4589|consensus | Back alignment and domain information |
|---|
| >PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional | Back alignment and domain information |
|---|
| >PLN02823 spermine synthase | Back alignment and domain information |
|---|
| >PLN02672 methionine S-methyltransferase | Back alignment and domain information |
|---|
| >TIGR03439 methyl_EasF probable methyltransferase domain, EasF family | Back alignment and domain information |
|---|
| >PF01943 Polysacc_synt: Polysaccharide biosynthesis protein; InterPro: IPR002797 Members of this family are integral membrane proteins [], and many are implicated in the production of polysaccharide | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 896 | ||||
| 3tka_A | 347 | Crystal Structure And Solution Saxs Of Methyltransf | 9e-75 | ||
| 1nmp_A | 247 | Structural Genomics, Ybgi Protein, Unknown Function | 5e-51 | ||
| 1nmo_A | 247 | Structural Genomics, Protein Ybgi, Unknown Function | 9e-51 | ||
| 1m6y_A | 301 | Crystal Structure Analysis Of Tm0872, A Putative Sa | 5e-43 | ||
| 1wg8_A | 285 | Crystal Structure Of A Predicted S-Adenosylmethioni | 3e-42 | ||
| 2yyb_A | 242 | Crystal Structure Of Ttha1606 From Thermus Thermoph | 7e-17 |
| >pdb|3TKA|A Chain A, Crystal Structure And Solution Saxs Of Methyltransferase Rsmh From E.Coli Length = 347 | Back alignment and structure |
|
| >pdb|1NMP|A Chain A, Structural Genomics, Ybgi Protein, Unknown Function Length = 247 | Back alignment and structure |
| >pdb|1NMO|A Chain A, Structural Genomics, Protein Ybgi, Unknown Function Length = 247 | Back alignment and structure |
| >pdb|1M6Y|A Chain A, Crystal Structure Analysis Of Tm0872, A Putative Sam- Dependent Methyltransferase, Complexed With Sah Length = 301 | Back alignment and structure |
| >pdb|1WG8|A Chain A, Crystal Structure Of A Predicted S-Adenosylmethionine- Dependent Methyltransferase Tt1512 From Thermus Thermophilus Hb8. Length = 285 | Back alignment and structure |
| >pdb|2YYB|A Chain A, Crystal Structure Of Ttha1606 From Thermus Thermophilus Hb8 Length = 242 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Length = 347 | Back alignment and structure |
|---|
Score = 384 bits (990), Expect = e-127
Identities = 137/281 (48%), Positives = 190/281 (67%), Gaps = 6/281 (2%)
Query: 392 LNEAINWLNIENERINGIYIDATFGQGGHSCKILERLGKKGRLIAIDKDTESVSLGNKIT 451
L+EA+N LNI R +GIYID TFG+GGHS IL +LG++GRL+AID+D +++++ I
Sbjct: 46 LDEAVNGLNI---RPDGIYIDGTFGRGGHSRLILSQLGEEGRLLAIDRDPQAIAVAKTID 102
Query: 452 DSRFSIIHNCFTELDIILKKYN-IKKIDGILFDLGISSNQINNELRGFSFLLDGPLDMRM 510
D RFSIIH F+ L + + + I KIDGIL DLG+SS Q+++ RGFSF+ DGPLDMRM
Sbjct: 103 DPRFSIIHGPFSALGEYVAERDLIGKIDGILLDLGVSSPQLDDAERGFSFMRDGPLDMRM 162
Query: 511 DITRGISASKWLANATEFNIKKVIQDYGEERFAKKIAKEIVHYRSITPITRTKQLVEIIL 570
D TRG SA++WL A E +I V++ YGEERFAK+IA+ IV P+TRTK+L E++
Sbjct: 163 DPTRGQSAAEWLQTAEEADIAWVLKTYGEERFAKRIARAIVERNREQPMTRTKELAEVVA 222
Query: 571 KSIRGNKRYKNPATRTFQAIRIYINQELKNLSIALKIGFKKLNIKGRIVVISFHSLEDRI 630
+ ++K+PATRTFQA+RI++N EL+ + ALK L GR+ +ISFHSLEDRI
Sbjct: 223 AATPVKDKFKHPATRTFQAVRIWVNSELEEIEQALKSSLNVLAPGGRLSIISFHSLEDRI 282
Query: 631 VKNFINFNTKIPHIDRRLPIYNYLFEPKMKFLARCKPKKKL 671
VK F+ N++ P + LP+ + + + KL
Sbjct: 283 VKRFMRENSRGPQVPAGLPMTEEQLKKLGGR--QLRALGKL 321
|
| >1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Length = 285 | Back alignment and structure |
|---|
| >1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Length = 301 | Back alignment and structure |
|---|
| >1nmo_A Hypothetical protein YBGI; toroidal structure, structure 2 project, S2F, structural genomics, unknown function; 2.20A {Escherichia coli} SCOP: c.135.1.1 PDB: 1nmp_A Length = 247 | Back alignment and structure |
|---|
| >2yyb_A Hypothetical protein TTHA1606; structural genomics, unknown function; 2.60A {Thermus thermophilus} Length = 242 | Back alignment and structure |
|---|
| >2fyw_A Conserved hypothetical protein; structural genomics, PSI, midwest CENT structural genomics, MCSG, protein structure initiative; 2.40A {Streptococcus pneumoniae} SCOP: c.135.1.1 Length = 267 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2nyd_A UPF0135 protein SA1388; hypothetical protein SA1388, selenomethionine SAD, unknown F; 2.00A {Staphylococcus aureus subsp} PDB: 3lnl_A* Length = 370 | Back alignment and structure |
|---|
| >2nyd_A UPF0135 protein SA1388; hypothetical protein SA1388, selenomethionine SAD, unknown F; 2.00A {Staphylococcus aureus subsp} PDB: 3lnl_A* Length = 370 | Back alignment and structure |
|---|
| >2gx8_A NIF3-related protein; structural genomics, unknown function, protein structure initiative, midwest center for structural genomics, MCSG; HET: EPE; 2.20A {Bacillus cereus} SCOP: c.135.1.1 Length = 397 | Back alignment and structure |
|---|
| >2gx8_A NIF3-related protein; structural genomics, unknown function, protein structure initiative, midwest center for structural genomics, MCSG; HET: EPE; 2.20A {Bacillus cereus} SCOP: c.135.1.1 Length = 397 | Back alignment and structure |
|---|
| >3rxy_A NIF3 protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, NIF3 superfamily, unknown function; 2.00A {Sphaerobacter thermophilus} Length = 278 | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Length = 185 | Back alignment and structure |
|---|
| >1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Length = 197 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 896 | |||
| 3tka_A | 347 | Ribosomal RNA small subunit methyltransferase H; H | 100.0 | |
| 1wg8_A | 285 | Predicted S-adenosylmethionine-dependent methyltra | 100.0 | |
| 1m6y_A | 301 | S-adenosyl-methyltransferase MRAW; SAM-dependent m | 100.0 | |
| 2fyw_A | 267 | Conserved hypothetical protein; structural genomic | 100.0 | |
| 1nmo_A | 247 | Hypothetical protein YBGI; toroidal structure, str | 100.0 | |
| 2nyd_A | 370 | UPF0135 protein SA1388; hypothetical protein SA138 | 100.0 | |
| 2yyb_A | 242 | Hypothetical protein TTHA1606; structural genomics | 100.0 | |
| 2gx8_A | 397 | NIF3-related protein; structural genomics, unknown | 100.0 | |
| 3rxy_A | 278 | NIF3 protein; structural genomics, PSI-biology, mi | 99.97 | |
| 3mkt_A | 460 | Multi antimicrobial extrusion protein (Na(+)/drug | 99.91 | |
| 3mkt_A | 460 | Multi antimicrobial extrusion protein (Na(+)/drug | 98.8 | |
| 3eey_A | 197 | Putative rRNA methylase; rRNA methylation, S-adeno | 98.64 | |
| 3mti_A | 185 | RRNA methylase; SAM-dependent, PSI, MCSG, structur | 98.35 | |
| 3m4x_A | 456 | NOL1/NOP2/SUN family protein; mtase domain, PUA do | 98.07 | |
| 3duw_A | 223 | OMT, O-methyltransferase, putative; alternating of | 98.0 | |
| 3mb5_A | 255 | SAM-dependent methyltransferase; RNA methyltransfe | 97.95 | |
| 2frx_A | 479 | Hypothetical protein YEBU; rossmann-type S-adenosy | 97.91 | |
| 1dus_A | 194 | MJ0882; hypothetical protein, methanococcus jannas | 97.89 | |
| 3e05_A | 204 | Precorrin-6Y C5,15-methyltransferase (decarboxyla; | 97.81 | |
| 2b9e_A | 309 | NOL1/NOP2/SUN domain family, member 5 isoform 2; m | 97.76 | |
| 1sqg_A | 429 | SUN protein, FMU protein; rossmann-fold, mixed bet | 97.75 | |
| 2yxl_A | 450 | PH0851 protein, 450AA long hypothetical FMU protei | 97.74 | |
| 3hm2_A | 178 | Precorrin-6Y C5,15-methyltransferase; alpha-beta-s | 97.7 | |
| 1ej0_A | 180 | FTSJ; methyltransferase, adoMet, adenosyl methioni | 97.59 | |
| 1o54_A | 277 | SAM-dependent O-methyltransferase; TM0748, structu | 97.57 | |
| 2frn_A | 278 | Hypothetical protein PH0793; structural genomics, | 97.56 | |
| 2gpy_A | 233 | O-methyltransferase; structural genomics, PSI, pro | 97.56 | |
| 3dtn_A | 234 | Putative methyltransferase MM_2633; structural gen | 97.5 | |
| 1l3i_A | 192 | Precorrin-6Y methyltransferase/putative decarboxyl | 97.47 | |
| 3dou_A | 191 | Ribosomal RNA large subunit methyltransferase J; c | 97.46 | |
| 2r6z_A | 258 | UPF0341 protein in RSP 3' region; alpha-beta prote | 97.45 | |
| 3grz_A | 205 | L11 mtase, ribosomal protein L11 methyltransferase | 97.44 | |
| 4df3_A | 233 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 97.41 | |
| 1yb2_A | 275 | Hypothetical protein TA0852; structural genomics, | 97.41 | |
| 1jsx_A | 207 | Glucose-inhibited division protein B; methyltransf | 97.4 | |
| 3evz_A | 230 | Methyltransferase; NYSGXRC, NEW YORK SGX research | 97.4 | |
| 1i1n_A | 226 | Protein-L-isoaspartate O-methyltransferase; S-aden | 97.37 | |
| 1o9g_A | 250 | RRNA methyltransferase; antibiotic resistance, Se- | 97.34 | |
| 2oyr_A | 258 | UPF0341 protein YHIQ; alpha-beta protein, structur | 97.31 | |
| 3tr6_A | 225 | O-methyltransferase; cellular processes; HET: SAH; | 97.29 | |
| 3hnr_A | 220 | Probable methyltransferase BT9727_4108; structural | 97.26 | |
| 2as0_A | 396 | Hypothetical protein PH1915; RNA methyltransferase | 97.26 | |
| 4dmg_A | 393 | Putative uncharacterized protein TTHA1493; rRNA, m | 97.21 | |
| 2plw_A | 201 | Ribosomal RNA methyltransferase, putative; malaria | 97.2 | |
| 3ajd_A | 274 | Putative methyltransferase MJ0026; tRNA, M5C, ross | 97.12 | |
| 4fzv_A | 359 | Putative methyltransferase NSUN4; mterf fold, meth | 97.12 | |
| 1ixk_A | 315 | Methyltransferase; open beta sheet; 1.90A {Pyrococ | 97.1 | |
| 3u81_A | 221 | Catechol O-methyltransferase; neurotransmitter deg | 97.08 | |
| 1xdz_A | 240 | Methyltransferase GIDB; MCSG, protein structure in | 97.07 | |
| 3id6_C | 232 | Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; | 97.06 | |
| 3r3h_A | 242 | O-methyltransferase, SAM-dependent; structural gen | 97.06 | |
| 3c3y_A | 237 | Pfomt, O-methyltransferase; plant secondary metabo | 97.04 | |
| 3m6w_A | 464 | RRNA methylase; rRNA methyltransferase, 5-methylcy | 97.04 | |
| 2esr_A | 177 | Methyltransferase; structural genomics, hypothetic | 97.03 | |
| 1g8a_A | 227 | Fibrillarin-like PRE-rRNA processing protein; rRNA | 97.02 | |
| 2b25_A | 336 | Hypothetical protein; structural genomics, methyl | 97.02 | |
| 3tfw_A | 248 | Putative O-methyltransferase; PSI-biology, nysgrc, | 97.02 | |
| 3p9n_A | 189 | Possible methyltransferase (methylase); RV2966C, a | 96.97 | |
| 2nyu_A | 196 | Putative ribosomal RNA methyltransferase 2; SAM, s | 96.97 | |
| 2fca_A | 213 | TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac | 96.96 | |
| 3ntv_A | 232 | MW1564 protein; rossmann fold, putative methyltran | 96.94 | |
| 2fhp_A | 187 | Methylase, putative; alpha-beta-alpha sandwich, st | 96.94 | |
| 2pwy_A | 258 | TRNA (adenine-N(1)-)-methyltransferase; mtase, ado | 96.86 | |
| 1yzh_A | 214 | TRNA (guanine-N(7)-)-methyltransferase; alpha-beta | 96.83 | |
| 3dr5_A | 221 | Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 | 96.83 | |
| 3m70_A | 286 | Tellurite resistance protein TEHB homolog; structu | 96.81 | |
| 2hnk_A | 239 | SAM-dependent O-methyltransferase; modified rossma | 96.8 | |
| 3opn_A | 232 | Putative hemolysin; structural genomics, PSI-2, pr | 96.78 | |
| 2f8l_A | 344 | Hypothetical protein LMO1582; structural genomics, | 96.78 | |
| 3g89_A | 249 | Ribosomal RNA small subunit methyltransferase G; 1 | 96.76 | |
| 1i9g_A | 280 | Hypothetical protein RV2118C; mtase, adoMet, cryst | 96.75 | |
| 1sui_A | 247 | Caffeoyl-COA O-methyltransferase; rossmann fold, p | 96.75 | |
| 4dzr_A | 215 | Protein-(glutamine-N5) methyltransferase, release | 96.74 | |
| 2ozv_A | 260 | Hypothetical protein ATU0636; structural genomics, | 96.74 | |
| 4gek_A | 261 | TRNA (CMO5U34)-methyltransferase; structural genom | 96.73 | |
| 1ne2_A | 200 | Hypothetical protein TA1320; structural genomics, | 96.69 | |
| 2h00_A | 254 | Methyltransferase 10 domain containing protein; st | 96.69 | |
| 3njr_A | 204 | Precorrin-6Y methylase; methyltransferase, decarbo | 96.68 | |
| 1fbn_A | 230 | MJ fibrillarin homologue; MJ proteins, ribosomal R | 96.64 | |
| 3g07_A | 292 | 7SK snRNA methylphosphate capping enzyme; structur | 96.64 | |
| 3lpm_A | 259 | Putative methyltransferase; structural genomics, p | 96.64 | |
| 1xxl_A | 239 | YCGJ protein; structural genomics, protein structu | 96.63 | |
| 2ipx_A | 233 | RRNA 2'-O-methyltransferase fibrillarin; FBL, stru | 96.62 | |
| 1ws6_A | 171 | Methyltransferase; structural genomics, riken stru | 96.62 | |
| 1nt2_A | 210 | Fibrillarin-like PRE-rRNA processing protein; adeM | 96.61 | |
| 3cbg_A | 232 | O-methyltransferase; cyanobacterium; HET: SAH FER | 96.61 | |
| 2avd_A | 229 | Catechol-O-methyltransferase; structural genomics, | 96.58 | |
| 3c3p_A | 210 | Methyltransferase; NP_951602.1, structural genomic | 96.58 | |
| 3fpf_A | 298 | Mtnas, putative uncharacterized protein; thermonic | 96.56 | |
| 2yxd_A | 183 | Probable cobalt-precorrin-6Y C(15)-methyltransfer | 96.56 | |
| 3dxy_A | 218 | TRNA (guanine-N(7)-)-methyltransferase; rossmann f | 96.55 | |
| 3dh0_A | 219 | SAM dependent methyltransferase; cystal structure, | 96.53 | |
| 1nv8_A | 284 | HEMK protein; class I adoMet-dependent methyltrans | 96.47 | |
| 3g5t_A | 299 | Trans-aconitate 3-methyltransferase; structural ge | 96.45 | |
| 3ckk_A | 235 | TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- | 96.45 | |
| 1wy7_A | 207 | Hypothetical protein PH1948; seven-stranded beta s | 96.44 | |
| 3hem_A | 302 | Cyclopropane-fatty-acyl-phospholipid synthase 2; p | 96.44 | |
| 2ift_A | 201 | Putative methylase HI0767; NESG, Y767_haein, struc | 96.38 | |
| 2nxc_A | 254 | L11 mtase, ribosomal protein L11 methyltransferase | 96.31 | |
| 3k6r_A | 278 | Putative transferase PH0793; structural genomics, | 96.3 | |
| 3uwp_A | 438 | Histone-lysine N-methyltransferase, H3 lysine-79; | 96.27 | |
| 3gdh_A | 241 | Trimethylguanosine synthase homolog; M7G, CAP, dim | 96.24 | |
| 2vdv_E | 246 | TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl | 96.21 | |
| 3ll7_A | 410 | Putative methyltransferase; methytransferase, stru | 96.21 | |
| 3dlc_A | 219 | Putative S-adenosyl-L-methionine-dependent methylt | 96.15 | |
| 3tma_A | 354 | Methyltransferase; thump domain; 2.05A {Thermus th | 96.15 | |
| 2pbf_A | 227 | Protein-L-isoaspartate O-methyltransferase beta-A | 96.15 | |
| 2bm8_A | 236 | Cephalosporin hydroxylase CMCI; cephamycin biosynt | 96.14 | |
| 1pjz_A | 203 | Thiopurine S-methyltransferase; polymorphism, S-ad | 96.11 | |
| 3uzu_A | 279 | Ribosomal RNA small subunit methyltransferase A; s | 96.1 | |
| 3tqs_A | 255 | Ribosomal RNA small subunit methyltransferase A; p | 96.09 | |
| 1zq9_A | 285 | Probable dimethyladenosine transferase; SGC, struc | 96.09 | |
| 2yxe_A | 215 | Protein-L-isoaspartate O-methyltransferase; rossma | 96.03 | |
| 2fpo_A | 202 | Methylase YHHF; structural genomics, putative meth | 95.99 | |
| 3gru_A | 295 | Dimethyladenosine transferase; rossman fold, ribos | 95.98 | |
| 3f4k_A | 257 | Putative methyltransferase; structural genomics, P | 95.88 | |
| 3kkz_A | 267 | Uncharacterized protein Q5LES9; putative methyltra | 95.88 | |
| 3a27_A | 272 | TYW2, uncharacterized protein MJ1557; wybutosine m | 95.87 | |
| 2h1r_A | 299 | Dimethyladenosine transferase, putative; SGC toron | 95.86 | |
| 3lbf_A | 210 | Protein-L-isoaspartate O-methyltransferase; modifi | 95.85 | |
| 1kpg_A | 287 | CFA synthase;, cyclopropane-fatty-acyl-phospholipi | 95.83 | |
| 3vc1_A | 312 | Geranyl diphosphate 2-C-methyltransferase; rossman | 95.81 | |
| 3ujc_A | 266 | Phosphoethanolamine N-methyltransferase; parasite; | 95.8 | |
| 3ou2_A | 218 | SAM-dependent methyltransferase; O-methyltransfera | 95.79 | |
| 2fk8_A | 318 | Methoxy mycolic acid synthase 4; S-adenosylmethion | 95.77 | |
| 1r18_A | 227 | Protein-L-isoaspartate(D-aspartate)-O-methyltrans; | 95.74 | |
| 3c0k_A | 396 | UPF0064 protein YCCW; PUA domain, adoMet dependent | 95.74 | |
| 1qam_A | 244 | ERMC' methyltransferase; rRNA methyltransferase ER | 95.69 | |
| 3jwg_A | 219 | HEN1, methyltransferase type 12; 1.90A {Clostridiu | 95.69 | |
| 2b3t_A | 276 | Protein methyltransferase HEMK; translation termin | 95.67 | |
| 1vbf_A | 231 | 231AA long hypothetical protein-L-isoaspartate O- | 95.67 | |
| 3bt7_A | 369 | TRNA (uracil-5-)-methyltransferase; methyluridine, | 95.63 | |
| 3giw_A | 277 | Protein of unknown function DUF574; rossmann-fold | 95.62 | |
| 1dl5_A | 317 | Protein-L-isoaspartate O-methyltransferase; isoasp | 95.58 | |
| 3jwh_A | 217 | HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena | 95.58 | |
| 3tm4_A | 373 | TRNA (guanine N2-)-methyltransferase TRM14; rossma | 95.57 | |
| 3orh_A | 236 | Guanidinoacetate N-methyltransferase; structura ge | 95.52 | |
| 3bkx_A | 275 | SAM-dependent methyltransferase; YP_807781.1, cycl | 95.5 | |
| 1nkv_A | 256 | Hypothetical protein YJHP; structural genomics, PS | 95.47 | |
| 2p35_A | 259 | Trans-aconitate 2-methyltransferase; SAM dependent | 95.46 | |
| 3ftd_A | 249 | Dimethyladenosine transferase; KSGA, rossmann-like | 95.42 | |
| 4dcm_A | 375 | Ribosomal RNA large subunit methyltransferase G; 2 | 95.4 | |
| 3bus_A | 273 | REBM, methyltransferase; rebeccamycin synthesis; H | 95.38 | |
| 2i7c_A | 283 | Spermidine synthase; transferase, structural genom | 95.38 | |
| 1uwv_A | 433 | 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m | 95.34 | |
| 2yx1_A | 336 | Hypothetical protein MJ0883; methyl transferase, t | 95.33 | |
| 2qe6_A | 274 | Uncharacterized protein TFU_2867; putative methylt | 95.3 | |
| 3ggd_A | 245 | SAM-dependent methyltransferase; YP_325210.1, stru | 95.3 | |
| 3bwc_A | 304 | Spermidine synthase; SAM, SGPP, structura genomics | 95.28 | |
| 4fsd_A | 383 | Arsenic methyltransferase; rossmann fold; 1.75A {C | 95.27 | |
| 1zx0_A | 236 | Guanidinoacetate N-methyltransferase; structural g | 95.27 | |
| 3g5l_A | 253 | Putative S-adenosylmethionine dependent methyltran | 95.26 | |
| 1u2z_A | 433 | Histone-lysine N-methyltransferase, H3 lysine-79 s | 95.25 | |
| 1iy9_A | 275 | Spermidine synthase; rossmann fold, structural gen | 95.25 | |
| 3ege_A | 261 | Putative methyltransferase from antibiotic biosyn | 95.21 | |
| 1mjf_A | 281 | Spermidine synthase; spermidine synthetase, struct | 95.2 | |
| 1xj5_A | 334 | Spermidine synthase 1; structural genomics, protei | 95.18 | |
| 3i9f_A | 170 | Putative type 11 methyltransferase; structural gen | 95.17 | |
| 1wxx_A | 382 | TT1595, hypothetical protein TTHA1280; thermus the | 95.16 | |
| 3gu3_A | 284 | Methyltransferase; alpha-beta protein, structural | 95.15 | |
| 3fut_A | 271 | Dimethyladenosine transferase; methyltransferase, | 95.14 | |
| 1vl5_A | 260 | Unknown conserved protein BH2331; putative methylt | 95.11 | |
| 3ocj_A | 305 | Putative exported protein; structural genomics, PS | 95.11 | |
| 3hp7_A | 291 | Hemolysin, putative; structural genomics, APC64019 | 95.1 | |
| 4htf_A | 285 | S-adenosylmethionine-dependent methyltransferase; | 95.08 | |
| 2o57_A | 297 | Putative sarcosine dimethylglycine methyltransfera | 95.08 | |
| 1inl_A | 296 | Spermidine synthase; beta-barrel, rossman fold, st | 95.07 | |
| 2igt_A | 332 | SAM dependent methyltransferase; alpha-beta sandwi | 95.07 | |
| 3mq2_A | 218 | 16S rRNA methyltransferase; methyltranferase, ribo | 95.0 | |
| 1ve3_A | 227 | Hypothetical protein PH0226; dimer, riken structur | 94.99 | |
| 3q87_B | 170 | N6 adenine specific DNA methylase; SAM-methyltrans | 94.97 | |
| 2p7i_A | 250 | Hypothetical protein; putative methyltransferase, | 94.96 | |
| 2b78_A | 385 | Hypothetical protein SMU.776; structure genomics, | 94.91 | |
| 3gjy_A | 317 | Spermidine synthase; APC62791, structural genomics | 94.91 | |
| 3bkw_A | 243 | MLL3908 protein, S-adenosylmethionine dependent me | 94.9 | |
| 3p2e_A | 225 | 16S rRNA methylase; methyltransferase, transferase | 94.9 | |
| 1qyr_A | 252 | KSGA, high level kasugamycin resistance protein, S | 94.89 | |
| 3iv6_A | 261 | Putative Zn-dependent alcohol dehydrogenase; alpha | 94.88 | |
| 1jg1_A | 235 | PIMT;, protein-L-isoaspartate O-methyltransferase; | 94.88 | |
| 2qm3_A | 373 | Predicted methyltransferase; putative methyltransf | 94.86 | |
| 2o07_A | 304 | Spermidine synthase; structural genomics, structur | 94.86 | |
| 2pt6_A | 321 | Spermidine synthase; transferase, structural genom | 94.83 | |
| 1uir_A | 314 | Polyamine aminopropyltransferase; spermidien synth | 94.82 | |
| 1wzn_A | 252 | SAM-dependent methyltransferase; structural genomi | 94.82 | |
| 3l8d_A | 242 | Methyltransferase; structural genomics, PSI, nysgr | 94.81 | |
| 1xtp_A | 254 | LMAJ004091AAA; SGPP, structural genomics, PSI, pro | 94.77 | |
| 2p8j_A | 209 | S-adenosylmethionine-dependent methyltransferase; | 94.74 | |
| 2xvm_A | 199 | Tellurite resistance protein TEHB; antibiotic resi | 94.74 | |
| 2yvl_A | 248 | TRMI protein, hypothetical protein; tRNA, methyltr | 94.73 | |
| 2b2c_A | 314 | Spermidine synthase; beta-alpha, transferase; 2.50 | 94.71 | |
| 3mgg_A | 276 | Methyltransferase; NYSGXRC, PSI-II, protein struct | 94.67 | |
| 2pxx_A | 215 | Uncharacterized protein MGC2408; structural genomi | 94.67 | |
| 2gb4_A | 252 | Thiopurine S-methyltransferase; 18204406, thiopuri | 94.66 | |
| 2ih2_A | 421 | Modification methylase TAQI; DNA, DNA methyltransf | 94.61 | |
| 3m33_A | 226 | Uncharacterized protein; structural genomics, PSI- | 94.59 | |
| 3sm3_A | 235 | SAM-dependent methyltransferases; NESG, structural | 94.58 | |
| 3e8s_A | 227 | Putative SAM dependent methyltransferase; NP_74470 | 94.56 | |
| 3ccf_A | 279 | Cyclopropane-fatty-acyl-phospholipid synthase; YP_ | 94.53 | |
| 2ex4_A | 241 | Adrenal gland protein AD-003; methyltransferase, s | 94.52 | |
| 3pfg_A | 263 | N-methyltransferase; N,N-dimethyltransferase, SAM | 94.52 | |
| 3axs_A | 392 | Probable N(2),N(2)-dimethylguanosine tRNA methylt | 94.45 | |
| 3e23_A | 211 | Uncharacterized protein RPA2492; alpha-beta protei | 94.43 | |
| 3bgv_A | 313 | MRNA CAP guanine-N7 methyltransferase; alternative | 94.42 | |
| 4hg2_A | 257 | Methyltransferase type 11; structural genomics, PS | 94.41 | |
| 3ofk_A | 216 | Nodulation protein S; NODS, N-methyltransferase, S | 94.39 | |
| 3g2m_A | 299 | PCZA361.24; SAM-dependent methyltransferase, glyco | 94.33 | |
| 3kr9_A | 225 | SAM-dependent methyltransferase; class I rossmann- | 94.24 | |
| 3lec_A | 230 | NADB-rossmann superfamily protein; PSI, MCSG, stru | 94.16 | |
| 3cgg_A | 195 | SAM-dependent methyltransferase; NP_600671.1, meth | 94.12 | |
| 3q7e_A | 349 | Protein arginine N-methyltransferase 1; HET: SAH; | 94.07 | |
| 2yqz_A | 263 | Hypothetical protein TTHA0223; RNA methyltransfera | 94.04 | |
| 1p91_A | 269 | Ribosomal RNA large subunit methyltransferase A; R | 94.02 | |
| 2dul_A | 378 | N(2),N(2)-dimethylguanosine tRNA methyltransferas; | 94.0 | |
| 3adn_A | 294 | Spermidine synthase; aminopropyltransferase, polya | 93.99 | |
| 2kw5_A | 202 | SLR1183 protein; structural genomics, northeast st | 93.97 | |
| 3d2l_A | 243 | SAM-dependent methyltransferase; ZP_00538691.1, st | 93.91 | |
| 1ri5_A | 298 | MRNA capping enzyme; methyltransferase, M7G, messe | 93.9 | |
| 1yub_A | 245 | Ermam, rRNA methyltransferase; MLS antibiotics; NM | 93.86 | |
| 3htx_A | 950 | HEN1; HEN1, small RNA methyltransferase, protein-R | 93.8 | |
| 3h2b_A | 203 | SAM-dependent methyltransferase; alpha-beta protei | 93.74 | |
| 3gnl_A | 244 | Uncharacterized protein, DUF633, LMOF2365_1472; st | 93.71 | |
| 3ldu_A | 385 | Putative methylase; structural genomics, PSI-2, pr | 93.56 | |
| 3thr_A | 293 | Glycine N-methyltransferase; GNMT, folate, methylt | 93.51 | |
| 2fyt_A | 340 | Protein arginine N-methyltransferase 3; structural | 93.44 | |
| 3mcz_A | 352 | O-methyltransferase; adomet_mtases, S-adenosylmeth | 93.43 | |
| 2oxt_A | 265 | Nucleoside-2'-O-methyltransferase; flavivirus, vir | 93.41 | |
| 2cmg_A | 262 | Spermidine synthase; transferase, putrescine amino | 93.38 | |
| 3lcc_A | 235 | Putative methyl chloride transferase; halide methy | 93.37 | |
| 1y8c_A | 246 | S-adenosylmethionine-dependent methyltransferase; | 93.31 | |
| 3bxo_A | 239 | N,N-dimethyltransferase; desosamine, sugar, carboh | 93.3 | |
| 2wa2_A | 276 | Non-structural protein 5; transferase, S-adenosyl- | 93.25 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 93.14 | |
| 1x19_A | 359 | CRTF-related protein; methyltransferase, bacterioc | 93.12 | |
| 2vdw_A | 302 | Vaccinia virus capping enzyme D1 subunit; nucleoti | 93.02 | |
| 3r0q_C | 376 | Probable protein arginine N-methyltransferase 4.2; | 93.02 | |
| 3dmg_A | 381 | Probable ribosomal RNA small subunit methyltransf; | 92.8 | |
| 3dli_A | 240 | Methyltransferase; PSI-II, NYSGXRC, structural gen | 92.69 | |
| 2pjd_A | 343 | Ribosomal RNA small subunit methyltransferase C; g | 92.35 | |
| 1qzz_A | 374 | RDMB, aclacinomycin-10-hydroxylase; anthracycline, | 92.34 | |
| 2jjq_A | 425 | Uncharacterized RNA methyltransferase pyrab10780; | 92.34 | |
| 2gs9_A | 211 | Hypothetical protein TT1324; methyl transferase, s | 92.33 | |
| 3sso_A | 419 | Methyltransferase; macrolide, natural product, ros | 92.22 | |
| 2y1w_A | 348 | Histone-arginine methyltransferase CARM1; histone | 92.1 | |
| 3k0b_A | 393 | Predicted N6-adenine-specific DNA methylase; methy | 92.05 | |
| 1g6q_1 | 328 | HnRNP arginine N-methyltransferase; SAM-binding do | 92.01 | |
| 3ldg_A | 384 | Putative uncharacterized protein SMU.472; YPSC, me | 91.89 | |
| 3cc8_A | 230 | Putative methyltransferase; structural genomics, j | 91.83 | |
| 3gwz_A | 369 | MMCR; methyltransferase, mitomycin, S-adenosyl met | 91.79 | |
| 2p41_A | 305 | Type II methyltransferase; vizier, viral enzymes i | 91.41 | |
| 3i53_A | 332 | O-methyltransferase; CO-complex, rossmann-like fol | 91.24 | |
| 2r3s_A | 335 | Uncharacterized protein; methyltransferase domain, | 91.19 | |
| 2qfm_A | 364 | Spermine synthase; spermidine aminopropyltransfera | 91.15 | |
| 3dp7_A | 363 | SAM-dependent methyltransferase; structural genomi | 91.04 | |
| 2avn_A | 260 | Ubiquinone/menaquinone biosynthesis methyltransfe | 91.02 | |
| 3b3j_A | 480 | Histone-arginine methyltransferase CARM1; protein | 90.89 | |
| 1tw3_A | 360 | COMT, carminomycin 4-O-methyltransferase; anthracy | 90.77 | |
| 2okc_A | 445 | Type I restriction enzyme stysji M protein; NP_813 | 90.27 | |
| 3rxy_A | 278 | NIF3 protein; structural genomics, PSI-biology, mi | 90.03 | |
| 4a6d_A | 353 | Hydroxyindole O-methyltransferase; melatonin, circ | 89.99 | |
| 3bzb_A | 281 | Uncharacterized protein; RED ALGA, protein structu | 89.45 | |
| 3reo_A | 368 | (ISO)eugenol O-methyltransferase; directed evoluti | 89.42 | |
| 2i62_A | 265 | Nicotinamide N-methyltransferase; structural genom | 89.29 | |
| 3p9c_A | 364 | Caffeic acid O-methyltransferase; S-adenosylmethio | 88.99 | |
| 2ip2_A | 334 | Probable phenazine-specific methyltransferase; pyo | 88.81 | |
| 2fyw_A | 267 | Conserved hypothetical protein; structural genomic | 88.44 | |
| 3fzg_A | 200 | 16S rRNA methylase; methyltransferase, plasmid, tr | 88.2 | |
| 3lst_A | 348 | CALO1 methyltransferase; calicheamicin, enediyne, | 88.05 | |
| 1fp2_A | 352 | Isoflavone O-methyltransferase; protein-product co | 87.15 | |
| 3v97_A | 703 | Ribosomal RNA large subunit methyltransferase L; Y | 86.95 | |
| 3p8z_A | 267 | Mtase, non-structural protein 5; methyltransferase | 86.32 | |
| 3lkz_A | 321 | Non-structural protein 5; flavivirus, methyltransf | 85.45 | |
| 4hc4_A | 376 | Protein arginine N-methyltransferase 6; HRMT1L6, S | 85.19 | |
| 1fp1_D | 372 | Isoliquiritigenin 2'-O-methyltransferase; protein- | 84.81 | |
| 4e2x_A | 416 | TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s | 84.73 | |
| 2ar0_A | 541 | M.ecoki, type I restriction enzyme ecoki M protein | 84.53 | |
| 1vlm_A | 219 | SAM-dependent methyltransferase; possible histamin | 83.2 | |
| 2xyq_A | 290 | Putative 2'-O-methyl transferase; transferase-vira | 82.75 | |
| 2nyd_A | 370 | UPF0135 protein SA1388; hypothetical protein SA138 | 82.57 | |
| 2zig_A | 297 | TTHA0409, putative modification methylase; methylt | 80.45 | |
| 1nmo_A | 247 | Hypothetical protein YBGI; toroidal structure, str | 80.4 | |
| 2gx8_A | 397 | NIF3-related protein; structural genomics, unknown | 80.22 | |
| 3lkd_A | 542 | Type I restriction-modification system methyltrans | 80.18 |
| >3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} | Back alignment and structure |
|---|
Probab=100.00 E-value=1.8e-96 Score=785.80 Aligned_cols=273 Identities=49% Similarity=0.816 Sum_probs=244.7
Q ss_pred ccchHHHhhhccccccccCcEEEEEccCCChhHHHHHHHcCCCcEEEEEeCCHHHHHHhhcccCCCeEEEccChhcHHHH
Q psy2376 389 FLFLNEAINWLNIENERINGIYIDATFGQGGHSCKILERLGKKGRLIAIDKDTESVSLGNKITDSRFSIIHNCFTELDII 468 (896)
Q Consensus 389 ~~m~~e~l~~L~~~~~~~~~~~vD~T~G~Gghs~~ll~~~~~~~~~~~~D~d~~a~~~~~~~~~~~~~~~~~~~~~~~~~ 468 (896)
..|++|+++.|.++ ||++|||||||+||||.+||++++|+|+|||||+||+|++.|+++.++|++++|+||++++++
T Consensus 43 pVLl~Evl~~L~i~---pggiyVD~TlG~GGHS~~iL~~lg~~GrVig~D~Dp~Al~~A~rL~~~Rv~lv~~nF~~l~~~ 119 (347)
T 3tka_A 43 TVLLDEAVNGLNIR---PDGIYIDGTFGRGGHSRLILSQLGEEGRLLAIDRDPQAIAVAKTIDDPRFSIIHGPFSALGEY 119 (347)
T ss_dssp CTTTHHHHHHTCCC---TTCEEEESCCTTSHHHHHHHTTCCTTCEEEEEESCHHHHHHHTTCCCTTEEEEESCGGGHHHH
T ss_pred cccHHHHHHhhCCC---CCCEEEEeCcCCCHHHHHHHHhCCCCCEEEEEECCHHHHHHHHhhcCCcEEEEeCCHHHHHHH
Confidence 35999999999986 499999999999999999999999999999999999999999766678999999999999999
Q ss_pred HHhcCCC-cccEEEEecccCccccCCCCCCccCCCCCCccccCCCCCCCCHHHHHhccCHHHHHHHHHHhcCcccHHHHH
Q psy2376 469 LKKYNIK-KIDGILFDLGISSNQINNELRGFSFLLDGPLDMRMDITRGISASKWLANATEFNIKKVIQDYGEERFAKKIA 547 (896)
Q Consensus 469 l~~~~~~-~~d~il~dlG~ss~q~~~~~rgfs~~~~~~ldmrm~~~~~~~a~~~~~~~~~~~l~~i~~~yg~~~~~~~~a 547 (896)
+++.|+. +||||||||||||||||+++|||||++|||||||||+++++||+||||+|||+||++||++|||||+|+|||
T Consensus 120 L~~~g~~~~vDgILfDLGVSS~QlD~~eRGFSf~~dgPLDMRMd~~~~~tAadvvn~~~e~eLa~Il~~YGEEr~a~rIA 199 (347)
T 3tka_A 120 VAERDLIGKIDGILLDLGVSSPQLDDAERGFSFMRDGPLDMRMDPTRGQSAAEWLQTAEEADIAWVLKTYGEERFAKRIA 199 (347)
T ss_dssp HHHTTCTTCEEEEEEECSCCHHHHHCGGGCCCSSSCCBSCCCSCTTSSCCHHHHHHHCCHHHHHHHHHHHHCCTTHHHHH
T ss_pred HHhcCCCCcccEEEECCccCHHHhcCCCCCCCCCCCCCcCCCCCCCCCCCHHHHHhhCCHHHHHHHHHHhcCcchHHHHH
Confidence 9999886 699999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHhccCCCcchHHHHHHHHhhccCCCCCCChhhHHHHHHHHHHhhhHHHHHHHHHHHHhccccCceEEEEeecchh
Q psy2376 548 KEIVHYRSITPITRTKQLVEIILKSIRGNKRYKNPATRTFQAIRIYINQELKNLSIALKIGFKKLNIKGRIVVISFHSLE 627 (896)
Q Consensus 548 ~~i~~~r~~~~~~~t~~l~~~~~~~~~~~~~~~~~~~~~fqalri~vn~el~~l~~~l~~~~~~l~~~g~~~visfhsle 627 (896)
++||++|+++||+||.||+++|++++|++.+++||||||||||||+||+||++|+++|++++++|+|||||+||||||||
T Consensus 200 ~aIv~~R~~~pi~tT~~La~ii~~a~p~~~~~~hpAtrtFQALRI~VN~EL~~L~~~L~~a~~~L~~gGRl~VISFHSLE 279 (347)
T 3tka_A 200 RAIVERNREQPMTRTKELAEVVAAATPVKDKFKHPATRTFQAVRIWVNSELEEIEQALKSSLNVLAPGGRLSIISFHSLE 279 (347)
T ss_dssp HHHHHHHHHSCCCBHHHHHHHHHHHSCCC----CTTHHHHHHHHHHHHTHHHHHHHHHHHHHHHEEEEEEEEEEESSHHH
T ss_pred HHHHHHHhcCCCCcHHHHHHHHHHhCCccccCCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCEEEEEecCchh
Confidence 99999999999999999999999999976566799999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHhhcCCCCCCCCCCCccccCC----cccchhhcc
Q psy2376 628 DRIVKNFINFNTKIPHIDRRLPIYNYLF----EPKMKFLAR 664 (896)
Q Consensus 628 dr~vk~~~~~~~~~~~~~~~~~~~~~~~----~p~~~~l~~ 664 (896)
|||||+||+++++.|.||+++|+|.|+. +|.++.+||
T Consensus 280 DRiVK~~f~~~~~~~~~p~~~p~~~~~~~~~~~~~~~~i~k 320 (347)
T 3tka_A 280 DRIVKRFMRENSRGPQVPAGLPMTEEQLKKLGGRQLRALGK 320 (347)
T ss_dssp HHHHHHHHHHTTCC-------------------CCEEEEEE
T ss_pred HHHHHHHHHHhccCCCCCccCCccccccccccCcceeeecC
Confidence 9999999999999999999999999977 667887765
|
| >1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 | Back alignment and structure |
|---|
| >1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* | Back alignment and structure |
|---|
| >2fyw_A Conserved hypothetical protein; structural genomics, PSI, midwest CENT structural genomics, MCSG, protein structure initiative; 2.40A {Streptococcus pneumoniae} SCOP: c.135.1.1 | Back alignment and structure |
|---|
| >1nmo_A Hypothetical protein YBGI; toroidal structure, structure 2 project, S2F, structural genomics, unknown function; 2.20A {Escherichia coli} SCOP: c.135.1.1 PDB: 1nmp_A | Back alignment and structure |
|---|
| >2nyd_A UPF0135 protein SA1388; hypothetical protein SA1388, selenomethionine SAD, unknown F; 2.00A {Staphylococcus aureus subsp} PDB: 3lnl_A* | Back alignment and structure |
|---|
| >2yyb_A Hypothetical protein TTHA1606; structural genomics, unknown function; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2gx8_A NIF3-related protein; structural genomics, unknown function, protein structure initiative, midwest center for structural genomics, MCSG; HET: EPE; 2.20A {Bacillus cereus} SCOP: c.135.1.1 | Back alignment and structure |
|---|
| >3rxy_A NIF3 protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, NIF3 superfamily, unknown function; 2.00A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >3mkt_A Multi antimicrobial extrusion protein (Na(+)/drug antiporter) MATE-like MDR efflux...; multidrug transporter, cation-bound, transport protein; 3.65A {Vibrio cholerae} PDB: 3mku_A | Back alignment and structure |
|---|
| >3mkt_A Multi antimicrobial extrusion protein (Na(+)/drug antiporter) MATE-like MDR efflux...; multidrug transporter, cation-bound, transport protein; 3.65A {Vibrio cholerae} PDB: 3mku_A | Back alignment and structure |
|---|
| >3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} | Back alignment and structure |
|---|
| >3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* | Back alignment and structure |
|---|
| >3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} | Back alignment and structure |
|---|
| >3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* | Back alignment and structure |
|---|
| >3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* | Back alignment and structure |
|---|
| >2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 | Back alignment and structure |
|---|
| >3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A | Back alignment and structure |
|---|
| >2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} | Back alignment and structure |
|---|
| >1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* | Back alignment and structure |
|---|
| >1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* | Back alignment and structure |
|---|
| >3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} | Back alignment and structure |
|---|
| >4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* | Back alignment and structure |
|---|
| >1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A | Back alignment and structure |
|---|
| >2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A | Back alignment and structure |
|---|
| >3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} | Back alignment and structure |
|---|
| >2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 | Back alignment and structure |
|---|
| >4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A | Back alignment and structure |
|---|
| >4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* | Back alignment and structure |
|---|
| >1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 | Back alignment and structure |
|---|
| >3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... | Back alignment and structure |
|---|
| >1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 | Back alignment and structure |
|---|
| >3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* | Back alignment and structure |
|---|
| >3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} | Back alignment and structure |
|---|
| >3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* | Back alignment and structure |
|---|
| >2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A | Back alignment and structure |
|---|
| >2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} | Back alignment and structure |
|---|
| >2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 | Back alignment and structure |
|---|
| >3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} | Back alignment and structure |
|---|
| >3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* | Back alignment and structure |
|---|
| >1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 | Back alignment and structure |
|---|
| >1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* | Back alignment and structure |
|---|
| >4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} | Back alignment and structure |
|---|
| >2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* | Back alignment and structure |
|---|
| >1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 | Back alignment and structure |
|---|
| >3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} | Back alignment and structure |
|---|
| >1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A | Back alignment and structure |
|---|
| >3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* | Back alignment and structure |
|---|
| >2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} | Back alignment and structure |
|---|
| >1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 | Back alignment and structure |
|---|
| >3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} | Back alignment and structure |
|---|
| >2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 | Back alignment and structure |
|---|
| >3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} | Back alignment and structure |
|---|
| >3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* | Back alignment and structure |
|---|
| >2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* | Back alignment and structure |
|---|
| >3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* | Back alignment and structure |
|---|
| >3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} | Back alignment and structure |
|---|
| >1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 | Back alignment and structure |
|---|
| >3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* | Back alignment and structure |
|---|
| >2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* | Back alignment and structure |
|---|
| >3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* | Back alignment and structure |
|---|
| >3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* | Back alignment and structure |
|---|
| >3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* | Back alignment and structure |
|---|
| >2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E | Back alignment and structure |
|---|
| >3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} | Back alignment and structure |
|---|
| >3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* | Back alignment and structure |
|---|
| >1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 | Back alignment and structure |
|---|
| >3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 | Back alignment and structure |
|---|
| >1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 | Back alignment and structure |
|---|
| >3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* | Back alignment and structure |
|---|
| >3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* | Back alignment and structure |
|---|
| >3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* | Back alignment and structure |
|---|
| >3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} | Back alignment and structure |
|---|
| >1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* | Back alignment and structure |
|---|
| >3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* | Back alignment and structure |
|---|
| >3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* | Back alignment and structure |
|---|
| >3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* | Back alignment and structure |
|---|
| >2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* | Back alignment and structure |
|---|
| >1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A | Back alignment and structure |
|---|
| >3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A | Back alignment and structure |
|---|
| >2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* | Back alignment and structure |
|---|
| >1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 | Back alignment and structure |
|---|
| >3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} | Back alignment and structure |
|---|
| >3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* | Back alignment and structure |
|---|
| >1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 | Back alignment and structure |
|---|
| >3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A | Back alignment and structure |
|---|
| >3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* | Back alignment and structure |
|---|
| >3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} | Back alignment and structure |
|---|
| >1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 | Back alignment and structure |
|---|
| >2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* | Back alignment and structure |
|---|
| >4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} | Back alignment and structure |
|---|
| >3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} | Back alignment and structure |
|---|
| >2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* | Back alignment and structure |
|---|
| >1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* | Back alignment and structure |
|---|
| >2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* | Back alignment and structure |
|---|
| >2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} | Back alignment and structure |
|---|
| >3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* | Back alignment and structure |
|---|
| >4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A | Back alignment and structure |
|---|
| >1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* | Back alignment and structure |
|---|
| >3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 | Back alignment and structure |
|---|
| >1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* | Back alignment and structure |
|---|
| >1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A | Back alignment and structure |
|---|
| >3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* | Back alignment and structure |
|---|
| >3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A | Back alignment and structure |
|---|
| >3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* | Back alignment and structure |
|---|
| >1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} | Back alignment and structure |
|---|
| >3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} | Back alignment and structure |
|---|
| >4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} | Back alignment and structure |
|---|
| >2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 | Back alignment and structure |
|---|
| >1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* | Back alignment and structure |
|---|
| >2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 | Back alignment and structure |
|---|
| >3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} | Back alignment and structure |
|---|
| >1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A | Back alignment and structure |
|---|
| >2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* | Back alignment and structure |
|---|
| >3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* | Back alignment and structure |
|---|
| >1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A | Back alignment and structure |
|---|
| >3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} | Back alignment and structure |
|---|
| >1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* | Back alignment and structure |
|---|
| >2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} | Back alignment and structure |
|---|
| >2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* | Back alignment and structure |
|---|
| >2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* | Back alignment and structure |
|---|
| >1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* | Back alignment and structure |
|---|
| >1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} | Back alignment and structure |
|---|
| >1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* | Back alignment and structure |
|---|
| >2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 | Back alignment and structure |
|---|
| >3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* | Back alignment and structure |
|---|
| >2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* | Back alignment and structure |
|---|
| >3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} | Back alignment and structure |
|---|
| >3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} | Back alignment and structure |
|---|
| >2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 | Back alignment and structure |
|---|
| >3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* | Back alignment and structure |
|---|
| >3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* | Back alignment and structure |
|---|
| >3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* | Back alignment and structure |
|---|
| >4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} | Back alignment and structure |
|---|
| >3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* | Back alignment and structure |
|---|
| >3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* | Back alignment and structure |
|---|
| >3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* | Back alignment and structure |
|---|
| >3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} | Back alignment and structure |
|---|
| >3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* | Back alignment and structure |
|---|
| >2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A | Back alignment and structure |
|---|
| >1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 | Back alignment and structure |
|---|
| >2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* | Back alignment and structure |
|---|
| >2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A | Back alignment and structure |
|---|
| >3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} | Back alignment and structure |
|---|
| >1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* | Back alignment and structure |
|---|
| >1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 | Back alignment and structure |
|---|
| >3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} | Back alignment and structure |
|---|
| >3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* | Back alignment and structure |
|---|
| >2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* | Back alignment and structure |
|---|
| >3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} | Back alignment and structure |
|---|
| >2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A | Back alignment and structure |
|---|
| >3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 | Back alignment and structure |
|---|
| >3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} | Back alignment and structure |
|---|
| >2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* | Back alignment and structure |
|---|
| >2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} | Back alignment and structure |
|---|
| >3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* | Back alignment and structure |
|---|
| >3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* | Back alignment and structure |
|---|
| >2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* | Back alignment and structure |
|---|
| >2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* | Back alignment and structure |
|---|
| >2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A | Back alignment and structure |
|---|
| >3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} | Back alignment and structure |
|---|
| >1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 | Back alignment and structure |
|---|
| >3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} | Back alignment and structure |
|---|
| >3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* | Back alignment and structure |
|---|
| >2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* | Back alignment and structure |
|---|
| >3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* | Back alignment and structure |
|---|
| >2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} | Back alignment and structure |
|---|
| >3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} | Back alignment and structure |
|---|
| >2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* | Back alignment and structure |
|---|
| >2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 | Back alignment and structure |
|---|
| >3rxy_A NIF3 protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, NIF3 superfamily, unknown function; 2.00A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* | Back alignment and structure |
|---|
| >3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} | Back alignment and structure |
|---|
| >3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* | Back alignment and structure |
|---|
| >2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* | Back alignment and structure |
|---|
| >3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* | Back alignment and structure |
|---|
| >2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2fyw_A Conserved hypothetical protein; structural genomics, PSI, midwest CENT structural genomics, MCSG, protein structure initiative; 2.40A {Streptococcus pneumoniae} SCOP: c.135.1.1 | Back alignment and structure |
|---|
| >3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} | Back alignment and structure |
|---|
| >3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* | Back alignment and structure |
|---|
| >3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* | Back alignment and structure |
|---|
| >3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* | Back alignment and structure |
|---|
| >3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} | Back alignment and structure |
|---|
| >4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} | Back alignment and structure |
|---|
| >1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* | Back alignment and structure |
|---|
| >4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* | Back alignment and structure |
|---|
| >2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* | Back alignment and structure |
|---|
| >1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 | Back alignment and structure |
|---|
| >2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* | Back alignment and structure |
|---|
| >2nyd_A UPF0135 protein SA1388; hypothetical protein SA1388, selenomethionine SAD, unknown F; 2.00A {Staphylococcus aureus subsp} PDB: 3lnl_A* | Back alignment and structure |
|---|
| >2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A | Back alignment and structure |
|---|
| >1nmo_A Hypothetical protein YBGI; toroidal structure, structure 2 project, S2F, structural genomics, unknown function; 2.20A {Escherichia coli} SCOP: c.135.1.1 PDB: 1nmp_A | Back alignment and structure |
|---|
| >2gx8_A NIF3-related protein; structural genomics, unknown function, protein structure initiative, midwest center for structural genomics, MCSG; HET: EPE; 2.20A {Bacillus cereus} SCOP: c.135.1.1 | Back alignment and structure |
|---|
| >3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 896 | ||||
| d1nmpa_ | 247 | c.135.1.1 (A:) Hypothetical protein YbgI {Escheric | 3e-52 | |
| d2fywa1 | 265 | c.135.1.1 (A:1-265) Hypothetical protein SP1609 {S | 6e-38 | |
| d1m6ya1 | 101 | a.60.13.1 (A:115-215) Putative methyltransferase T | 1e-25 | |
| d1wg8a1 | 98 | a.60.13.1 (A:109-206) Putative methyltransferase T | 5e-25 | |
| d2gx8a1 | 370 | c.135.1.1 (A:4-373) Nif3-related protein BC4286 {B | 7e-23 | |
| d2gx8a1 | 370 | c.135.1.1 (A:4-373) Nif3-related protein BC4286 {B | 3e-15 | |
| d1wg8a2 | 182 | c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransf | 1e-21 | |
| d1m6ya2 | 192 | c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransf | 3e-20 | |
| d1m6ya2 | 192 | c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransf | 0.002 |
| >d1nmpa_ c.135.1.1 (A:) Hypothetical protein YbgI {Escherichia coli [TaxId: 562]} Length = 247 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NIF3 (NGG1p interacting factor 3)-like superfamily: NIF3 (NGG1p interacting factor 3)-like family: NIF3 (NGG1p interacting factor 3)-like domain: Hypothetical protein YbgI species: Escherichia coli [TaxId: 562]
Score = 181 bits (459), Expect = 3e-52
Identities = 97/220 (44%), Positives = 133/220 (60%), Gaps = 11/220 (5%)
Query: 669 KKLNIKKYEDYCPNGLQVEGRSNINVIVTGVTASLDLIKTAVDMNADAILVHHGYFWKGE 728
+KLN DY PNGLQVEG+ + IVTGVTAS L+ AV + ADA++VHHGYFWKGE
Sbjct: 12 EKLNSAAISDYAPNGLQVEGKETVQKIVTGVTASQALLDEAVRLGADAVIVHHGYFWKGE 71
Query: 729 NSNIVGIKKKRLEQLIINKINLYAYHLPLDMHPKLGNNAQLAKILNFSCTRRFSKNNIGW 788
+ I G+K+ RL+ L+ N INLY +HLPLD HP+LGNNAQLA +L +
Sbjct: 72 SPVIRGMKRNRLKTLLANDINLYGWHLPLDAHPELGNNAQLAALLGITVMGEIEPLVPWG 131
Query: 789 IGKIINLKRYNFKKIITIKDLFHHITRKIGKKPIVIG-DLNKKIYEIGWCTGAAQNLLTD 847
+ +L I ++G+KP+ G + + + WCTG Q+ +
Sbjct: 132 ----------ELTMPVPGLELASWIEARLGRKPLWCGDTGPEVVQRVAWCTGGGQSFIDS 181
Query: 848 AINEGVTAYISGEISESTVYISRESGVAYFAAGHHATERY 887
A GV A+I+GE+SE T++ +RE G+ ++AAGHHATER
Sbjct: 182 AARFGVDAFITGEVSEQTIHSAREQGLHFYAAGHHATERG 221
|
| >d2fywa1 c.135.1.1 (A:1-265) Hypothetical protein SP1609 {Streptococcus pneumoniae [TaxId: 1313]} Length = 265 | Back information, alignment and structure |
|---|
| >d1m6ya1 a.60.13.1 (A:115-215) Putative methyltransferase TM0872, insert domain {Thermotoga maritima [TaxId: 2336]} Length = 101 | Back information, alignment and structure |
|---|
| >d1wg8a1 a.60.13.1 (A:109-206) Putative methyltransferase TM0872, insert domain {Thermus thermophilus [TaxId: 274]} Length = 98 | Back information, alignment and structure |
|---|
| >d2gx8a1 c.135.1.1 (A:4-373) Nif3-related protein BC4286 {Bacillus cereus [TaxId: 1396]} Length = 370 | Back information, alignment and structure |
|---|
| >d2gx8a1 c.135.1.1 (A:4-373) Nif3-related protein BC4286 {Bacillus cereus [TaxId: 1396]} Length = 370 | Back information, alignment and structure |
|---|
| >d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Length = 182 | Back information, alignment and structure |
|---|
| >d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Length = 192 | Back information, alignment and structure |
|---|
| >d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Length = 192 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 896 | |||
| d2gx8a1 | 370 | Nif3-related protein BC4286 {Bacillus cereus [TaxI | 100.0 | |
| d1nmpa_ | 247 | Hypothetical protein YbgI {Escherichia coli [TaxId | 100.0 | |
| d2fywa1 | 265 | Hypothetical protein SP1609 {Streptococcus pneumon | 100.0 | |
| d1wg8a1 | 98 | Putative methyltransferase TM0872, insert domain { | 100.0 | |
| d1m6ya1 | 101 | Putative methyltransferase TM0872, insert domain { | 100.0 | |
| d1m6ya2 | 192 | TM0872, methyltransferase domain {Thermotoga marit | 100.0 | |
| d1wg8a2 | 182 | TM0872, methyltransferase domain {Thermus thermoph | 100.0 | |
| d1g8aa_ | 227 | Fibrillarin homologue {Archaeon Pyrococcus horikos | 97.91 | |
| d2b25a1 | 324 | Hypothetical protein FLJ20628 {Human (Homo sapiens | 97.72 | |
| d1sqga2 | 284 | Ribosomal RNA small subunit methyltransferase B, R | 97.71 | |
| d2b9ea1 | 293 | NOL1R {Human (Homo sapiens) [TaxId: 9606]} | 97.71 | |
| d2as0a2 | 324 | Hypothetical protein PH1915, middle and C-terminal | 97.7 | |
| d1i9ga_ | 264 | Probable methyltransferase Rv2118c {Mycobacterium | 97.62 | |
| d1wxxa2 | 318 | Hypothetical protein TTHA1280, middle and C-termin | 97.56 | |
| d1dusa_ | 194 | Hypothetical protein MJ0882 {Archaeon Methanococcu | 97.55 | |
| d1l3ia_ | 186 | Precorrin-6Y methyltransferase (CbiT) {Archaeon Me | 97.42 | |
| d2b78a2 | 317 | Hypothetical protein SMu776, middle and C-terminal | 97.36 | |
| d1o54a_ | 266 | Hypothetical protein TM0748 {Thermotoga maritima [ | 97.33 | |
| d1yb2a1 | 250 | Hypothetical protein Ta0852 {Thermoplasma acidophi | 97.31 | |
| d2nxca1 | 254 | PrmA-like protein TTHA0656 (TT0836) {Thermus therm | 97.22 | |
| d1dl5a1 | 213 | Protein-L-isoaspartyl O-methyltransferase {Thermot | 97.05 | |
| d1nt2a_ | 209 | Fibrillarin homologue {Archaeon Archaeoglobus fulg | 96.87 | |
| d2cl5a1 | 214 | Catechol O-methyltransferase, COMT {Rat (Rattus no | 96.85 | |
| d2ih2a1 | 223 | DNA methylase TaqI, N-terminal domain {Thermus aqu | 96.83 | |
| d1i1na_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Human ( | 96.68 | |
| d2esra1 | 152 | Putative methyltransferase SPy1538 {Streptococcus | 96.68 | |
| d1im8a_ | 225 | Hypothetical protein HI0319 (YecO) {Haemophilus in | 96.55 | |
| d2o57a1 | 282 | Putative sarcosine dimethylglycine methyltransfera | 96.53 | |
| d2fcaa1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil | 96.43 | |
| d1nw3a_ | 328 | Catalytic, N-terminal domain of histone methyltran | 96.35 | |
| d1nkva_ | 245 | Hypothetical Protein YjhP {Escherichia coli [TaxId | 96.31 | |
| d1wy7a1 | 201 | Hypothetical protein PH1948 {Archaeon Pyrococcus h | 96.3 | |
| d1g8sa_ | 230 | Fibrillarin homologue {Archaeon Methanococcus jann | 96.25 | |
| d1vl5a_ | 231 | Hypothetical protein BH2331 {Bacillus halodurans [ | 96.25 | |
| d1ne2a_ | 197 | Hypothetical protein Ta1320 {Archaeon Thermoplasma | 96.2 | |
| d1pjza_ | 201 | Thiopurine S-methyltransferase {Pseudomonas syring | 96.17 | |
| d2frna1 | 260 | Hypothetical protein PH0793 {Pyrococcus horikoshii | 96.15 | |
| d1yzha1 | 204 | tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep | 96.07 | |
| d1p91a_ | 268 | rRNA methyltransferase RlmA {Escherichia coli [Tax | 96.07 | |
| d1zx0a1 | 229 | Guanidinoacetate methyltransferase {Human (Homo sa | 95.94 | |
| d1ri5a_ | 252 | mRNA cap (Guanine N-7) methyltransferase {Fungus ( | 95.81 | |
| d2fhpa1 | 182 | Putative methylase EF2452 {Enterococcus faecalis [ | 95.76 | |
| d1nv8a_ | 271 | N5-glutamine methyltransferase, HemK {Thermotoga m | 95.55 | |
| d2h00a1 | 250 | Methyltransferase 10 domain containing protein MET | 95.45 | |
| d2avda1 | 219 | COMT domain-containing protein 1, COMTD1 {Human (H | 95.41 | |
| d2b3ta1 | 274 | N5-glutamine methyltransferase, HemK {Escherichia | 95.39 | |
| d2f8la1 | 328 | Hypothetical protein Lmo1582 {Listeria monocytogen | 95.33 | |
| d1wzna1 | 251 | Hypothetical methyltransferase PH1305 {Archaeon Py | 95.3 | |
| d2gh1a1 | 281 | Methyltransferase BC2162 {Bacillus cereus [TaxId: | 95.19 | |
| d1y8ca_ | 246 | Putative methyltransferase CAC2371 {Clostridium ac | 95.17 | |
| d2fk8a1 | 280 | Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri | 95.14 | |
| d1ixka_ | 313 | Hypothetical methyltransferase PH1374 {Archaeon Py | 95.11 | |
| d1ws6a1 | 171 | Methyltransferase TTHA0928 {Thermus thermophilus [ | 95.04 | |
| d1vbfa_ | 224 | Protein-L-isoaspartyl O-methyltransferase {Sulfolo | 95.0 | |
| d2igta1 | 309 | Putative methyltransferase Atu0340 {Agrobacterium | 94.98 | |
| d1uwva2 | 358 | rRNA (Uracil-5-)-methyltransferase RumA, catalytic | 94.94 | |
| d2ex4a1 | 222 | Adrenal gland protein AD-003 (C9orf32) {Human (Hom | 94.87 | |
| d2p7ia1 | 225 | Hypothetical protein ECA1738 {Erwinia carotovora [ | 94.86 | |
| d2oyra1 | 250 | Hypothetical protein YhiQ {Shigella flexneri [TaxI | 94.78 | |
| d1xtpa_ | 254 | Hypothetical protein Lmaj004091aaa (LmjF30.0810) { | 94.67 | |
| d1kpia_ | 291 | CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | 94.51 | |
| d1ve3a1 | 226 | Hypothetical protein PH0226 {Archaeon Pyrococcus h | 94.51 | |
| d2bzga1 | 229 | Thiopurine S-methyltransferase {Human (Homo sapien | 94.46 | |
| d1kpga_ | 285 | CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | 94.07 | |
| d1xxla_ | 234 | Hypothetical protein YcgJ {Bacillus subtilis [TaxI | 93.99 | |
| d1u2za_ | 406 | Catalytic, N-terminal domain of histone methyltran | 93.94 | |
| d1tw3a2 | 253 | Carminomycin 4-O-methyltransferase {Streptomyces p | 93.62 | |
| d2i6ga1 | 198 | Putative methyltransferase TehB {Salmonella typhim | 93.48 | |
| d2fpoa1 | 183 | Methylase YhhF {Escherichia coli [TaxId: 562]} | 93.41 | |
| d1ej0a_ | 180 | RNA methyltransferase FtsJ {Escherichia coli [TaxI | 93.33 | |
| d1susa1 | 227 | Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag | 93.24 | |
| d1r18a_ | 223 | Protein-L-isoaspartyl O-methyltransferase {Fruit f | 93.07 | |
| d1xvaa_ | 292 | Glycine N-methyltransferase {Rat (Rattus norvegicu | 92.84 | |
| d2avna1 | 246 | Hypothetical methyltransferase TM1389 {Thermotoga | 92.52 | |
| d1jg1a_ | 215 | Protein-L-isoaspartyl O-methyltransferase {Archaeo | 91.96 | |
| d1qzza2 | 256 | Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu | 90.8 | |
| d1qama_ | 235 | rRNA adenine dimethylase {Bacillus subtilis, Ermc' | 90.65 | |
| d2gx8a1 | 370 | Nif3-related protein BC4286 {Bacillus cereus [TaxI | 90.11 | |
| d2fywa1 | 265 | Hypothetical protein SP1609 {Streptococcus pneumon | 89.68 | |
| d1nmpa_ | 247 | Hypothetical protein YbgI {Escherichia coli [TaxId | 88.86 | |
| d1oria_ | 316 | Protein arginine N-methyltransferase 1, PRMT1 {Rat | 88.25 | |
| d2ar0a1 | 524 | M.EcoKI {Escherichia coli [TaxId: 562]} | 88.07 | |
| d1uira_ | 312 | Spermidine synthase {Thermus thermophilus [TaxId: | 87.77 | |
| d2a14a1 | 257 | Indolethylamine N-methyltransferase, INMT {Human ( | 87.18 | |
| d1yuba_ | 245 | rRNA adenine dimethylase {Streptococcus pneumoniae | 86.5 | |
| d2fyta1 | 311 | Protein arginine N-methyltransferase 3, PRMT3 {Hum | 85.4 | |
| d1mjfa_ | 276 | Putative spermidine synthetase PF0127 (SpeE) {Arch | 85.28 | |
| d1g6q1_ | 328 | Arginine methyltransferase, HMT1 {Baker's yeast (S | 85.19 | |
| d1jqea_ | 280 | Histamine methyltransferase {Human (Homo sapiens) | 84.9 | |
| d1xj5a_ | 290 | Spermidine synthase {Thale cress (Arabidopsis thal | 83.22 | |
| d1vlma_ | 208 | Possible histamine N-methyltransferase TM1293 {The | 82.92 | |
| d1fp2a2 | 244 | Isoflavone O-methyltransferase {Alfalfa (Medicago | 82.82 | |
| d1qyra_ | 252 | High level kasugamycin resistance protein KsgA {Es | 82.09 | |
| d1iy9a_ | 274 | Spermidine synthase {Bacillus subtilis [TaxId: 142 | 81.27 |
| >d2gx8a1 c.135.1.1 (A:4-373) Nif3-related protein BC4286 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: NIF3 (NGG1p interacting factor 3)-like superfamily: NIF3 (NGG1p interacting factor 3)-like family: NIF3 (NGG1p interacting factor 3)-like domain: Nif3-related protein BC4286 species: Bacillus cereus [TaxId: 1396]
Probab=100.00 E-value=4.9e-54 Score=471.54 Aligned_cols=230 Identities=20% Similarity=0.295 Sum_probs=205.7
Q ss_pred ccchhhcccccccccccccccccCCceeeecc-CCCcceEEEEeecCHHHHHHHHHcCCCEEEEccCCCccCCCCcc-CC
Q psy2376 657 PKMKFLARCKPKKKLNIKKYEDYCPNGLQVEG-RSNINVIVTGVTASLDLIKTAVDMNADAILVHHGYFWKGENSNI-VG 734 (896)
Q Consensus 657 p~~~~l~~~~~~~~~~~~~~e~wd~~Gl~~~~-~~~v~~i~~~~~~t~~vi~~A~~~~~~lIitHHP~~f~~~~~~~-~~ 734 (896)
|.++.| -..+|+++|++.+|+|||+|||+|+ +++|++|++|+|+|++|++||+++||||||||||+||++.+++. ++
T Consensus 2 p~~~ei-i~~le~~~P~~lAe~wDnvGL~vg~~~~~V~~I~valD~t~~vi~eAi~~~adlIItHHPl~f~~~k~l~~~~ 80 (370)
T d2gx8a1 2 PNGHEI-ISLFESMYPKHLAMEGDKIGLQIGALNKPVRHVLIALDVTEEVVDEAIQLGANVIIAHHPLIFNPLKAIHTDK 80 (370)
T ss_dssp CBHHHH-HHHHHHHSCGGGSCTTCCCEEEESCSSSBCCEEEEESSCCHHHHHHHHHHTCCEEEESSCSCCSCCSCCCTTS
T ss_pred CCHHHH-HHHHHHhCCHhHcccCCCCeEEeCCCCCccCEEEEEEcCCHHHHHHHHHCCCCEEEECCCCCcCCcccccCCC
Confidence 667777 6789999999999999999999998 57899999999999999999999999999999999999999866 57
Q ss_pred hHHHHHHHHHHcCCeEEEecCCCCCCCCCcHHHHHHHHcCCCccccCccC---------------------------ccc
Q psy2376 735 IKKKRLEQLIINKINLYAYHLPLDMHPKLGNNAQLAKILNFSCTRRFSKN---------------------------NIG 787 (896)
Q Consensus 735 ~~~~~~~~l~~~~I~vy~~Ht~lD~~~~~G~n~~la~~Lgl~~~~~~~~~---------------------------~~g 787 (896)
++++++.+|++|||+|||+|||||+++. |+|+|||+.||+++.+++.+. +.|
T Consensus 81 ~~~~~~~~li~~~I~vys~HTnlD~~~~-G~nd~La~~Lgl~~~~~l~~~~~~~~~~~~~~~p~~~~~~~~~~~~~agag 159 (370)
T d2gx8a1 81 AYGKIIEKCIKNDIAIYAAHTNVDVAKG-GVNDLLAEALGLQNTEVLAPTYAEEMKKVVVFVPVTHAEEVRKALGDAGAG 159 (370)
T ss_dssp HHHHHHHHHHHTTCEEEECCHHHHHSTT-SHHHHHHHHTTCEEEEEEEEEEEEEEEEEEEEECHHHHHHHHHHHHHTTTT
T ss_pred chhHHHHHHHHCCCeEEEeccchhccCC-cHHHHHHHHhCCCccccccccccccccceEEEeChhhhhhhhhcchhcCCC
Confidence 7899999999999999999999999985 999999999999987765321 011
Q ss_pred --------------------------------------------------------------------------------
Q psy2376 788 -------------------------------------------------------------------------------- 787 (896)
Q Consensus 788 -------------------------------------------------------------------------------- 787 (896)
T Consensus 160 ~ig~y~~~~~~~~g~G~~~~~~~~~P~ig~~~~~~~~~e~~~e~~~~~~~~~~v~~al~~ahpy~~~~~~~~~~~~~~~~ 239 (370)
T d2gx8a1 160 HIGNYSHCTFSSEGTGTFVPQEGTNPYIGETGQLERVEEVRIETIIPASLQRKVIKAMVTAHPYEEVAYDVYPLDNKGET 239 (370)
T ss_dssp CBTTEEEEEEEEEEEEEEEEC-----------CCEEEEEEEEEEEEEGGGHHHHHHHHHHHSSSSSCCEEEEEEEEEEEE
T ss_pred cccccccccccccCcccccCCCCCCCccCcCCceeecchhheeeechHHHHHHHHHHHHHhCCcchhhhhhccccccccc
Confidence
Q ss_pred -ccceeecccccccCCccCHHHHHHHHHhHhCCCcE-EEcCCCCceeEEEEEecCchHHHHHHHHcCCcEEEEccCCchH
Q psy2376 788 -WIGKIINLKRYNFKKIITIKDLFHHITRKIGKKPI-VIGDLNKKIYEIGWCTGAAQNLLTDAINEGVTAYISGEISEST 865 (896)
Q Consensus 788 -~~g~i~~~~~~~~~~~~~~~el~~~~~~~l~~~~~-~~g~~~~~v~rvai~~Gsg~~~i~~a~~~g~D~~ITGd~~~h~ 865 (896)
++|+++ ++++|+|++||++++|+.|+.+.+ ++|+++++|+|||||+|||++++++|.+.|||+|||||+|||+
T Consensus 240 ~G~Grig-----~l~~p~~l~~~~~~vk~~l~~~~vr~~g~~~~~I~~VAvc~GSG~s~i~~a~~~gaDv~ITGe~k~h~ 314 (370)
T d2gx8a1 240 LGLGKIG-----YLQEEMTLGQFAEHVKQSLDVKGARVVGKLDDKVRKVAVLGGDGNKYINQAKFKGADVYVTGDMYYHV 314 (370)
T ss_dssp EEEEEEE-----EEEEEEEHHHHHHHHHHHTTCSCCEEESCTTSEEEEEEEEEEECGGGHHHHHHTTCSEEEEECCCHHH
T ss_pred cCcceEE-----EeCCcccHHHHHHHHHHHcCCCeEEEeCCCCCceeEEEEEccccHHHHHHHHHCCCCEEEEcCCcHHH
Confidence 122232 256799999999999999999987 5788899999999999999999999999999999999999999
Q ss_pred HHHHHHcCCeEEEeCChhhhhhhhhhccc
Q psy2376 866 VYISRESGVAYFAAGHHATERYDKSPNRE 894 (896)
Q Consensus 866 ~~~a~~~g~~li~~gH~~sE~~~~~~~~~ 894 (896)
+++|.++|+++||+||| ||+++++.++|
T Consensus 315 ~~dA~~~gi~lId~GH~-sE~~~~~~l~~ 342 (370)
T d2gx8a1 315 AHDAMMLGLNIVDPGHN-VEKVMKQGVQK 342 (370)
T ss_dssp HHHHHHHTCEEEECCGG-GGGHHHHHHHH
T ss_pred HHHHHHcCCEEEECCch-hhHHHHHHHHH
Confidence 99999999999999997 99999887765
|
| >d1nmpa_ c.135.1.1 (A:) Hypothetical protein YbgI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fywa1 c.135.1.1 (A:1-265) Hypothetical protein SP1609 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1wg8a1 a.60.13.1 (A:109-206) Putative methyltransferase TM0872, insert domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1m6ya1 a.60.13.1 (A:115-215) Putative methyltransferase TM0872, insert domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} | Back information, alignment and structure |
|---|
| >d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} | Back information, alignment and structure |
|---|
| >d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} | Back information, alignment and structure |
|---|
| >d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} | Back information, alignment and structure |
|---|
| >d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} | Back information, alignment and structure |
|---|
| >d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} | Back information, alignment and structure |
|---|
| >d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} | Back information, alignment and structure |
|---|
| >d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} | Back information, alignment and structure |
|---|
| >d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2gx8a1 c.135.1.1 (A:4-373) Nif3-related protein BC4286 {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d2fywa1 c.135.1.1 (A:1-265) Hypothetical protein SP1609 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1nmpa_ c.135.1.1 (A:) Hypothetical protein YbgI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} | Back information, alignment and structure |
|---|
| >d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|