Psyllid ID: psy241
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 753 | ||||||
| 242009515 | 1424 | Neogenin precursor, putative [Pediculus | 0.859 | 0.454 | 0.480 | 1e-178 | |
| 321468721 | 1334 | hypothetical protein DAPPUDRAFT_197333 [ | 0.901 | 0.508 | 0.434 | 1e-164 | |
| 328718304 | 1437 | PREDICTED: neogenin-like isoform 2 [Acyr | 0.973 | 0.510 | 0.402 | 1e-162 | |
| 328718302 | 1398 | PREDICTED: neogenin-like isoform 1 [Acyr | 0.973 | 0.524 | 0.402 | 1e-161 | |
| 322794382 | 1306 | hypothetical protein SINV_16528 [Solenop | 0.900 | 0.519 | 0.430 | 1e-155 | |
| 380021881 | 1484 | PREDICTED: neogenin-like [Apis florea] | 0.875 | 0.444 | 0.446 | 1e-155 | |
| 328786070 | 1537 | PREDICTED: neogenin [Apis mellifera] | 0.875 | 0.428 | 0.446 | 1e-154 | |
| 307184444 | 1466 | Neogenin [Camponotus floridanus] | 0.853 | 0.438 | 0.448 | 1e-154 | |
| 332030773 | 1488 | Neogenin [Acromyrmex echinatior] | 0.909 | 0.460 | 0.428 | 1e-153 | |
| 307195636 | 1463 | Neogenin [Harpegnathos saltator] | 0.856 | 0.440 | 0.440 | 1e-153 |
| >gi|242009515|ref|XP_002425529.1| Neogenin precursor, putative [Pediculus humanus corporis] gi|212509404|gb|EEB12791.1| Neogenin precursor, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 632 bits (1629), Expect = e-178, Method: Compositional matrix adjust.
Identities = 343/714 (48%), Positives = 458/714 (64%), Gaps = 67/714 (9%)
Query: 56 LPSAPQSVSAIMVGPRSVALRWLPPTLPRGEILVYCVLYKREGSERERAYNATA-RVEAI 114
+PS+PQ+V I RSV L+ +PPT GEI Y V +++EGS+RER N + R E I
Sbjct: 445 VPSSPQAVEVIYTSSRSVTLKVVPPTHTNGEITSYSVFFRQEGSQRERVLNTSGVRSEEI 504
Query: 115 -IQGLHPNTSYTFRVVAYNALGAGLASSALPVKTEPEDHVPSPPLNVNIPVVGTSSLLVT 173
I GL P+ +Y FR+VA NA GAG +S L VKTE E HVPS PL +N ++++V
Sbjct: 505 TIPGLQPDRTYHFRIVANNAHGAGPSSEDLIVKTETEVHVPSAPLGINAYATSPTTIIVE 564
Query: 174 WEKPTVTNGEIKHYTLYYLEEDTSVERHVVTPQLSYELTGLSHFTLYSIWVVAHNGNGAG 233
W+ P VTNG I Y L ++E D+S E H++T Q S E+T L+ FT Y WV+A N NG G
Sbjct: 565 WKPPAVTNGAILKYKLLFIESDSSNENHMLTSQQSIEVTDLNKFTEYCFWVIAMNENGMG 624
Query: 234 TTSQELSVQTLSDKPSEPPAN---------SITVRWQPPSRRGQNGIITGYKLRYKKKDV 284
+ S+E+ +TLSD PSEPP N SI VRW+PPS+ GQNGIITGYKLRYKK++
Sbjct: 625 SASEEVVTRTLSDVPSEPPQNVTVEPGSSTSIVVRWEPPSKDGQNGIITGYKLRYKKQNR 684
Query: 285 KK--DKGETVTTAGDRRLYVITGLNKSTTYQIKLWAMNVNGSGPATDWFSAETFSQDLGE 342
++ ++G TVT AGDRRLYV++ L K ++YQ+++WAMNVNG+GP TDW + ETF DL E
Sbjct: 685 RERGERGFTVTAAGDRRLYVLSDLEKGSSYQVRIWAMNVNGTGPPTDWITVETFKNDLDE 744
Query: 343 FTVPDIPASLKARPGGPSSIIVSWTPPADQSIMVRGFTLGWGKGVPDEFVKQILDVKQRS 402
VPD P ++ ARP SI VSW PP D ++MVRG+ +GWGKG P F +IL+ KQ+S
Sbjct: 745 TKVPDKPTNVIARPSS-DSIRVSWGPPKDPNVMVRGYNIGWGKGFPYTF-SEILEGKQQS 802
Query: 403 DEITGLEPNSDYVISLRAFNEMGDGPQKYESLRTRNEPPPQAPKVLIPPMGLKSEVLSPY 462
I L +S+YVI++RA+N MGDG Y S+RTR EPP + ++PP+GLK+ VLS
Sbjct: 803 FNIKNLANSSEYVIAVRAYNAMGDGSPAYVSVRTREEPPNEDEMTILPPVGLKAIVLSSS 862
Query: 463 SMRISWIDTTLPDQFQQHGEEGRHYLVRYTHLLGASNPRYKYINANITSVQINDLRPSTQ 522
S+ + W D P + Q + R Y V+Y+ SNPR K++ ++ INDLRP+TQ
Sbjct: 863 SVILHWTD---PTRVQV--ADDRTYSVKYS-WAHHSNPRPKFVTTTNSNCMINDLRPNTQ 916
Query: 523 YEFTVKVVRAKKESEWSMIVLNTTQEAAPASAPRDLTVVSKEGDPSLVNLNWQPPKSANG 582
YEF+VK+++ ++ES+WSM+V NTT EA P+SAPRDLTVV E +P+ VNLNWQPPK ANG
Sbjct: 917 YEFSVKLLKGRRESKWSMVVFNTTFEAIPSSAPRDLTVVPVEKNPTHVNLNWQPPKQANG 976
Query: 583 QISGYTILYSSD---PNTDQWIEESVVGDKMSTNVRGLEPGRIYYFKIKARNSAGSSPYS 639
I+GY I Y++D P D WI +++VGDK++ ++GLEP YYFKI+ARNS G P S
Sbjct: 977 LITGYVIFYTTDYELPEKD-WIPQNIVGDKLTAVIKGLEPSTTYYFKIQARNSKGYGPLS 1035
Query: 640 STVTWTT------ASDMQEAG--GIPNSNQVSNTMIL----------------------- 668
+ V++ T +SD G G P S + +I
Sbjct: 1036 TKVSFKTFDGGPSSSDSTLFGKDGRPLSKIIYIILICSFVAVLCVALTIGIICCKRASAR 1095
Query: 669 ------YVKGNTGGKQQAPATQINPPDLWIHHDQMELKAIEKSSQGSLDLAPTT 716
Y+KGN P T + PPDLWIHHDQMELKA+EKS + D+ P++
Sbjct: 1096 SRNASGYLKGNL-----KPKTSMKPPDLWIHHDQMELKALEKSHHSNSDIGPSS 1144
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|321468721|gb|EFX79705.1| hypothetical protein DAPPUDRAFT_197333 [Daphnia pulex] | Back alignment and taxonomy information |
|---|
| >gi|328718304|ref|XP_003246447.1| PREDICTED: neogenin-like isoform 2 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|328718302|ref|XP_001946559.2| PREDICTED: neogenin-like isoform 1 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|322794382|gb|EFZ17486.1| hypothetical protein SINV_16528 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|380021881|ref|XP_003694785.1| PREDICTED: neogenin-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328786070|ref|XP_001122444.2| PREDICTED: neogenin [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|307184444|gb|EFN70853.1| Neogenin [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|332030773|gb|EGI70449.1| Neogenin [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|307195636|gb|EFN77478.1| Neogenin [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 753 | ||||||
| UNIPROTKB|Q59FP8 | 1130 | NEO1 "Neogenin" [Homo sapiens | 0.827 | 0.551 | 0.418 | 1.6e-134 | |
| UNIPROTKB|J9P2T1 | 1459 | NEO1 "Uncharacterized protein" | 0.837 | 0.432 | 0.413 | 6e-133 | |
| UNIPROTKB|F1SI93 | 1123 | NEO1 "Uncharacterized protein" | 0.837 | 0.561 | 0.413 | 7.6e-133 | |
| ZFIN|ZDB-GENE-011101-2 | 1421 | dcc "deleted in colorectal car | 0.823 | 0.436 | 0.380 | 1.3e-126 | |
| UNIPROTKB|J3QS93 | 1076 | DCC "Netrin receptor DCC" [Hom | 0.779 | 0.545 | 0.408 | 3.4e-126 | |
| UNIPROTKB|Q91562 | 1427 | dcc "Tumor suppressor" [Xenopu | 0.779 | 0.411 | 0.395 | 4.5e-125 | |
| FB|FBgn0011592 | 1526 | fra "frazzled" [Drosophila mel | 0.800 | 0.395 | 0.392 | 4e-121 | |
| UNIPROTKB|F1M0Z6 | 1427 | Neo1 "Neogenin" [Rattus norveg | 0.524 | 0.276 | 0.435 | 1.8e-96 | |
| UNIPROTKB|Q92859 | 1461 | NEO1 "Neogenin" [Homo sapiens | 0.536 | 0.276 | 0.422 | 2.1e-96 | |
| RGD|619837 | 1377 | Neo1 "neogenin 1" [Rattus norv | 0.536 | 0.293 | 0.425 | 2.9e-96 |
| UNIPROTKB|Q59FP8 NEO1 "Neogenin" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 1239 (441.2 bits), Expect = 1.6e-134, Sum P(2) = 1.6e-134
Identities = 276/660 (41%), Positives = 384/660 (58%)
Query: 3 GNIQASSLLAISDMDPSSST-PPNQYHLTSTTSMTASPLDTSTGSIEAINETLTLPSAPQ 61
GN QA + L I + D + T PP TS TS T L +T T LPSAP+
Sbjct: 93 GNAQAGAQLIILEHDVAIPTLPP-----TSLTSATTDHLAPAT--------TGPLPSAPR 139
Query: 62 SVSAIMVGPRSVALRWLPPTL-PRGEILVYCVLYKREGSERERAYNAT--ARVEAIIQGL 118
V A +V R + L W P P G+ L Y V Y +EG RER N + ++ IQ L
Sbjct: 140 DVVASLVSTRFIKLTWRTPASDPHGDNLTYSVFYTKEGIARERVENTSHPGEMQVTIQNL 199
Query: 119 HPNTSYTFRVVAYNXXXXXXXXXXXPVKTEPEDHVPSPPLNVNIPVVGTSSLLVTWEKPT 178
P T Y FRV+A N V+T+PE +P P N+ +S+ VTWE P
Sbjct: 200 MPATVYIFRVMAQNKHGSGESSAPLRVETQPEVQLPGPAPNLRAYAASPTSITVTWETPV 259
Query: 179 VTNGEIKHYTLYYLEEDTSVERHVVTPQLSYELTGLSHFTLYSIWVVAHNGNGAGTTSQE 238
NGEI++Y LYY+E+ T E+ V SY + GL +T YS VVA+N +G G ++ +
Sbjct: 260 SGNGEIQNYKLYYMEKGTDKEQDVDVSSHSYTINGLKKYTEYSFRVVAYNKHGPGVSTPD 319
Query: 239 LSVQTLSDKPSEPPAN---------SITVRWQPPSRRGQNGIITGYKLRYXXXXXXXXXG 289
++V+TLSD PS P N SI + WQPP+ QNG ITGYK+RY
Sbjct: 320 VAVRTLSDVPSAAPQNLSLEVRNSKSIMIHWQPPAPATQNGQITGYKIRYRKASRKSDVT 379
Query: 290 ETVTTAGDRRLYVITGLNKSTTYQIKLWAMNVNGSGPATDWFSAETFSQDLGEFTVPDIP 349
ET+ + G + +I GL++ T Y ++ A+ +NG+GPATDW SAETF DL E VP++P
Sbjct: 380 ETLVS-GTQLSQLIEGLDRGTEYNFRVAALTINGTGPATDWLSAETFESDLDETRVPEVP 438
Query: 350 ASLKARPGGPSSIIVSWTPPADQSIMVRGFTLGWGKGVPD-EFVKQILDVKQRSDEITGL 408
+SL RP +SI+VSWTPP +Q+I+VRG+ +G+G G P + +K +D KQR I L
Sbjct: 439 SSLHVRPL-VTSIVVSWTPPENQNIVVRGYAIGYGIGSPHAQTIK--VDYKQRYYTIENL 495
Query: 409 EPNSDYVISLRAFNEMGDGPQKYESLRTRNEPPPQAPKVLIPPMGLKSEVLSPYSMRISW 468
+P+S YVI+L+AFN +G+G YES TR P P ++PP+G+++ +LS ++RI+W
Sbjct: 496 DPSSHYVITLKAFNNVGEGIPLYESAVTRPHTVPD-PTPMMPPVGVQASILSHDTIRITW 554
Query: 469 IDTTLPDQFQQHGEEGRHYLVRYTHLLGASNPRYKYINANITSVQINDLRPSTQYEFTVK 528
D +LP Q + R+Y VR+ + A N +YK NA S + L+P+T YEF+V
Sbjct: 555 ADNSLPKH--QKITDSRYYTVRWKTNIPA-NTKYKNANATTLSYLVTGLKPNTLYEFSVM 611
Query: 529 VVRAKKESEWSMIVLNTTQEAAPASAPRDLTVVSKEGDPSLVNLNWQPPKSANGQISGYT 588
V + ++ S WSM TT E P S P+D+TVVSKEG P + +NWQPP ANG+I+GY
Sbjct: 612 VTKGRRSSTWSMTAHGTTFELVPTSPPKDVTVVSKEGKPKTIIVNWQPPSEANGKITGYI 671
Query: 589 ILYSSDPNTD--QWIEESVVGDKMSTNVRGLEPGRIYYFKIKARNSAGSSPYSSTVTWTT 646
I YS+D N + W+ E VVG++++ ++ L YYFKI+ARNS G P S V + T
Sbjct: 672 IYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDTPYYFKIQARNSKGMGPMSEAVQFRT 731
|
|
| UNIPROTKB|J9P2T1 NEO1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SI93 NEO1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-011101-2 dcc "deleted in colorectal carcinoma" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J3QS93 DCC "Netrin receptor DCC" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q91562 dcc "Tumor suppressor" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0011592 fra "frazzled" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1M0Z6 Neo1 "Neogenin" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q92859 NEO1 "Neogenin" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|619837 Neo1 "neogenin 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 753 | |||
| cd00063 | 93 | cd00063, FN3, Fibronectin type 3 domain; One of th | 3e-16 | |
| cd00063 | 93 | cd00063, FN3, Fibronectin type 3 domain; One of th | 6e-16 | |
| cd00063 | 93 | cd00063, FN3, Fibronectin type 3 domain; One of th | 6e-16 | |
| pfam00041 | 84 | pfam00041, fn3, Fibronectin type III domain | 6e-15 | |
| smart00060 | 83 | smart00060, FN3, Fibronectin type 3 domain | 2e-13 | |
| pfam00041 | 84 | pfam00041, fn3, Fibronectin type III domain | 3e-12 | |
| cd00063 | 93 | cd00063, FN3, Fibronectin type 3 domain; One of th | 5e-12 | |
| smart00060 | 83 | smart00060, FN3, Fibronectin type 3 domain | 1e-11 | |
| smart00060 | 83 | smart00060, FN3, Fibronectin type 3 domain | 6e-11 | |
| smart00060 | 83 | smart00060, FN3, Fibronectin type 3 domain | 1e-10 | |
| pfam00041 | 84 | pfam00041, fn3, Fibronectin type III domain | 2e-10 | |
| cd00063 | 93 | cd00063, FN3, Fibronectin type 3 domain; One of th | 3e-10 | |
| smart00060 | 83 | smart00060, FN3, Fibronectin type 3 domain | 4e-10 | |
| pfam00041 | 84 | pfam00041, fn3, Fibronectin type III domain | 1e-08 | |
| cd00063 | 93 | cd00063, FN3, Fibronectin type 3 domain; One of th | 3e-08 | |
| pfam00041 | 84 | pfam00041, fn3, Fibronectin type III domain | 4e-08 | |
| pfam00041 | 84 | pfam00041, fn3, Fibronectin type III domain | 2e-06 | |
| smart00060 | 83 | smart00060, FN3, Fibronectin type 3 domain | 5e-06 | |
| pfam06583 | 295 | pfam06583, Neogenin_C, Neogenin C-terminus | 2e-04 |
| >gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
Score = 74.1 bits (182), Expect = 3e-16
Identities = 35/95 (36%), Positives = 51/95 (53%), Gaps = 4/95 (4%)
Query: 553 SAPRDLTVVSKEGDPSLVNLNWQPPKSANGQISGYTILYSSDPNTDQWIE-ESVVGDKMS 611
S P +L V + + V L+W PP+ G I+GY + Y + + W E E G + S
Sbjct: 2 SPPTNLRV--TDVTSTSVTLSWTPPEDDGGPITGYVVEYR-EKGSGDWKEVEVTPGSETS 58
Query: 612 TNVRGLEPGRIYYFKIKARNSAGSSPYSSTVTWTT 646
+ GL+PG Y F+++A N G SP S +VT TT
Sbjct: 59 YTLTGLKPGTEYEFRVRAVNGGGESPPSESVTVTT 93
|
Its tenth fibronectin type III repeat contains an RGD cell recognition sequence in a flexible loop between 2 strands. Approximately 2% of all animal proteins contain the FN3 repeat; including extracellular and intracellular proteins, membrane spanning cytokine receptors, growth hormone receptors, tyrosine phosphatase receptors, and adhesion molecules. FN3-like domains are also found in bacterial glycosyl hydrolases. Length = 93 |
| >gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain | Back alignment and domain information |
|---|
| >gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain | Back alignment and domain information |
|---|
| >gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain | Back alignment and domain information |
|---|
| >gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain | Back alignment and domain information |
|---|
| >gnl|CDD|238020 cd00063, FN3, Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain | Back alignment and domain information |
|---|
| >gnl|CDD|200951 pfam00041, fn3, Fibronectin type III domain | Back alignment and domain information |
|---|
| >gnl|CDD|214495 smart00060, FN3, Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >gnl|CDD|219094 pfam06583, Neogenin_C, Neogenin C-terminus | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 753 | |||
| KOG4221|consensus | 1381 | 100.0 | ||
| KOG4221|consensus | 1381 | 100.0 | ||
| KOG3513|consensus | 1051 | 100.0 | ||
| KOG3513|consensus | 1051 | 100.0 | ||
| KOG4222|consensus | 1281 | 99.88 | ||
| KOG0196|consensus | 996 | 99.81 | ||
| KOG0196|consensus | 996 | 99.79 | ||
| KOG4222|consensus | 1281 | 99.71 | ||
| KOG4258|consensus | 1025 | 99.61 | ||
| KOG4258|consensus | 1025 | 99.55 | ||
| PF00041 | 85 | fn3: Fibronectin type III domain; InterPro: IPR003 | 99.33 | |
| PF00041 | 85 | fn3: Fibronectin type III domain; InterPro: IPR003 | 99.18 | |
| KOG4802|consensus | 516 | 98.73 | ||
| cd00063 | 93 | FN3 Fibronectin type 3 domain; One of three types | 98.71 | |
| PF10179 | 300 | DUF2369: Uncharacterised conserved protein (DUF236 | 98.68 | |
| cd00063 | 93 | FN3 Fibronectin type 3 domain; One of three types | 98.58 | |
| COG3401 | 343 | Fibronectin type 3 domain-containing protein [Gene | 98.58 | |
| PF10179 | 300 | DUF2369: Uncharacterised conserved protein (DUF236 | 98.47 | |
| KOG4802|consensus | 516 | 98.44 | ||
| COG3401 | 343 | Fibronectin type 3 domain-containing protein [Gene | 98.33 | |
| KOG3632|consensus | 1335 | 98.26 | ||
| smart00060 | 83 | FN3 Fibronectin type 3 domain. One of three types | 98.21 | |
| smart00060 | 83 | FN3 Fibronectin type 3 domain. One of three types | 98.1 | |
| KOG3632|consensus | 1335 | 98.08 | ||
| KOG4152|consensus | 830 | 98.03 | ||
| KOG0613|consensus | 1205 | 97.9 | ||
| KOG4367|consensus | 699 | 97.64 | ||
| KOG4152|consensus | 830 | 97.55 | ||
| KOG0613|consensus | 1205 | 97.5 | ||
| PF09294 | 106 | Interfer-bind: Interferon-alpha/beta receptor, fib | 97.49 | |
| PF01108 | 107 | Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH | 97.35 | |
| TIGR00864 | 2740 | PCC polycystin cation channel protein. Note: this | 97.17 | |
| PF01108 | 107 | Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH | 97.1 | |
| PF06583 | 319 | Neogenin_C: Neogenin C-terminus; InterPro: IPR0105 | 97.02 | |
| PF09294 | 106 | Interfer-bind: Interferon-alpha/beta receptor, fib | 97.0 | |
| KOG4367|consensus | 699 | 96.91 | ||
| TIGR00864 | 2740 | PCC polycystin cation channel protein. Note: this | 96.65 | |
| KOG4806|consensus | 454 | 96.22 | ||
| KOG4228|consensus | 1087 | 96.21 | ||
| KOG4806|consensus | 454 | 95.97 | ||
| KOG4228|consensus | 1087 | 95.65 | ||
| PF09067 | 104 | EpoR_lig-bind: Erythropoietin receptor, ligand bin | 95.29 | |
| COG4733 | 952 | Phage-related protein, tail component [Function un | 94.89 | |
| PF09067 | 104 | EpoR_lig-bind: Erythropoietin receptor, ligand bin | 94.09 | |
| PF07495 | 66 | Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi | 94.01 | |
| TIGR00868 | 863 | hCaCC calcium-activated chloride channel protein 1 | 93.87 | |
| COG4733 | 952 | Phage-related protein, tail component [Function un | 93.76 | |
| PLN02533 | 427 | probable purple acid phosphatase | 92.22 | |
| PF09240 | 99 | IL6Ra-bind: Interleukin-6 receptor alpha chain, bi | 92.2 | |
| PLN02533 | 427 | probable purple acid phosphatase | 90.91 | |
| TIGR00868 | 863 | hCaCC calcium-activated chloride channel protein 1 | 90.03 | |
| KOG1225|consensus | 525 | 89.42 | ||
| PF09240 | 99 | IL6Ra-bind: Interleukin-6 receptor alpha chain, bi | 88.86 | |
| KOG1225|consensus | 525 | 88.0 | ||
| PF07495 | 66 | Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This regi | 87.95 | |
| cd05735 | 88 | Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down | 83.96 | |
| cd05762 | 98 | Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of | 82.6 | |
| PF02010 | 440 | REJ: REJ domain; InterPro: IPR002859 The REJ (Rece | 80.09 |
| >KOG4221|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=4.2e-73 Score=599.14 Aligned_cols=657 Identities=42% Similarity=0.718 Sum_probs=560.4
Q ss_pred CchhhhccceeeecCCCCCCCCCCccccccceeeecccCCCCCCcceeeccccCCCCCCcccEEEEEcCcEEEEEEcCCC
Q psy241 2 AGNIQASSLLAISDMDPSSSTPPNQYHLTSTTSMTASPLDTSTGSIEAINETLTLPSAPQSVSAIMVGPRSVALRWLPPT 81 (753)
Q Consensus 2 ~g~~~a~~~l~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~~P~~l~~~~~~~~si~lsW~~~~ 81 (753)
||++||+|+|.|.... +.......|.+|+++.+..+..++++++|.+|.
T Consensus 404 ~G~a~a~a~l~vv~~p-------------------------------~~~~s~~~~sap~~lv~~~~~srfi~~tw~~p~ 452 (1381)
T KOG4221|consen 404 AGSAQAAAQLEVVPQP-------------------------------ASASSDLLPSAPRDLVANLVSSRFIQLTWRPPA 452 (1381)
T ss_pred cccccchhhheeccCC-------------------------------cccccCccccCCcceecccccceeEEEeecCcc
Confidence 7999999999555441 112224558999999999999999999999999
Q ss_pred CCCCcceEEEEEEEEcCCCCceEEeeccccceE-eeCCcCCCEEEEEEEEEeCCCCccCCCceEEEccCCCCCCCCCcce
Q psy241 82 LPRGEILVYCVLYKREGSERERAYNATARVEAI-IQGLHPNTSYTFRVVAYNALGAGLASSALPVKTEPEDHVPSPPLNV 160 (753)
Q Consensus 82 ~~~~~~~~Y~v~~~~~~~~~~~~~~~~~~~~~~-i~~L~p~t~Y~~~V~a~~~~g~~~~s~~~~~~t~~~~~~P~~p~~l 160 (753)
..++.+..|.+.|...+..+++..+........ +.+|+|.+.|.|+|.|.|..|.+.++..+.+.+.++ +|..+
T Consensus 453 ~~~g~i~~~~v~~~~~~~~rer~~~tss~g~~~tv~nl~p~t~Y~~rv~A~n~~g~g~sS~pLkV~t~pE-----gp~~~ 527 (1381)
T KOG4221|consen 453 QISGNISTYTVFYKVEGDVRERLQNTSSPGIQVTVQNLSPLTMYFFRVRAKNEAGSGESSAPLKVTTQPE-----GPVQL 527 (1381)
T ss_pred ccCCCcceEEEEEecCCchhhhheeccCCceEEEeeecccceeEEEEEeccCcccCCccCCceEEecCCC-----CCccc
Confidence 888899999999999988888888877744777 999999999999999999999999999999998764 33338
Q ss_pred EEeeecCcEEEEEEeCCCCCCCcceEEEEEEEEcCCcceEEEeecccEEEEcCCCCCcEEEEEEEEEeCCCCCCCCceeE
Q psy241 161 NIPVVGTSSLLVTWEKPTVTNGEIKHYTLYYLEEDTSVERHVVTPQLSYELTGLSHFTLYSIWVVAHNGNGAGTTSQELS 240 (753)
Q Consensus 161 ~~~~~~~~sv~lsW~~p~~~~~~~~~Y~v~~~~~~~~~~~~~~~~~~~~~i~~L~p~t~Y~~~V~a~n~~g~~~~s~~~~ 240 (753)
++...+..++.+.|++|...|+++.+|++.|...+.+.+..+..+.++++|.||++.++|.|+|.|+|..|.|..|..+.
T Consensus 528 ~a~ats~~ti~v~WepP~~~n~~I~~yk~~ys~~~~~~~~~~~~n~~e~ti~gL~k~TeY~~~vvA~N~~G~g~sS~~i~ 607 (1381)
T KOG4221|consen 528 QAYATSPTTILVTWEPPPFGNGPITGYKLFYSEDDTGKELRVENNATEYTINGLEKYTEYSIRVVAYNSAGSGVSSADIT 607 (1381)
T ss_pred cccccCcceEEEEecCCCCCCCCceEEEEEEEcCCCCceEEEecCccEEEeecCCCccceEEEEEEecCCCCCCCCCceE
Confidence 88899999999999999999999999999999998889999999999999999999999999999999999999999999
Q ss_pred EEecCCCCCCCCCC---------cEEEEEeCCCCCCCCceeeEEEEEEEEcCccCCCCcEEEecCceeEEEEcCCCCCCe
Q psy241 241 VQTLSDKPSEPPAN---------SITVRWQPPSRRGQNGIITGYKLRYKKKDVKKDKGETVTTAGDRRLYVITGLNKSTT 311 (753)
Q Consensus 241 ~~t~~~~p~~~~~~---------si~l~W~~p~~~~~~~~~~~Y~v~~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~t~ 311 (753)
+.|..+.|+.||.+ +|+|+|.+|.....|+.+.+|+|+|+....... .....+.++.+.+.+.+|+|++.
T Consensus 608 V~Tlsd~PsaPP~Nl~lev~sStsVrVsW~pP~~~t~ng~itgYkIRy~~~~~~~~-~~~t~v~~n~~~~l~~~Lep~T~ 686 (1381)
T KOG4221|consen 608 VRTLSDVPSAPPQNLSLEVVSSTSVRVSWLPPPSETQNGQITGYKIRYRKLSREDE-VNETVVKGNTTQYLFNGLEPNTQ 686 (1381)
T ss_pred EEeccCCCCCCCcceEEEecCCCeEEEEccCCCcccccceEEEEEEEecccCcccc-cceeecccchhhhHhhcCCCCce
Confidence 99999999999996 999999999999999999999999997654333 22333555888999999999999
Q ss_pred EEEEEEEEeCCCCCCCCcceeeeeeeccCCCcccCCCCcceeeecCCCCeEEEEEeCCCCCCcceeEEEEEEeeC--CCC
Q psy241 312 YQIKLWAMNVNGSGPATDWFSAETFSQDLGEFTVPDIPASLKARPGGPSSIIVSWTPPADQSIMVRGFTLGWGKG--VPD 389 (753)
Q Consensus 312 Y~i~V~a~~~~g~~~~s~~~~~~t~~~~~~~~~~p~~p~~~~~~~~~~~~v~l~W~~~~~~~~~i~~Y~v~~~~~--~~~ 389 (753)
|.|+|.|++..|.|++|+|..+.|+..+.++ .+|.+|..|.+.... +++.|+|.|+...+..+.+|.|.|... ..+
T Consensus 687 Y~vrIsa~t~nGtGpaS~w~~aeT~~~d~~e-~vp~~ps~l~~~~g~-~si~vsW~Pp~~~~~~vrgY~ig~r~g~~~p~ 764 (1381)
T KOG4221|consen 687 YRVRISAMTVNGTGPASEWVSAETPESDLDE-RVPGKPSELHVHPGS-NSIVVSWTPPPHPNIVVRGYKIGYRPGSGIPD 764 (1381)
T ss_pred EEEEEEEeccCCCCCcccceeccCccccccc-cCCCCCceeeeccCc-eeEEEEeCCCCChhhhhcceEEeeecccCCCC
Confidence 9999999999999999999999999988887 678888888877777 999999999999888999999999543 343
Q ss_pred ccEEEEecCcccEEEeCCCCCCCeEEEEEEEEcCCCCCCCceeEEEecCCCCC--CCCCCCCCCceeEEEecCCCeEEEE
Q psy241 390 EFVKQILDVKQRSDEITGLEPNSDYVISLRAFNEMGDGPQKYESLRTRNEPPP--QAPKVLIPPMGLKSEVLSPYSMRIS 467 (753)
Q Consensus 390 ~~~~~~~~~~~~~~~i~~L~p~~~Y~v~V~a~~~~G~~~~s~~~~~t~~~~~p--~~~~p~~~p~~l~~~~~~~~sv~v~ 467 (753)
... +.++.....+.|..|.++..|.|+++|+|..|+|.+......+.....+ ....|+.+|..+++...+.++|.|.
T Consensus 765 ~~t-Irl~~~~s~y~l~~Le~~~~YvVkL~AfNn~gdG~p~y~~~~tR~~~~~~~~v~tp~~ppvgv~A~~~S~tsI~v~ 843 (1381)
T KOG4221|consen 765 TGT-IRLDEKVSYYNLEQLEPNRDYVVKLRAFNNHGDGNPIYESVKTRSATDPTSPVDTPMLPPVGVRANALSSTSIRVT 843 (1381)
T ss_pred Ccc-EEecceeeEEEEEecccCceEEEEEEEeccCCCCcceeeeeeeccCCCcCCcCCCCCCCcccccccccccceEEEE
Confidence 444 8899999999999999999999999999999999999888887753322 2235788999999999999999999
Q ss_pred EeCCCCCcccccCCCCccEEEEEEEeecCCCCCceEEeccccceEEecCcccCceeEEEEEEEe-CCCCCcceEEEEeee
Q psy241 468 WIDTTLPDQFQQHGEEGRHYLVRYTHLLGASNPRYKYINANITSVQINDLRPSTQYEFTVKVVR-AKKESEWSMIVLNTT 546 (753)
Q Consensus 468 W~~p~~~~~~~~~~~~~~~Y~v~~~~~~~~~~~~~~~~~~~~~~~~l~~L~p~t~Y~~~V~a~~-~~g~s~~s~~~~~~t 546 (753)
|.... ++ ......|.|+|...+-.+.......+.++.++.+.+|+|++.|+|.|.++. +...+.|++.+..+|
T Consensus 844 w~~~~-----~~-t~~~~~yTVr~~~~gi~~~~~~~~~~~t~ls~~v~glkpnt~yEfav~~~~~~~r~stwsmsv~~~t 917 (1381)
T KOG4221|consen 844 WADNK-----DQ-TTDNRIYTVRWSLTGIRNGTLYRYDNSTDLSYLVGGLKPNTPYEFAVMVVKRNRRESTWSMSVENRT 917 (1381)
T ss_pred EecCC-----Cc-cccceEEEEEEeecccccceeEEEecccccceeccCcCcCChhhhhhhhhhccCcCCcccceeeeee
Confidence 99731 12 346679999998554335666667888999999999999999999999987 677899999999999
Q ss_pred cCCCCCCCCcceEEeecCCCCeeEEEEeeCCCCCCCceeEEEEEEEeCCCC--CceEEEEeeCceeEEEEcCCCCCCEEE
Q psy241 547 QEAAPASAPRDLTVVSKEGDPSLVNLNWQPPKSANGQISGYTILYSSDPNT--DQWIEESVVGDKMSTNVRGLEPGRIYY 624 (753)
Q Consensus 547 ~~~~p~~~P~~l~~~~~~~~~~~v~l~W~~p~~~~g~i~~Y~V~~~~~~~~--~~~~~~~~~~~~~~~~l~~L~p~t~Y~ 624 (753)
.+.+|..||+++.+.... ..+++.+.|.+|...||.|++|.|+|..+... .+|....+.++...+.+.+|.+++.|.
T Consensus 918 le~~P~sPP~d~tv~p~e-~P~~v~v~WqPp~e~nG~I~~Yii~Ys~~~n~~~~dWt~~t~~g~~L~~~v~~l~p~t~yf 996 (1381)
T KOG4221|consen 918 LELVPSSPPRDLTVQPDE-KPTTVIVHWQPPTEPNGEITEYIIYYSTDGNTPEHDWTIETTAGAELSHQVPNLDPDTGYF 996 (1381)
T ss_pred cccCCCCCChhceecccC-CCCccccccCCCcCCCCceeeEEEEEecCCCCchhhceeeecccchhhhccCCCCCCCceE
Confidence 999999999999999865 67999999999999999999999999887665 789888999999999999999999999
Q ss_pred EEEEEEcCCCCCCCCCceEEEcCCCC----------------CCCC--CCC----------------C--CCCcc-eeEE
Q psy241 625 FKIKARNSAGSSPYSSTVTWTTASDM----------------QEAG--GIP----------------N--SNQVS-NTMI 667 (753)
Q Consensus 625 ~~V~A~~~~G~g~~S~~~~~~T~~~~----------------~~~~--~~~----------------~--~~~i~-~~il 667 (753)
|+|+|++..|.|++|..+.++|.... ++.. .++ . .+.|. +.++
T Consensus 997 fkiQAr~~kG~gp~s~~v~y~t~~~~~~~~~d~~~~~gt~~~~p~~~~~~~~~~~~~~~~~~ll~i~l~~~~vi~i~~~~ 1076 (1381)
T KOG4221|consen 997 FKIQARNEKGPGPFSSPVLYETSKAEIVMINDQEAERGTGKEPPELFYQFAHGSETNLVDSNLLDIILVAVAVILILVLL 1076 (1381)
T ss_pred EEEEeeccCCCCccccceeeeccccccccccchhhccccCCCCCcccccccccccccccccceeeeeeehhhhHHHHHHh
Confidence 99999999999999999999998752 0000 111 0 11111 2222
Q ss_pred EEEEEe---------------cCCcccCCCCCCCCCCcccccchhcccccccc
Q psy241 668 LYVKGN---------------TGGKQQAPATQINPPDLWIHHDQMELKAIEKS 705 (753)
Q Consensus 668 ~~~~~c---------------~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~ 705 (753)
+++++| ++|+++.-.+..+|+|+|||+++||+|+.+|.
T Consensus 1077 ~v~v~C~~r~~~~~~~~r~~~~~~~~~g~s~~~~ppDLwI~~~~~elkn~~k~ 1129 (1381)
T KOG4221|consen 1077 LVLVTCRRRSGSNRKKKRASIKKGKPKGISGDFKPPDLWIHHERMELKNIEKP 1129 (1381)
T ss_pred hheeEEeccccCCcCccceeeeccCCCCCcCCCCCCccccccchhhcCCCCCC
Confidence 233455 34555555667889999999999999998887
|
|
| >KOG4221|consensus | Back alignment and domain information |
|---|
| >KOG3513|consensus | Back alignment and domain information |
|---|
| >KOG3513|consensus | Back alignment and domain information |
|---|
| >KOG4222|consensus | Back alignment and domain information |
|---|
| >KOG0196|consensus | Back alignment and domain information |
|---|
| >KOG0196|consensus | Back alignment and domain information |
|---|
| >KOG4222|consensus | Back alignment and domain information |
|---|
| >KOG4258|consensus | Back alignment and domain information |
|---|
| >KOG4258|consensus | Back alignment and domain information |
|---|
| >PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] | Back alignment and domain information |
|---|
| >PF00041 fn3: Fibronectin type III domain; InterPro: IPR003961 Fibronectins are multi-domain glycoproteins found in a soluble form in plasma, and in an insoluble form in loose connective tissue and basement membranes [] | Back alignment and domain information |
|---|
| >KOG4802|consensus | Back alignment and domain information |
|---|
| >cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi | Back alignment and domain information |
|---|
| >cd00063 FN3 Fibronectin type 3 domain; One of three types of internal repeats found in the plasma protein fibronectin | Back alignment and domain information |
|---|
| >COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >PF10179 DUF2369: Uncharacterised conserved protein (DUF2369); InterPro: IPR019326 This is a proline-rich region of a group of proteins found from plants to fungi | Back alignment and domain information |
|---|
| >KOG4802|consensus | Back alignment and domain information |
|---|
| >COG3401 Fibronectin type 3 domain-containing protein [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >smart00060 FN3 Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >smart00060 FN3 Fibronectin type 3 domain | Back alignment and domain information |
|---|
| >KOG3632|consensus | Back alignment and domain information |
|---|
| >KOG4152|consensus | Back alignment and domain information |
|---|
| >KOG0613|consensus | Back alignment and domain information |
|---|
| >KOG4367|consensus | Back alignment and domain information |
|---|
| >KOG4152|consensus | Back alignment and domain information |
|---|
| >KOG0613|consensus | Back alignment and domain information |
|---|
| >PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology | Back alignment and domain information |
|---|
| >PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R | Back alignment and domain information |
|---|
| >TIGR00864 PCC polycystin cation channel protein | Back alignment and domain information |
|---|
| >PF01108 Tissue_fac: Tissue factor; PDB: 3OG4_B 3OG6_B 1FYH_E 1FG9_D 1JRH_I 3DGC_R 3DLQ_R 1LQS_R 1Y6M_R 1J7V_R | Back alignment and domain information |
|---|
| >PF06583 Neogenin_C: Neogenin C-terminus; InterPro: IPR010560 This entry represents the C terminus of eukaryotic neogenin precursor proteins, which contains several potential phosphorylation sites [] | Back alignment and domain information |
|---|
| >PF09294 Interfer-bind: Interferon-alpha/beta receptor, fibronectin type III; InterPro: IPR015373 Members of this family adopt a secondary structure consisting of seven beta-strands arranged in an immunoglobulin-like beta-sandwich, in a Greek-key topology | Back alignment and domain information |
|---|
| >KOG4367|consensus | Back alignment and domain information |
|---|
| >TIGR00864 PCC polycystin cation channel protein | Back alignment and domain information |
|---|
| >KOG4806|consensus | Back alignment and domain information |
|---|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >KOG4806|consensus | Back alignment and domain information |
|---|
| >KOG4228|consensus | Back alignment and domain information |
|---|
| >PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors | Back alignment and domain information |
|---|
| >COG4733 Phage-related protein, tail component [Function unknown] | Back alignment and domain information |
|---|
| >PF09067 EpoR_lig-bind: Erythropoietin receptor, ligand binding; InterPro: IPR015152 Members of this entry include the growth hormone and erythropoietin receptors | Back alignment and domain information |
|---|
| >PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators | Back alignment and domain information |
|---|
| >TIGR00868 hCaCC calcium-activated chloride channel protein 1 | Back alignment and domain information |
|---|
| >COG4733 Phage-related protein, tail component [Function unknown] | Back alignment and domain information |
|---|
| >PLN02533 probable purple acid phosphatase | Back alignment and domain information |
|---|
| >PF09240 IL6Ra-bind: Interleukin-6 receptor alpha chain, binding; InterPro: IPR015321 Members of this entry adopt a structure consisting of an immunoglobulin-like beta-sandwich, with seven strands in two beta-sheets, in a Greek-key topology | Back alignment and domain information |
|---|
| >PLN02533 probable purple acid phosphatase | Back alignment and domain information |
|---|
| >TIGR00868 hCaCC calcium-activated chloride channel protein 1 | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >PF09240 IL6Ra-bind: Interleukin-6 receptor alpha chain, binding; InterPro: IPR015321 Members of this entry adopt a structure consisting of an immunoglobulin-like beta-sandwich, with seven strands in two beta-sheets, in a Greek-key topology | Back alignment and domain information |
|---|
| >KOG1225|consensus | Back alignment and domain information |
|---|
| >PF07495 Y_Y_Y: Y_Y_Y domain; InterPro: IPR011123 This region is mostly found at the end of the beta propellers (IPR011110 from INTERPRO) in a family of two component regulators | Back alignment and domain information |
|---|
| >cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) | Back alignment and domain information |
|---|
| >cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) | Back alignment and domain information |
|---|
| >PF02010 REJ: REJ domain; InterPro: IPR002859 The REJ (Receptor for Egg Jelly) domain is found in PKD1 P98161 from SWISSPROT and the sperm receptor for egg jelly Q26627 from SWISSPROT | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 753 | ||||
| 3p4l_A | 211 | Crystal Structure Of A Hemojuvelin-Binding Fragment | 9e-41 | ||
| 1x5i_A | 126 | The Solution Structure Of The Fourth Fibronectin Ty | 2e-26 | ||
| 1x5h_A | 132 | The Solution Structure Of The Third Fibronectin Typ | 1e-21 | ||
| 1x5h_A | 132 | The Solution Structure Of The Third Fibronectin Typ | 4e-06 | ||
| 1x5k_A | 124 | The Solution Structure Of The Sixth Fibronectin Typ | 2e-21 | ||
| 2ede_A | 114 | Solution Structure Of The Sixth Fibronectin Type Ii | 5e-20 | ||
| 2edb_A | 116 | Solution Structure Of The Fourth Fibronectin Type I | 7e-17 | ||
| 1x5g_A | 116 | The Solution Structure Of The Second Fibronectin Ty | 1e-16 | ||
| 2ed9_A | 124 | Solution Structure Of The Third Fibronectin Type Ii | 6e-16 | ||
| 2ed7_A | 119 | Solution Structure Of The First Fibronectin Type Ii | 9e-14 | ||
| 2ed7_A | 119 | Solution Structure Of The First Fibronectin Type Ii | 1e-04 | ||
| 1x5j_A | 113 | The Solution Structure Of The Fifth Fibronectin Typ | 3e-13 | ||
| 2ed8_A | 106 | Solution Structure Of The Second Fibronectin Type I | 3e-11 | ||
| 2edd_A | 123 | Solution Structure Of The Fifth Fibronectin Type Ii | 6e-11 | ||
| 1x5f_A | 120 | The Solution Structure Of The First Fibronectin Typ | 8e-11 | ||
| 1fnf_A | 368 | Fragment Of Human Fibronectin Encompassing Type-Iii | 5e-10 | ||
| 2dlh_A | 121 | Solution Structure Of The Second Fn3 Domain Of Huma | 1e-09 | ||
| 3f7p_C | 248 | Crystal Structure Of A Complex Between Integrin Bet | 2e-09 | ||
| 3f7p_C | 248 | Crystal Structure Of A Complex Between Integrin Bet | 4e-07 | ||
| 3f7r_A | 249 | First Pair Of Fibronectin Type Iii Domains And Part | 2e-09 | ||
| 3f7r_A | 249 | First Pair Of Fibronectin Type Iii Domains And Part | 4e-07 | ||
| 3f7q_A | 234 | First Pair Of Fibronectin Type Iii Domains And Part | 4e-09 | ||
| 3f7q_A | 234 | First Pair Of Fibronectin Type Iii Domains And Part | 5e-07 | ||
| 1qg3_A | 195 | Crystal Structure Of A Tandem Pair Of Fibronectin T | 7e-09 | ||
| 1qg3_A | 195 | Crystal Structure Of A Tandem Pair Of Fibronectin T | 5e-07 | ||
| 1mfn_A | 184 | Solution Nmr Structure Of Linked Cell Attachment Mo | 1e-07 | ||
| 2edx_A | 134 | Solution Structures Of The Fn3 Domain Of Human Rece | 3e-07 | ||
| 3t1w_A | 375 | Structure Of The Four-Domain Fragment Fn7b89 Of Onc | 3e-07 | ||
| 1fnh_A | 271 | Crystal Structure Of Heparin And Integrin Binding S | 3e-06 | ||
| 1fnh_A | 271 | Crystal Structure Of Heparin And Integrin Binding S | 4e-04 | ||
| 3r8q_A | 290 | Structure Of Fibronectin Domain 12-14 Length = 290 | 4e-06 | ||
| 3r8q_A | 290 | Structure Of Fibronectin Domain 12-14 Length = 290 | 4e-04 | ||
| 1va9_A | 122 | Solution Structure Of The Second Fniii Domain Of Ds | 1e-05 | ||
| 1va9_A | 122 | Solution Structure Of The Second Fniii Domain Of Ds | 4e-05 | ||
| 4gh7_B | 285 | Crystal Structure Of Anticalin N7a In Complex With | 4e-05 | ||
| 1tdq_A | 283 | Structural Basis For The Interactions Between Tenas | 4e-05 | ||
| 2gee_A | 203 | Crystal Structure Of Human Type Iii Fibronectin Ext | 6e-05 | ||
| 2jll_A | 389 | Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 | 1e-04 | ||
| 1x5l_A | 111 | Solution Structure Of The Second Fn3 Domain Of Eph | 1e-04 | ||
| 3lpw_A | 197 | Crystal Structure Of The Fniii-Tandem A77-A78 From | 1e-04 | ||
| 1x5z_A | 115 | Solution Structure Of The Fibronectin Type-Iii Doma | 2e-04 | ||
| 2x11_A | 545 | Crystal Structure Of The Complete Epha2 Ectodomain | 2e-04 | ||
| 3fl7_A | 536 | Crystal Structure Of The Human Ephrin A2 Ectodomain | 2e-04 | ||
| 2x10_A | 545 | Crystal Structure Of The Complete Epha2 Ectodomain | 3e-04 | ||
| 1ttf_A | 94 | The Three-Dimensional Structure Of The Tenth Type I | 6e-04 |
| >pdb|3P4L|A Chain A, Crystal Structure Of A Hemojuvelin-Binding Fragment Of Neogenin Length = 211 | Back alignment and structure |
|
| >pdb|1X5I|A Chain A, The Solution Structure Of The Fourth Fibronectin Type Iii Domain Of Human Neogenin Length = 126 | Back alignment and structure |
| >pdb|1X5H|A Chain A, The Solution Structure Of The Third Fibronectin Type Iii Domain Of Human Neogenin Length = 132 | Back alignment and structure |
| >pdb|1X5H|A Chain A, The Solution Structure Of The Third Fibronectin Type Iii Domain Of Human Neogenin Length = 132 | Back alignment and structure |
| >pdb|1X5K|A Chain A, The Solution Structure Of The Sixth Fibronectin Type Iii Domain Of Human Neogenin Length = 124 | Back alignment and structure |
| >pdb|2EDE|A Chain A, Solution Structure Of The Sixth Fibronectin Type Iii Domain Of Human Netrin Receptor Dcc Length = 114 | Back alignment and structure |
| >pdb|2EDB|A Chain A, Solution Structure Of The Fourth Fibronectin Type Iii Domain Of Human Netrin Receptor Dcc Length = 116 | Back alignment and structure |
| >pdb|1X5G|A Chain A, The Solution Structure Of The Second Fibronectin Type Iii Domain Of Human Neogenin Length = 116 | Back alignment and structure |
| >pdb|2ED9|A Chain A, Solution Structure Of The Third Fibronectin Type Iii Domain Of Human Netrin Receptor Dcc Length = 124 | Back alignment and structure |
| >pdb|2ED7|A Chain A, Solution Structure Of The First Fibronectin Type Iii Domain Of Human Netrin Receptor Dcc Length = 119 | Back alignment and structure |
| >pdb|2ED7|A Chain A, Solution Structure Of The First Fibronectin Type Iii Domain Of Human Netrin Receptor Dcc Length = 119 | Back alignment and structure |
| >pdb|1X5J|A Chain A, The Solution Structure Of The Fifth Fibronectin Type Iii Domain Of Human Neogenin Length = 113 | Back alignment and structure |
| >pdb|2ED8|A Chain A, Solution Structure Of The Second Fibronectin Type Iii Domain Of Human Netrin Receptor Dcc Length = 106 | Back alignment and structure |
| >pdb|2EDD|A Chain A, Solution Structure Of The Fifth Fibronectin Type Iii Domain Of Human Netrin Receptor Dcc Length = 123 | Back alignment and structure |
| >pdb|1X5F|A Chain A, The Solution Structure Of The First Fibronectin Type Iii Domain Of Human Neogenin Length = 120 | Back alignment and structure |
| >pdb|1FNF|A Chain A, Fragment Of Human Fibronectin Encompassing Type-Iii Repeats 7 Through 10 Length = 368 | Back alignment and structure |
| >pdb|2DLH|A Chain A, Solution Structure Of The Second Fn3 Domain Of Human Receptor-Type Tyrosine-Protein Phosphatase Delta Length = 121 | Back alignment and structure |
| >pdb|3F7P|C Chain C, Crystal Structure Of A Complex Between Integrin Beta4 And Plectin Length = 248 | Back alignment and structure |
| >pdb|3F7P|C Chain C, Crystal Structure Of A Complex Between Integrin Beta4 And Plectin Length = 248 | Back alignment and structure |
| >pdb|3F7R|A Chain A, First Pair Of Fibronectin Type Iii Domains And Part Of The Connecting Segment Of The Integrin Beta4 Length = 249 | Back alignment and structure |
| >pdb|3F7R|A Chain A, First Pair Of Fibronectin Type Iii Domains And Part Of The Connecting Segment Of The Integrin Beta4 Length = 249 | Back alignment and structure |
| >pdb|3F7Q|A Chain A, First Pair Of Fibronectin Type Iii Domains And Part Of The Connecting Segment Of The Integrin Beta4 Length = 234 | Back alignment and structure |
| >pdb|3F7Q|A Chain A, First Pair Of Fibronectin Type Iii Domains And Part Of The Connecting Segment Of The Integrin Beta4 Length = 234 | Back alignment and structure |
| >pdb|1QG3|A Chain A, Crystal Structure Of A Tandem Pair Of Fibronectin Type Iii Domains From The Cytoplasmic Tail Of Integrin Alpha6 Beta4 Length = 195 | Back alignment and structure |
| >pdb|1QG3|A Chain A, Crystal Structure Of A Tandem Pair Of Fibronectin Type Iii Domains From The Cytoplasmic Tail Of Integrin Alpha6 Beta4 Length = 195 | Back alignment and structure |
| >pdb|1MFN|A Chain A, Solution Nmr Structure Of Linked Cell Attachment Modules Of Mouse Fibronectin Containing The Rgd And Synergy Regions, 20 Structures Length = 184 | Back alignment and structure |
| >pdb|2EDX|A Chain A, Solution Structures Of The Fn3 Domain Of Human Receptor- Type Tyrosine-Protein Phosphatase F Length = 134 | Back alignment and structure |
| >pdb|3T1W|A Chain A, Structure Of The Four-Domain Fragment Fn7b89 Of Oncofetal Fibronectin Length = 375 | Back alignment and structure |
| >pdb|1FNH|A Chain A, Crystal Structure Of Heparin And Integrin Binding Segment Of Human Fibronectin Length = 271 | Back alignment and structure |
| >pdb|1FNH|A Chain A, Crystal Structure Of Heparin And Integrin Binding Segment Of Human Fibronectin Length = 271 | Back alignment and structure |
| >pdb|3R8Q|A Chain A, Structure Of Fibronectin Domain 12-14 Length = 290 | Back alignment and structure |
| >pdb|3R8Q|A Chain A, Structure Of Fibronectin Domain 12-14 Length = 290 | Back alignment and structure |
| >pdb|1VA9|A Chain A, Solution Structure Of The Second Fniii Domain Of Dscaml1 Protein Length = 122 | Back alignment and structure |
| >pdb|1VA9|A Chain A, Solution Structure Of The Second Fniii Domain Of Dscaml1 Protein Length = 122 | Back alignment and structure |
| >pdb|4GH7|B Chain B, Crystal Structure Of Anticalin N7a In Complex With Oncofetal Fibronectin Fragment Fn7b8 Length = 285 | Back alignment and structure |
| >pdb|1TDQ|A Chain A, Structural Basis For The Interactions Between Tenascins And The C-Type Lectin Domains From Lecticans: Evidence For A Cross-Linking Role For Tenascins Length = 283 | Back alignment and structure |
| >pdb|2GEE|A Chain A, Crystal Structure Of Human Type Iii Fibronectin Extradomain B And Domain 8 Length = 203 | Back alignment and structure |
| >pdb|2JLL|A Chain A, Crystal Structure Of Ncam2 Igiv-Fn3ii Length = 389 | Back alignment and structure |
| >pdb|1X5L|A Chain A, Solution Structure Of The Second Fn3 Domain Of Eph Receptor A8 Protein Length = 111 | Back alignment and structure |
| >pdb|3LPW|A Chain A, Crystal Structure Of The Fniii-Tandem A77-A78 From The A-Band Of Titin Length = 197 | Back alignment and structure |
| >pdb|1X5Z|A Chain A, Solution Structure Of The Fibronectin Type-Iii Domain Of Human Protein Tyrosine Phosphatase, Receptor Type, D Isoform 4 Variant Length = 115 | Back alignment and structure |
| >pdb|2X11|A Chain A, Crystal Structure Of The Complete Epha2 Ectodomain In Complex With Ephrin A5 Receptor Binding Domain Length = 545 | Back alignment and structure |
| >pdb|3FL7|A Chain A, Crystal Structure Of The Human Ephrin A2 Ectodomain Length = 536 | Back alignment and structure |
| >pdb|2X10|A Chain A, Crystal Structure Of The Complete Epha2 Ectodomain Length = 545 | Back alignment and structure |
| >pdb|1TTF|A Chain A, The Three-Dimensional Structure Of The Tenth Type Iii Module Of Fibronectin: An Insight Into Rgd-Mediated Interactions Length = 94 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 753 | |||
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 5e-72 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 9e-68 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 3e-45 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 1e-11 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 1e-67 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 5e-62 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 9e-55 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 4e-50 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 8e-25 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 3e-11 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 1e-63 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 3e-62 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 6e-61 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 1e-45 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 8e-11 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 1e-61 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 1e-60 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 6e-50 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 2e-41 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 1e-25 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 1e-59 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 1e-50 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 2e-43 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 9e-41 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 2e-22 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 1e-58 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 5e-49 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 2e-48 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 4e-35 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 1e-26 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 4e-23 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 5e-23 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 1e-11 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 2e-52 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 8e-52 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 9e-39 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 9e-27 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 5e-16 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 3e-12 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 3e-52 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 7e-33 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 1e-32 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 1e-51 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 6e-40 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 1e-25 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 3e-13 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 2e-49 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 2e-41 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 3e-38 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 5e-29 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 2e-24 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 7e-16 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 2e-14 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 4e-44 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 3e-41 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 6e-38 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 4e-31 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 3e-24 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 1e-20 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 2e-17 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 2e-40 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 2e-34 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 4e-27 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 7e-25 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 3e-12 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 1e-38 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 4e-35 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 8e-26 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 5e-25 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 2e-19 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 4e-17 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 4e-37 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 4e-34 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 3e-24 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 3e-23 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 7e-19 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 1e-36 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 4e-34 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 9e-28 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 1e-20 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 2e-14 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 7e-36 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 2e-31 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 6e-30 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 5e-27 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 8e-18 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 7e-33 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 3e-29 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 2e-26 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 5e-25 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 1e-13 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 8e-32 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 1e-29 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 7e-24 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 9e-32 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 9e-28 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 8e-25 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 3e-20 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 1e-12 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 1e-31 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 4e-29 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 2e-28 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 7e-28 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 1e-21 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 1e-13 | |
| 2ede_A | 114 | Netrin receptor DCC; tumor suppressor protein DCC, | 1e-30 | |
| 2ede_A | 114 | Netrin receptor DCC; tumor suppressor protein DCC, | 7e-18 | |
| 2ede_A | 114 | Netrin receptor DCC; tumor suppressor protein DCC, | 3e-17 | |
| 2ede_A | 114 | Netrin receptor DCC; tumor suppressor protein DCC, | 4e-17 | |
| 2ede_A | 114 | Netrin receptor DCC; tumor suppressor protein DCC, | 2e-11 | |
| 2ede_A | 114 | Netrin receptor DCC; tumor suppressor protein DCC, | 5e-07 | |
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 2e-29 | |
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 8e-21 | |
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 2e-17 | |
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 1e-16 | |
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 2e-15 | |
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 3e-08 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 2e-29 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 6e-26 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 4e-22 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 3e-18 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 1e-13 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 3e-12 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 7e-29 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 2e-22 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 5e-22 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 2e-19 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 2e-15 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 5e-10 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 9e-29 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 2e-25 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 3e-25 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 5e-23 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 6e-19 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 4e-16 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 1e-28 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 5e-23 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 3e-22 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 1e-16 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 9e-15 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 8e-08 | |
| 3s98_A | 306 | Interferon alpha/beta receptor 1; human, type I in | 7e-28 | |
| 3s98_A | 306 | Interferon alpha/beta receptor 1; human, type I in | 2e-21 | |
| 3s98_A | 306 | Interferon alpha/beta receptor 1; human, type I in | 9e-19 | |
| 3s98_A | 306 | Interferon alpha/beta receptor 1; human, type I in | 7e-14 | |
| 3s98_A | 306 | Interferon alpha/beta receptor 1; human, type I in | 8e-06 | |
| 1x5h_A | 132 | Neogenin; RGM binding, fibronectin type III domain | 1e-27 | |
| 1x5h_A | 132 | Neogenin; RGM binding, fibronectin type III domain | 3e-24 | |
| 1x5h_A | 132 | Neogenin; RGM binding, fibronectin type III domain | 9e-23 | |
| 1x5h_A | 132 | Neogenin; RGM binding, fibronectin type III domain | 3e-18 | |
| 1x5h_A | 132 | Neogenin; RGM binding, fibronectin type III domain | 2e-15 | |
| 1x5h_A | 132 | Neogenin; RGM binding, fibronectin type III domain | 2e-10 | |
| 2gys_A | 419 | Cytokine receptor common beta chain; dimer of inte | 4e-27 | |
| 2gys_A | 419 | Cytokine receptor common beta chain; dimer of inte | 1e-21 | |
| 2gys_A | 419 | Cytokine receptor common beta chain; dimer of inte | 3e-21 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 1e-26 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 2e-23 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 3e-21 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 2e-19 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 3e-12 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 1e-07 | |
| 2dm4_A | 108 | Sortilin-related receptor; beta-sandwich, sorting | 4e-26 | |
| 2dm4_A | 108 | Sortilin-related receptor; beta-sandwich, sorting | 7e-19 | |
| 2dm4_A | 108 | Sortilin-related receptor; beta-sandwich, sorting | 4e-18 | |
| 2dm4_A | 108 | Sortilin-related receptor; beta-sandwich, sorting | 1e-13 | |
| 2dm4_A | 108 | Sortilin-related receptor; beta-sandwich, sorting | 2e-10 | |
| 2dm4_A | 108 | Sortilin-related receptor; beta-sandwich, sorting | 4e-06 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 4e-26 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 1e-20 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 4e-18 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 6e-15 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 7e-13 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 8e-11 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 7e-05 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 6e-26 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 5e-22 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 2e-20 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 6e-15 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 2e-12 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 3e-09 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 6e-26 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 1e-23 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 8e-23 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 1e-20 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 3e-14 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 1e-11 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 8e-26 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 4e-24 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 2e-23 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 5e-23 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 2e-20 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 1e-12 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 5e-09 | |
| 3lb6_C | 380 | IL-13, interleukin-13 receptor subunit alpha-2; cy | 8e-26 | |
| 3lb6_C | 380 | IL-13, interleukin-13 receptor subunit alpha-2; cy | 1e-21 | |
| 3lb6_C | 380 | IL-13, interleukin-13 receptor subunit alpha-2; cy | 1e-19 | |
| 3lb6_C | 380 | IL-13, interleukin-13 receptor subunit alpha-2; cy | 3e-14 | |
| 3lb6_C | 380 | IL-13, interleukin-13 receptor subunit alpha-2; cy | 3e-09 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 7e-25 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 3e-21 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 3e-20 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 3e-17 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 1e-11 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 4e-08 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 8e-25 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 2e-20 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 1e-19 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 2e-19 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 7e-14 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 7e-08 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 1e-24 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 1e-22 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 1e-19 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 3e-18 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 6e-12 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 9e-08 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 1e-24 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 6e-19 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 5e-18 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 4e-17 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 2e-15 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 4e-06 | |
| 2edx_A | 134 | Protein tyrosine phosphatase, receptor type, F; LA | 1e-24 | |
| 2edx_A | 134 | Protein tyrosine phosphatase, receptor type, F; LA | 3e-24 | |
| 2edx_A | 134 | Protein tyrosine phosphatase, receptor type, F; LA | 6e-21 | |
| 2edx_A | 134 | Protein tyrosine phosphatase, receptor type, F; LA | 4e-18 | |
| 2edx_A | 134 | Protein tyrosine phosphatase, receptor type, F; LA | 3e-13 | |
| 2edx_A | 134 | Protein tyrosine phosphatase, receptor type, F; LA | 6e-13 | |
| 1va9_A | 122 | DOWN syndrome cell adhesion molecule like- protein | 9e-24 | |
| 1va9_A | 122 | DOWN syndrome cell adhesion molecule like- protein | 1e-20 | |
| 1va9_A | 122 | DOWN syndrome cell adhesion molecule like- protein | 4e-20 | |
| 1va9_A | 122 | DOWN syndrome cell adhesion molecule like- protein | 5e-16 | |
| 1va9_A | 122 | DOWN syndrome cell adhesion molecule like- protein | 2e-11 | |
| 1va9_A | 122 | DOWN syndrome cell adhesion molecule like- protein | 1e-10 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 9e-24 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 1e-18 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 6e-10 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 3e-05 | |
| 2q7n_A | 488 | Leukemia inhibitory factor receptor; cytokine cell | 1e-23 | |
| 2q7n_A | 488 | Leukemia inhibitory factor receptor; cytokine cell | 1e-18 | |
| 2q7n_A | 488 | Leukemia inhibitory factor receptor; cytokine cell | 9e-17 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 1e-23 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 3e-19 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 6e-19 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 6e-17 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 1e-13 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 9e-09 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 1e-23 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 4e-16 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 1e-13 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 1e-10 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 3e-06 | |
| 1x4y_A | 114 | Biregional cell adhesion molecule-related/DOWN- re | 2e-23 | |
| 1x4y_A | 114 | Biregional cell adhesion molecule-related/DOWN- re | 7e-19 | |
| 1x4y_A | 114 | Biregional cell adhesion molecule-related/DOWN- re | 1e-18 | |
| 1x4y_A | 114 | Biregional cell adhesion molecule-related/DOWN- re | 4e-17 | |
| 1x4y_A | 114 | Biregional cell adhesion molecule-related/DOWN- re | 2e-11 | |
| 1x4y_A | 114 | Biregional cell adhesion molecule-related/DOWN- re | 5e-11 | |
| 2dbj_A | 124 | Proto-oncogene tyrosine-protein kinase MER precurs | 3e-23 | |
| 2dbj_A | 124 | Proto-oncogene tyrosine-protein kinase MER precurs | 3e-21 | |
| 2dbj_A | 124 | Proto-oncogene tyrosine-protein kinase MER precurs | 4e-17 | |
| 2dbj_A | 124 | Proto-oncogene tyrosine-protein kinase MER precurs | 7e-14 | |
| 2dbj_A | 124 | Proto-oncogene tyrosine-protein kinase MER precurs | 5e-09 | |
| 2dbj_A | 124 | Proto-oncogene tyrosine-protein kinase MER precurs | 6e-06 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 6e-23 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 2e-22 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 6e-22 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 5e-19 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 3e-15 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 9e-08 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 2e-22 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 4e-16 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 8e-16 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 3e-15 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 2e-11 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 1e-10 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 3e-22 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 5e-17 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 3e-15 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 5e-15 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 4e-11 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 4e-10 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 4e-22 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 7e-22 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 3e-21 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 6e-19 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 3e-10 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 2e-07 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 5e-22 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 1e-21 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 2e-19 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 3e-19 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 3e-12 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 1e-07 | |
| 1uen_A | 125 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 6e-22 | |
| 1uen_A | 125 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 4e-20 | |
| 1uen_A | 125 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 2e-18 | |
| 1uen_A | 125 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 2e-16 | |
| 1uen_A | 125 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 6e-10 | |
| 1uen_A | 125 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 4e-07 | |
| 3lqm_A | 201 | Interleukin-10 receptor subunit beta; IL-10R2, com | 3e-21 | |
| 3lqm_A | 201 | Interleukin-10 receptor subunit beta; IL-10R2, com | 7e-18 | |
| 3lqm_A | 201 | Interleukin-10 receptor subunit beta; IL-10R2, com | 8e-11 | |
| 3lqm_A | 201 | Interleukin-10 receptor subunit beta; IL-10R2, com | 3e-09 | |
| 3lqm_A | 201 | Interleukin-10 receptor subunit beta; IL-10R2, com | 4e-04 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 3e-21 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 6e-19 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 4e-18 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 1e-17 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 2e-12 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 3e-06 | |
| 3n1f_C | 102 | Cell adhesion molecule-related/DOWN-regulated BY; | 1e-20 | |
| 3n1f_C | 102 | Cell adhesion molecule-related/DOWN-regulated BY; | 1e-19 | |
| 3n1f_C | 102 | Cell adhesion molecule-related/DOWN-regulated BY; | 3e-18 | |
| 3n1f_C | 102 | Cell adhesion molecule-related/DOWN-regulated BY; | 2e-17 | |
| 3n1f_C | 102 | Cell adhesion molecule-related/DOWN-regulated BY; | 2e-11 | |
| 3n1f_C | 102 | Cell adhesion molecule-related/DOWN-regulated BY; | 2e-10 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 2e-20 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 1e-18 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 3e-18 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 8e-12 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 2e-11 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 5e-06 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 4e-20 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 6e-16 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 1e-15 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 5e-13 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 2e-12 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 5e-08 | |
| 4doh_R | 221 | Interleukin-20 receptor subunit alpha; IL10 family | 9e-19 | |
| 4doh_R | 221 | Interleukin-20 receptor subunit alpha; IL10 family | 8e-15 | |
| 4doh_R | 221 | Interleukin-20 receptor subunit alpha; IL10 family | 5e-09 | |
| 4doh_R | 221 | Interleukin-20 receptor subunit alpha; IL10 family | 4e-07 | |
| 4doh_R | 221 | Interleukin-20 receptor subunit alpha; IL10 family | 5e-06 | |
| 4doh_R | 221 | Interleukin-20 receptor subunit alpha; IL10 family | 2e-05 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 2e-18 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 2e-18 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 4e-18 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 1e-14 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 3e-12 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 9e-07 | |
| 1wj3_A | 117 | KIAA1496 protein; beta sandwich, PANG, structural | 3e-18 | |
| 1wj3_A | 117 | KIAA1496 protein; beta sandwich, PANG, structural | 7e-14 | |
| 1wj3_A | 117 | KIAA1496 protein; beta sandwich, PANG, structural | 3e-13 | |
| 1wj3_A | 117 | KIAA1496 protein; beta sandwich, PANG, structural | 2e-11 | |
| 1wj3_A | 117 | KIAA1496 protein; beta sandwich, PANG, structural | 5e-08 | |
| 2crm_A | 120 | Fibronectin type-III domain containing protein 3A; | 3e-18 | |
| 2crm_A | 120 | Fibronectin type-III domain containing protein 3A; | 1e-13 | |
| 2crm_A | 120 | Fibronectin type-III domain containing protein 3A; | 9e-12 | |
| 2crm_A | 120 | Fibronectin type-III domain containing protein 3A; | 1e-09 | |
| 2crm_A | 120 | Fibronectin type-III domain containing protein 3A; | 5e-06 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 1e-17 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 2e-15 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 4e-15 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 1e-10 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 7e-10 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 2e-06 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 1e-17 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 1e-16 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 2e-16 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 6e-15 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 6e-12 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 1e-04 | |
| 1x5x_A | 109 | Fibronectin type-III domain containing protein 3A; | 2e-17 | |
| 1x5x_A | 109 | Fibronectin type-III domain containing protein 3A; | 1e-15 | |
| 1x5x_A | 109 | Fibronectin type-III domain containing protein 3A; | 3e-13 | |
| 1x5x_A | 109 | Fibronectin type-III domain containing protein 3A; | 8e-08 | |
| 1x5x_A | 109 | Fibronectin type-III domain containing protein 3A; | 1e-07 | |
| 1x3d_A | 118 | Fibronectin type-III domain containing protein 3A; | 2e-17 | |
| 1x3d_A | 118 | Fibronectin type-III domain containing protein 3A; | 2e-15 | |
| 1x3d_A | 118 | Fibronectin type-III domain containing protein 3A; | 5e-12 | |
| 1x3d_A | 118 | Fibronectin type-III domain containing protein 3A; | 9e-10 | |
| 1x3d_A | 118 | Fibronectin type-III domain containing protein 3A; | 2e-08 | |
| 2crz_A | 110 | Fibronectin type-III domain containing protein 3A; | 4e-17 | |
| 2crz_A | 110 | Fibronectin type-III domain containing protein 3A; | 5e-14 | |
| 2crz_A | 110 | Fibronectin type-III domain containing protein 3A; | 5e-10 | |
| 2crz_A | 110 | Fibronectin type-III domain containing protein 3A; | 2e-07 | |
| 2crz_A | 110 | Fibronectin type-III domain containing protein 3A; | 7e-05 | |
| 1eer_B | 227 | Epobp, erythropoietin receptor; signal transductio | 5e-17 | |
| 1eer_B | 227 | Epobp, erythropoietin receptor; signal transductio | 8e-13 | |
| 1eer_B | 227 | Epobp, erythropoietin receptor; signal transductio | 2e-11 | |
| 1eer_B | 227 | Epobp, erythropoietin receptor; signal transductio | 2e-07 | |
| 2haz_A | 105 | N-CAM 1, neural cell adhesion molecule 1; fibronec | 5e-17 | |
| 2haz_A | 105 | N-CAM 1, neural cell adhesion molecule 1; fibronec | 1e-15 | |
| 2haz_A | 105 | N-CAM 1, neural cell adhesion molecule 1; fibronec | 3e-12 | |
| 2haz_A | 105 | N-CAM 1, neural cell adhesion molecule 1; fibronec | 2e-11 | |
| 2haz_A | 105 | N-CAM 1, neural cell adhesion molecule 1; fibronec | 1e-07 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 1e-16 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 2e-14 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 1e-13 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 4e-12 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 6e-06 | |
| 2e3v_A | 122 | Neural cell adhesion molecule 1, 140 kDa isoform; | 2e-16 | |
| 2e3v_A | 122 | Neural cell adhesion molecule 1, 140 kDa isoform; | 7e-15 | |
| 2e3v_A | 122 | Neural cell adhesion molecule 1, 140 kDa isoform; | 6e-12 | |
| 2e3v_A | 122 | Neural cell adhesion molecule 1, 140 kDa isoform; | 1e-09 | |
| 2e3v_A | 122 | Neural cell adhesion molecule 1, 140 kDa isoform; | 6e-08 | |
| 1uey_A | 127 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 2e-16 | |
| 1uey_A | 127 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 4e-12 | |
| 1uey_A | 127 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 1e-10 | |
| 1uey_A | 127 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 5e-09 | |
| 1uey_A | 127 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 5e-08 | |
| 2dju_A | 106 | Receptor-type tyrosine-protein phosphatase F; LAR | 4e-16 | |
| 2dju_A | 106 | Receptor-type tyrosine-protein phosphatase F; LAR | 1e-14 | |
| 2dju_A | 106 | Receptor-type tyrosine-protein phosphatase F; LAR | 3e-10 | |
| 2dju_A | 106 | Receptor-type tyrosine-protein phosphatase F; LAR | 8e-07 | |
| 2dju_A | 106 | Receptor-type tyrosine-protein phosphatase F; LAR | 2e-06 | |
| 2dju_A | 106 | Receptor-type tyrosine-protein phosphatase F; LAR | 8e-04 | |
| 1wf5_A | 121 | Sidekick 2 protein; FNIII domain, structural genom | 5e-16 | |
| 1wf5_A | 121 | Sidekick 2 protein; FNIII domain, structural genom | 4e-15 | |
| 1wf5_A | 121 | Sidekick 2 protein; FNIII domain, structural genom | 2e-08 | |
| 1wf5_A | 121 | Sidekick 2 protein; FNIII domain, structural genom | 3e-08 | |
| 1wf5_A | 121 | Sidekick 2 protein; FNIII domain, structural genom | 2e-06 | |
| 3n06_B | 210 | PRL-R, prolactin receptor; PH dependence, hematopo | 8e-16 | |
| 3n06_B | 210 | PRL-R, prolactin receptor; PH dependence, hematopo | 7e-15 | |
| 3n06_B | 210 | PRL-R, prolactin receptor; PH dependence, hematopo | 9e-14 | |
| 3n06_B | 210 | PRL-R, prolactin receptor; PH dependence, hematopo | 8e-09 | |
| 1cd9_B | 215 | G-CSF-R, protein (G-CSF receptor); class1 cytokine | 2e-15 | |
| 1cd9_B | 215 | G-CSF-R, protein (G-CSF receptor); class1 cytokine | 8e-14 | |
| 1cd9_B | 215 | G-CSF-R, protein (G-CSF receptor); class1 cytokine | 9e-14 | |
| 1cd9_B | 215 | G-CSF-R, protein (G-CSF receptor); class1 cytokine | 3e-13 | |
| 1cd9_B | 215 | G-CSF-R, protein (G-CSF receptor); class1 cytokine | 1e-07 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 4e-15 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 3e-11 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 6e-10 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 4e-09 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 7e-09 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 4e-07 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 5e-15 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 6e-14 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 4e-13 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 6e-13 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 2e-11 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 3e-07 | |
| 3qt2_A | 317 | Interleukin-5 receptor subunit alpha; cytokine typ | 6e-15 | |
| 3qt2_A | 317 | Interleukin-5 receptor subunit alpha; cytokine typ | 3e-13 | |
| 3qt2_A | 317 | Interleukin-5 receptor subunit alpha; cytokine typ | 3e-11 | |
| 3qt2_A | 317 | Interleukin-5 receptor subunit alpha; cytokine typ | 2e-08 | |
| 1x5a_A | 107 | Ephrin type-A receptor 1; tyrosine-protein kinase | 6e-15 | |
| 1x5a_A | 107 | Ephrin type-A receptor 1; tyrosine-protein kinase | 1e-12 | |
| 1x5a_A | 107 | Ephrin type-A receptor 1; tyrosine-protein kinase | 3e-12 | |
| 1x5a_A | 107 | Ephrin type-A receptor 1; tyrosine-protein kinase | 5e-12 | |
| 1x5a_A | 107 | Ephrin type-A receptor 1; tyrosine-protein kinase | 5e-05 | |
| 4doh_B | 206 | Interleukin-20 receptor subunit beta; IL10 family | 8e-15 | |
| 4doh_B | 206 | Interleukin-20 receptor subunit beta; IL10 family | 2e-11 | |
| 4doh_B | 206 | Interleukin-20 receptor subunit beta; IL10 family | 1e-10 | |
| 4doh_B | 206 | Interleukin-20 receptor subunit beta; IL10 family | 2e-07 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 1e-14 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 2e-14 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 2e-13 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 2e-13 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 1e-12 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 3e-07 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 1e-14 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 4e-13 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 2e-12 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 2e-10 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 1e-05 | |
| 1wis_A | 124 | KIAA1514 protein; FNIII domain, sidekick-2, struct | 1e-14 | |
| 1wis_A | 124 | KIAA1514 protein; FNIII domain, sidekick-2, struct | 7e-13 | |
| 1wis_A | 124 | KIAA1514 protein; FNIII domain, sidekick-2, struct | 3e-09 | |
| 1wis_A | 124 | KIAA1514 protein; FNIII domain, sidekick-2, struct | 8e-08 | |
| 1wis_A | 124 | KIAA1514 protein; FNIII domain, sidekick-2, struct | 5e-07 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 1e-14 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 9e-14 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 3e-12 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 2e-11 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 1e-10 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 4e-10 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 2e-14 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 2e-12 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 3e-12 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 7e-12 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 2e-11 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 5e-08 | |
| 1uem_A | 117 | KIAA1568 protein; immunoglobulin-like beta-sandwic | 2e-14 | |
| 1uem_A | 117 | KIAA1568 protein; immunoglobulin-like beta-sandwic | 5e-13 | |
| 1uem_A | 117 | KIAA1568 protein; immunoglobulin-like beta-sandwic | 5e-08 | |
| 1uem_A | 117 | KIAA1568 protein; immunoglobulin-like beta-sandwic | 8e-07 | |
| 1uem_A | 117 | KIAA1568 protein; immunoglobulin-like beta-sandwic | 4e-06 | |
| 1x5y_A | 111 | Myosin binding protein C, fast-type; fast MYBP-C, | 2e-14 | |
| 1x5y_A | 111 | Myosin binding protein C, fast-type; fast MYBP-C, | 9e-14 | |
| 1x5y_A | 111 | Myosin binding protein C, fast-type; fast MYBP-C, | 2e-09 | |
| 1x5y_A | 111 | Myosin binding protein C, fast-type; fast MYBP-C, | 9e-05 | |
| 1v5j_A | 108 | KIAA1355 protein, RSGI RUH-008; FN3 domain, human | 3e-14 | |
| 1v5j_A | 108 | KIAA1355 protein, RSGI RUH-008; FN3 domain, human | 3e-11 | |
| 1v5j_A | 108 | KIAA1355 protein, RSGI RUH-008; FN3 domain, human | 2e-08 | |
| 1v5j_A | 108 | KIAA1355 protein, RSGI RUH-008; FN3 domain, human | 4e-05 | |
| 1v5j_A | 108 | KIAA1355 protein, RSGI RUH-008; FN3 domain, human | 1e-04 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 3e-14 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 3e-13 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 6e-13 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 3e-09 | |
| 3v6o_A | 206 | Leptin receptor; receptor-antibody complex, cytoki | 4e-14 | |
| 3v6o_A | 206 | Leptin receptor; receptor-antibody complex, cytoki | 1e-13 | |
| 3v6o_A | 206 | Leptin receptor; receptor-antibody complex, cytoki | 2e-12 | |
| 3v6o_A | 206 | Leptin receptor; receptor-antibody complex, cytoki | 4e-10 | |
| 3v6o_A | 206 | Leptin receptor; receptor-antibody complex, cytoki | 4e-09 | |
| 3v6o_A | 206 | Leptin receptor; receptor-antibody complex, cytoki | 1e-05 | |
| 3g9v_A | 211 | Interleukin 22 receptor, alpha 2; cytokine, cytoki | 4e-14 | |
| 3g9v_A | 211 | Interleukin 22 receptor, alpha 2; cytokine, cytoki | 4e-13 | |
| 3g9v_A | 211 | Interleukin 22 receptor, alpha 2; cytokine, cytoki | 2e-08 | |
| 3g9v_A | 211 | Interleukin 22 receptor, alpha 2; cytokine, cytoki | 7e-08 | |
| 3g9v_A | 211 | Interleukin 22 receptor, alpha 2; cytokine, cytoki | 7e-08 | |
| 3g9v_A | 211 | Interleukin 22 receptor, alpha 2; cytokine, cytoki | 8e-07 | |
| 2yux_A | 120 | Myosin-binding protein C, SLOW-type; fibronectin I | 5e-14 | |
| 2yux_A | 120 | Myosin-binding protein C, SLOW-type; fibronectin I | 3e-13 | |
| 2yux_A | 120 | Myosin-binding protein C, SLOW-type; fibronectin I | 1e-07 | |
| 2yux_A | 120 | Myosin-binding protein C, SLOW-type; fibronectin I | 2e-07 | |
| 2yux_A | 120 | Myosin-binding protein C, SLOW-type; fibronectin I | 7e-04 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 5e-14 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 2e-11 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 1e-10 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 6e-10 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 5e-09 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 1e-06 | |
| 2kbg_A | 114 | N-CAM 2, neural cell adhesion molecule 2; fibronec | 5e-14 | |
| 2kbg_A | 114 | N-CAM 2, neural cell adhesion molecule 2; fibronec | 2e-11 | |
| 2kbg_A | 114 | N-CAM 2, neural cell adhesion molecule 2; fibronec | 2e-10 | |
| 2kbg_A | 114 | N-CAM 2, neural cell adhesion molecule 2; fibronec | 7e-09 | |
| 2kbg_A | 114 | N-CAM 2, neural cell adhesion molecule 2; fibronec | 1e-08 | |
| 2kbg_A | 114 | N-CAM 2, neural cell adhesion molecule 2; fibronec | 4e-05 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 7e-14 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 4e-12 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 5e-12 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 8e-10 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 4e-09 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 2e-07 | |
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 7e-14 | |
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 1e-12 | |
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 2e-12 | |
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 7e-12 | |
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 2e-11 | |
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 7e-08 | |
| 2yuw_A | 110 | Myosin binding protein C, SLOW type; fibronectin I | 1e-13 | |
| 2yuw_A | 110 | Myosin binding protein C, SLOW type; fibronectin I | 2e-13 | |
| 2yuw_A | 110 | Myosin binding protein C, SLOW type; fibronectin I | 2e-09 | |
| 2yuw_A | 110 | Myosin binding protein C, SLOW type; fibronectin I | 5e-06 | |
| 1wfu_A | 120 | Unnamed protein product; FN3 domain, similar to 17 | 1e-13 | |
| 1wfu_A | 120 | Unnamed protein product; FN3 domain, similar to 17 | 3e-12 | |
| 1wfu_A | 120 | Unnamed protein product; FN3 domain, similar to 17 | 6e-09 | |
| 1wfu_A | 120 | Unnamed protein product; FN3 domain, similar to 17 | 1e-08 | |
| 1wfu_A | 120 | Unnamed protein product; FN3 domain, similar to 17 | 2e-05 | |
| 1wfu_A | 120 | Unnamed protein product; FN3 domain, similar to 17 | 3e-05 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 1e-13 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 3e-13 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 2e-12 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 2e-09 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 5e-08 | |
| 1x4z_A | 121 | Biregional cell adhesion molecule-related/DOWN- re | 2e-13 | |
| 1x4z_A | 121 | Biregional cell adhesion molecule-related/DOWN- re | 4e-13 | |
| 1x4z_A | 121 | Biregional cell adhesion molecule-related/DOWN- re | 9e-09 | |
| 1x4z_A | 121 | Biregional cell adhesion molecule-related/DOWN- re | 2e-07 | |
| 1x4z_A | 121 | Biregional cell adhesion molecule-related/DOWN- re | 4e-07 | |
| 2cuh_A | 115 | Tenascin-X; fibronectin type III domain, extracell | 2e-13 | |
| 2cuh_A | 115 | Tenascin-X; fibronectin type III domain, extracell | 6e-13 | |
| 2cuh_A | 115 | Tenascin-X; fibronectin type III domain, extracell | 1e-10 | |
| 2cuh_A | 115 | Tenascin-X; fibronectin type III domain, extracell | 9e-10 | |
| 2cuh_A | 115 | Tenascin-X; fibronectin type III domain, extracell | 2e-09 | |
| 2cuh_A | 115 | Tenascin-X; fibronectin type III domain, extracell | 2e-08 | |
| 1wk0_A | 137 | KIAA0970 protein; fibronectin type III domain, str | 2e-13 | |
| 1wk0_A | 137 | KIAA0970 protein; fibronectin type III domain, str | 2e-12 | |
| 1wk0_A | 137 | KIAA0970 protein; fibronectin type III domain, str | 1e-10 | |
| 1wk0_A | 137 | KIAA0970 protein; fibronectin type III domain, str | 4e-10 | |
| 1wk0_A | 137 | KIAA0970 protein; fibronectin type III domain, str | 1e-07 | |
| 1wk0_A | 137 | KIAA0970 protein; fibronectin type III domain, str | 3e-06 | |
| 2erj_C | 247 | Cytokine receptor common gamma chain; immune syste | 2e-13 | |
| 2erj_C | 247 | Cytokine receptor common gamma chain; immune syste | 6e-12 | |
| 2erj_C | 247 | Cytokine receptor common gamma chain; immune syste | 1e-09 | |
| 2erj_C | 247 | Cytokine receptor common gamma chain; immune syste | 3e-07 | |
| 2ic2_A | 115 | CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t | 2e-13 | |
| 2ic2_A | 115 | CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t | 6e-13 | |
| 2ic2_A | 115 | CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t | 6e-09 | |
| 2ic2_A | 115 | CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t | 2e-07 | |
| 2ic2_A | 115 | CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t | 5e-07 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 3e-13 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 3e-12 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 4e-12 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 2e-10 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 1e-09 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 1e-09 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 5e-13 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 7e-12 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 3e-11 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 8e-11 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 2e-10 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 4e-09 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 6e-13 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 4e-10 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 1e-09 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 1e-09 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 4e-09 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 4e-09 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 7e-13 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 2e-11 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 1e-10 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 3e-10 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 2e-08 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 5e-08 | |
| 1bpv_A | 112 | Titin, A71, connectin; fibronectin type III; NMR { | 7e-13 | |
| 1bpv_A | 112 | Titin, A71, connectin; fibronectin type III; NMR { | 1e-12 | |
| 1bpv_A | 112 | Titin, A71, connectin; fibronectin type III; NMR { | 3e-06 | |
| 1bpv_A | 112 | Titin, A71, connectin; fibronectin type III; NMR { | 1e-04 | |
| 2cum_A | 105 | Tenascin-X; hexabrachion-like, fibronectin type II | 9e-13 | |
| 2cum_A | 105 | Tenascin-X; hexabrachion-like, fibronectin type II | 1e-12 | |
| 2cum_A | 105 | Tenascin-X; hexabrachion-like, fibronectin type II | 2e-11 | |
| 2cum_A | 105 | Tenascin-X; hexabrachion-like, fibronectin type II | 1e-09 | |
| 2cum_A | 105 | Tenascin-X; hexabrachion-like, fibronectin type II | 2e-09 | |
| 2cum_A | 105 | Tenascin-X; hexabrachion-like, fibronectin type II | 1e-06 | |
| 1ujt_A | 120 | KIAA1568 protein; fibronectin type III domain, str | 1e-12 | |
| 1ujt_A | 120 | KIAA1568 protein; fibronectin type III domain, str | 5e-11 | |
| 1ujt_A | 120 | KIAA1568 protein; fibronectin type III domain, str | 7e-11 | |
| 1ujt_A | 120 | KIAA1568 protein; fibronectin type III domain, str | 2e-10 | |
| 1ujt_A | 120 | KIAA1568 protein; fibronectin type III domain, str | 4e-08 | |
| 1ujt_A | 120 | KIAA1568 protein; fibronectin type III domain, str | 1e-05 | |
| 2b5i_C | 199 | Cytokine receptor common gamma chain; four-helix b | 2e-12 | |
| 2b5i_C | 199 | Cytokine receptor common gamma chain; four-helix b | 3e-12 | |
| 2b5i_C | 199 | Cytokine receptor common gamma chain; four-helix b | 5e-08 | |
| 2b5i_C | 199 | Cytokine receptor common gamma chain; four-helix b | 4e-07 | |
| 2b5i_C | 199 | Cytokine receptor common gamma chain; four-helix b | 6e-07 | |
| 2w1n_A | 238 | O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol | 2e-11 | |
| 2w1n_A | 238 | O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol | 2e-09 | |
| 2w1n_A | 238 | O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol | 3e-09 | |
| 2w1n_A | 238 | O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol | 3e-07 | |
| 3mpc_A | 103 | FN3-like protein; fibronectin, FN(III), unknown fu | 2e-11 | |
| 3mpc_A | 103 | FN3-like protein; fibronectin, FN(III), unknown fu | 2e-06 | |
| 3mpc_A | 103 | FN3-like protein; fibronectin, FN(III), unknown fu | 8e-05 | |
| 2h41_A | 95 | Fibronectin; beta sandwich, cell adhesion, structu | 4e-11 | |
| 2h41_A | 95 | Fibronectin; beta sandwich, cell adhesion, structu | 5e-09 | |
| 2h41_A | 95 | Fibronectin; beta sandwich, cell adhesion, structu | 1e-08 | |
| 2h41_A | 95 | Fibronectin; beta sandwich, cell adhesion, structu | 8e-08 | |
| 2h41_A | 95 | Fibronectin; beta sandwich, cell adhesion, structu | 2e-07 | |
| 2h41_A | 95 | Fibronectin; beta sandwich, cell adhesion, structu | 2e-07 | |
| 1axi_B | 236 | HGHBP, growth hormone receptor; complex (hormone-r | 1e-10 | |
| 1axi_B | 236 | HGHBP, growth hormone receptor; complex (hormone-r | 7e-08 | |
| 1axi_B | 236 | HGHBP, growth hormone receptor; complex (hormone-r | 1e-07 | |
| 1axi_B | 236 | HGHBP, growth hormone receptor; complex (hormone-r | 4e-05 | |
| 2dmk_A | 127 | Midline 2 isoform 2; midline defect 2, tripartite | 4e-10 | |
| 2dmk_A | 127 | Midline 2 isoform 2; midline defect 2, tripartite | 3e-09 | |
| 2dmk_A | 127 | Midline 2 isoform 2; midline defect 2, tripartite | 4e-07 | |
| 2dmk_A | 127 | Midline 2 isoform 2; midline defect 2, tripartite | 5e-07 | |
| 2dmk_A | 127 | Midline 2 isoform 2; midline defect 2, tripartite | 2e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-09 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 3e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 | |
| 2b5i_B | 214 | Interleukin-2 receptor beta chain; four-helix bund | 2e-09 | |
| 2b5i_B | 214 | Interleukin-2 receptor beta chain; four-helix bund | 7e-09 | |
| 2b5i_B | 214 | Interleukin-2 receptor beta chain; four-helix bund | 5e-08 | |
| 2b5i_B | 214 | Interleukin-2 receptor beta chain; four-helix bund | 7e-06 | |
| 2b5i_B | 214 | Interleukin-2 receptor beta chain; four-helix bund | 9e-06 | |
| 3tgx_A | 219 | Interleukin-21 receptor; class I cytokine, class I | 2e-09 | |
| 3tgx_A | 219 | Interleukin-21 receptor; class I cytokine, class I | 1e-06 | |
| 3tgx_A | 219 | Interleukin-21 receptor; class I cytokine, class I | 8e-05 | |
| 3tgx_A | 219 | Interleukin-21 receptor; class I cytokine, class I | 6e-04 | |
| 3up1_A | 223 | Interleukin-7 receptor subunit alpha; cytokine rec | 4e-09 | |
| 3up1_A | 223 | Interleukin-7 receptor subunit alpha; cytokine rec | 4e-06 | |
| 3up1_A | 223 | Interleukin-7 receptor subunit alpha; cytokine rec | 5e-06 | |
| 3up1_A | 223 | Interleukin-7 receptor subunit alpha; cytokine rec | 1e-05 | |
| 1iar_B | 207 | Protein (interleukin-4 receptor alpha chain); cyto | 1e-08 | |
| 1iar_B | 207 | Protein (interleukin-4 receptor alpha chain); cyto | 2e-08 | |
| 1iar_B | 207 | Protein (interleukin-4 receptor alpha chain); cyto | 2e-08 | |
| 1iar_B | 207 | Protein (interleukin-4 receptor alpha chain); cyto | 3e-07 | |
| 1iar_B | 207 | Protein (interleukin-4 receptor alpha chain); cyto | 5e-05 | |
| 1iar_B | 207 | Protein (interleukin-4 receptor alpha chain); cyto | 9e-05 | |
| 1k85_A | 88 | Chitinase A1; fibronectin type III domain, chitin | 1e-08 | |
| 1k85_A | 88 | Chitinase A1; fibronectin type III domain, chitin | 2e-08 | |
| 1k85_A | 88 | Chitinase A1; fibronectin type III domain, chitin | 9e-06 | |
| 2cui_A | 112 | Tenascin-X; fibronectin type III domain, extracell | 2e-08 | |
| 2cui_A | 112 | Tenascin-X; fibronectin type III domain, extracell | 2e-08 | |
| 2cui_A | 112 | Tenascin-X; fibronectin type III domain, extracell | 1e-07 | |
| 2cui_A | 112 | Tenascin-X; fibronectin type III domain, extracell | 7e-07 | |
| 2cui_A | 112 | Tenascin-X; fibronectin type III domain, extracell | 2e-05 | |
| 2cui_A | 112 | Tenascin-X; fibronectin type III domain, extracell | 3e-04 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 1e-07 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 5e-07 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 1e-05 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 5e-05 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 7e-04 | |
| 3dlq_R | 211 | Interleukin-22 receptor subunit alpha-1; cytokine- | 3e-07 | |
| 3dlq_R | 211 | Interleukin-22 receptor subunit alpha-1; cytokine- | 2e-06 | |
| 3dlq_R | 211 | Interleukin-22 receptor subunit alpha-1; cytokine- | 2e-06 | |
| 1uc6_A | 109 | CNTF receptor, ciliary neurotrophic factor recepto | 3e-07 | |
| 1uc6_A | 109 | CNTF receptor, ciliary neurotrophic factor recepto | 5e-07 | |
| 1uc6_A | 109 | CNTF receptor, ciliary neurotrophic factor recepto | 1e-05 | |
| 1uc6_A | 109 | CNTF receptor, ciliary neurotrophic factor recepto | 5e-05 | |
| 2dle_A | 104 | Receptor-type tyrosine-protein phosphatase ETA; pr | 4e-07 | |
| 2dle_A | 104 | Receptor-type tyrosine-protein phosphatase ETA; pr | 3e-06 | |
| 2dle_A | 104 | Receptor-type tyrosine-protein phosphatase ETA; pr | 3e-05 | |
| 2dle_A | 104 | Receptor-type tyrosine-protein phosphatase ETA; pr | 8e-04 | |
| 3d85_D | 306 | IL-12B, interleukin-12 subunit P40, cytotoxic lymp | 3e-06 | |
| 2csp_A | 130 | RIM-BP2, RIM binding protein 2; FN3 domain, struct | 6e-06 | |
| 1y6k_R | 214 | Interleukin-10 receptor alpha chain; helix bundle, | 2e-05 | |
| 1y6k_R | 214 | Interleukin-10 receptor alpha chain; helix bundle, | 2e-04 | |
| 1wft_A | 123 | 1700129L13RIK protein; FN3 domain, similar to HOST | 7e-05 | |
| 3o71_B | 27 | Peptide of deleted in colorectal cancer; protein-p | 1e-04 | |
| 3og6_B | 226 | Interleukin 28 receptor, alpha (interferon, lambd | 1e-04 | |
| 1oww_A | 98 | FN, fibronectin first type III module, CIG; fibron | 3e-04 |
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
Score = 244 bits (625), Expect = 5e-72
Identities = 101/618 (16%), Positives = 187/618 (30%), Gaps = 70/618 (11%)
Query: 60 PQSVSAIMVGPRSVALRWLPPTLPRGEILVYCVLYKREG----SERERAYNATARVEAII 115
P+S + + + + +++K E+ N TA
Sbjct: 10 PESPVVQLHSNFTAVCVLKEKCMDYFHVNANYIVWKTNHFTIPKEQYTIINRTASSVTFT 69
Query: 116 QGLHPNTSYTFRVVAYNALGAGLASSALPVKTEPEDHVPSPPLNVNIPVVGTSSLLVTWE 175
N T ++ + L + + P P N++ V + W+
Sbjct: 70 DIASLNIQLTCNILTFGQLEQNVYGITIISGL-----PPEKPKNLSCIVNEGKKMRCEWD 124
Query: 176 KPTVTNGEIKHYTLYY---LEEDTSVERHVVTPQLSYELTGLSHFTLYSIWVVAHNGNGA 232
T+ E +TL + + TP +F +WV A N G
Sbjct: 125 GGRETHLETN-FTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVEAENALGK 183
Query: 233 GTTSQELSVQTLSDKPSEPPAN-----------SITVRWQPPSRRGQNGIITGYKLRYKK 281
T S ++ + PP N + + W PS ++ II Y ++Y+
Sbjct: 184 VT-SDHINFDPVYKVKPNPPHNLSVINSEELSSILKLTWTNPSI--KSVIILKYNIQYRT 240
Query: 282 KDVKK-DKGETVTTAGDRRLYVITGLNKSTTYQIKLWAMNVNGSGPATDWFSAETFSQDL 340
KD + TA R + + L T Y ++ M +G G +DW S E
Sbjct: 241 KDASTWSQIPPEDTASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDW-SEEASGITY 299
Query: 341 GEFTVPDIPASL-----KARPGGPSSIIVSWT--PPADQSIMVRGFTLGWGKGVPDEFVK 393
+ P S + G ++ + W PP + + + + + +
Sbjct: 300 ED--RPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPFEANGKILDYEVTLT-----RWKS 352
Query: 394 QILDVKQRSDEITGLEPNSDYVISLRAFNEMGDGPQKYESLRTRNEPPPQAPKVLIPPMG 453
+ + + ++T N Y+ +L N +G ++ + L
Sbjct: 353 HLQNYTVNATKLTVNLTNDRYLATLTVRNLVGKSDAAVLTIPACDFQATHPVMDL----- 407
Query: 454 LKSEVLSPYSMRISWIDTTLPDQFQQHGEEGRHYLVRYTHLL--GASNPRYKYINANIT- 510
+ + W E + Y++ + L ++ + +
Sbjct: 408 --KAFPKDNMLWVEW---------TTPRESVKKYILEWCVLSDKAPCITDWQQEDGTVHR 456
Query: 511 SVQINDLRPSTQYEFTVKVVRAKKESEWSMIVLNTTQEAAPASAPRDLTVVSKEGDPSLV 570
+ +L S Y TV V A I ++A P+ P TV +K+ +
Sbjct: 457 TYLRGNLAESKCYLITVTPVYADGPGSPESIKA-YLKQAPPSKGP---TVRTKKVGKNEA 512
Query: 571 NLNWQ--PPKSANGQISGYTILYSSDPNTDQWIEESVVGDKMSTNVRGLEPGRIYYFKIK 628
L W P NG I YTI Y +V + L +Y ++
Sbjct: 513 VLEWDQLPVDVQNGFIRNYTIFYR--TIIGNETAVNVDSSHTEYTLSSLTSDTLYMVRMA 570
Query: 629 ARNSAGSSPYSSTVTWTT 646
A G T
Sbjct: 571 AYTDEGGKDGPEFTFTTP 588
|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} Length = 589 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A Length = 368 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} Length = 375 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} Length = 731 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} Length = 680 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A Length = 290 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A Length = 290 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 Length = 283 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A Length = 211 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A Length = 234 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* Length = 536 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} Length = 197 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 Length = 205 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Length = 389 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A Length = 209 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A Length = 214 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} Length = 483 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 Length = 186 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A Length = 203 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 126 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 116 | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* Length = 414 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} Length = 306 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 132 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A Length = 419 | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A Length = 215 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* Length = 380 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 134 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 122 | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A Length = 303 | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} Length = 488 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 109 | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* Length = 314 | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 114 | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 124 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 119 | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 113 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 125 | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} Length = 201 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C Length = 102 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 106 | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} Length = 103 | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 221 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 118 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 110 | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A Length = 227 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Length = 305 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} Length = 122 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 127 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 106 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A Length = 210 | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A Length = 215 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} Length = 97 | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} Length = 317 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 Length = 107 | Back alignment and structure |
|---|
| >4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A Length = 101 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Length = 215 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 124 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A Length = 104 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 117 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 Length = 111 | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 108 | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A Length = 325 | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} Length = 206 | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} Length = 211 | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} Length = 120 | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* Length = 114 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} Length = 114 | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} Length = 121 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} Length = 100 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 Length = 313 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 Length = 121 | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 137 | Back alignment and structure |
|---|
| >2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 | Back alignment and structure |
|---|
| >2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 | Back alignment and structure |
|---|
| >2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 | Back alignment and structure |
|---|
| >2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 Length = 247 | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 Length = 115 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 108 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} Length = 98 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 94 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 105 | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 120 | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* Length = 199 | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} Length = 238 | Back alignment and structure |
|---|
| >3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Length = 103 | Back alignment and structure |
|---|
| >3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Length = 103 | Back alignment and structure |
|---|
| >3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} Length = 103 | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A Length = 95 | Back alignment and structure |
|---|
| >1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 | Back alignment and structure |
|---|
| >1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 | Back alignment and structure |
|---|
| >1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 | Back alignment and structure |
|---|
| >1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A Length = 236 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 127 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* Length = 214 | Back alignment and structure |
|---|
| >3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} Length = 219 | Back alignment and structure |
|---|
| >3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 | Back alignment and structure |
|---|
| >3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 | Back alignment and structure |
|---|
| >3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 | Back alignment and structure |
|---|
| >3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* Length = 223 | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* Length = 207 | Back alignment and structure |
|---|
| >1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 | Back alignment and structure |
|---|
| >1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 | Back alignment and structure |
|---|
| >1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 Length = 88 | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 112 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 | Back alignment and structure |
|---|
| >3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Length = 211 | Back alignment and structure |
|---|
| >3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Length = 211 | Back alignment and structure |
|---|
| >3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* Length = 211 | Back alignment and structure |
|---|
| >1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 109 | Back alignment and structure |
|---|
| >2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} Length = 104 | Back alignment and structure |
|---|
| >3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* Length = 306 | Back alignment and structure |
|---|
| >2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 130 | Back alignment and structure |
|---|
| >1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Length = 214 | Back alignment and structure |
|---|
| >1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R Length = 214 | Back alignment and structure |
|---|
| >1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 Length = 123 | Back alignment and structure |
|---|
| >3o71_B Peptide of deleted in colorectal cancer; protein-peptide complex, kinase, DCC, transferase-protein BI complex; 1.95A {Rattus norvegicus} Length = 27 | Back alignment and structure |
|---|
| >3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* Length = 226 | Back alignment and structure |
|---|
| >1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 Length = 98 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 753 | |||
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 100.0 | |
| 3l5h_A | 589 | Interleukin-6 receptor subunit beta; IG-like, FNII | 100.0 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 100.0 | |
| 1zlg_A | 680 | Anosmin 1; insulin-like growth factor receptor Cys | 100.0 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 100.0 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 100.0 | |
| 3t1w_A | 375 | Four-domain fibronectin fragment; human fibronecti | 100.0 | |
| 1fnf_A | 368 | Fibronectin; RGD, extracellular matrix, cell adhes | 100.0 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 100.0 | |
| 2v5y_A | 731 | Receptor-type tyrosine-protein phosphatase MU; mem | 100.0 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 100.0 | |
| 3se4_A | 414 | Interferon alpha/beta receptor 1; type I interfero | 100.0 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 99.97 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 99.97 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 99.97 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 99.97 | |
| 2dtg_E | 897 | Insulin receptor; IR ectodomain, X-RAY crystallogr | 99.97 | |
| 3r8q_A | 290 | Fibronectin; heparin, FNIII, heparin binding, cell | 99.96 | |
| 1tdq_A | 283 | Tenascin-R; extracellular matrix, lecticans, tenas | 99.96 | |
| 3l5i_A | 290 | Interleukin-6 receptor subunit beta; cytokine rece | 99.96 | |
| 3lb6_C | 380 | IL-13, interleukin-13 receptor subunit alpha-2; cy | 99.94 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 99.94 | |
| 3s98_A | 306 | Interferon alpha/beta receptor 1; human, type I in | 99.93 | |
| 3s98_A | 306 | Interferon alpha/beta receptor 1; human, type I in | 99.93 | |
| 2q7n_A | 488 | Leukemia inhibitory factor receptor; cytokine cell | 99.92 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 99.92 | |
| 3p4l_A | 211 | Neogenin; iron homeostasis, hemojuvelin receptor, | 99.92 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 99.92 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 99.92 | |
| 1cfb_A | 205 | Drosophila neuroglian; neural adhesion molecule; H | 99.92 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 99.91 | |
| 3f7q_A | 234 | Integrin beta-4, GP150; hemidesmosome, cell adhesi | 99.91 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 99.91 | |
| 2q7n_A | 488 | Leukemia inhibitory factor receptor; cytokine cell | 99.91 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 99.91 | |
| 2vkw_A | 209 | Neural cell adhesion molecule 1,140 kDa isoform; a | 99.9 | |
| 2gys_A | 419 | Cytokine receptor common beta chain; dimer of inte | 99.9 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 99.89 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 99.89 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 99.89 | |
| 2gys_A | 419 | Cytokine receptor common beta chain; dimer of inte | 99.89 | |
| 1bqu_A | 215 | Protein (GP130); cytokine receptor, glycoprotein 1 | 99.89 | |
| 2ibg_A | 214 | CG9211-PA, GH03927P; IHOG, fibronectin type III, p | 99.89 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 99.88 | |
| 3lpw_A | 197 | A77-A78 domain from titin; intracellular FNIII-tan | 99.88 | |
| 2jll_A | 389 | NCAM2, neural cell adhesion molecule 2; immunoglob | 99.88 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 99.87 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 99.87 | |
| 3bpo_C | 314 | Interleukin-13 receptor alpha-1 chain; IL4, IL13, | 99.87 | |
| 3lb6_C | 380 | IL-13, interleukin-13 receptor subunit alpha-2; cy | 99.87 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 99.86 | |
| 1qr4_A | 186 | Protein (tenascin); fibronectin type-III, heparin, | 99.86 | |
| 1i1r_A | 303 | GP130, interleukin-6 receptor beta chain; cytokine | 99.86 | |
| 2gee_A | 203 | Hypothetical protein; fibronectin, EIIIB, cancer, | 99.86 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 99.85 | |
| 3fl7_A | 536 | Ephrin receptor; ATP-binding, kinase, nucleotide-b | 99.85 | |
| 3e0g_A | 483 | Leukemia inhibitory factor receptor; IG domain, cy | 99.85 | |
| 2ha1_A | 201 | Fibronectin; beta sandwich, protein-protein comple | 99.84 | |
| 3n06_B | 210 | PRL-R, prolactin receptor; PH dependence, hematopo | 99.83 | |
| 3n06_B | 210 | PRL-R, prolactin receptor; PH dependence, hematopo | 99.83 | |
| 1cd9_B | 215 | G-CSF-R, protein (G-CSF receptor); class1 cytokine | 99.8 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 99.8 | |
| 1cd9_B | 215 | G-CSF-R, protein (G-CSF receptor); class1 cytokine | 99.8 | |
| 2d9q_B | 313 | Granulocyte colony-stimulating factor receptor; cy | 99.79 | |
| 3lqm_A | 201 | Interleukin-10 receptor subunit beta; IL-10R2, com | 99.76 | |
| 4go6_B | 232 | HCF C-terminal chain 1; tandem fibronectin repeat, | 99.75 | |
| 3lqm_A | 201 | Interleukin-10 receptor subunit beta; IL-10R2, com | 99.72 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 99.72 | |
| 1n26_A | 325 | IL-6 receptor alpha chain; transmembrane, glycopro | 99.72 | |
| 4go6_B | 232 | HCF C-terminal chain 1; tandem fibronectin repeat, | 99.7 | |
| 1axi_B | 236 | HGHBP, growth hormone receptor; complex (hormone-r | 99.7 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.68 | |
| 1axi_B | 236 | HGHBP, growth hormone receptor; complex (hormone-r | 99.67 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 99.67 | |
| 3qt2_A | 317 | Interleukin-5 receptor subunit alpha; cytokine typ | 99.66 | |
| 2dbj_A | 124 | Proto-oncogene tyrosine-protein kinase MER precurs | 99.66 | |
| 2ede_A | 114 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.65 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 99.65 | |
| 4doh_R | 221 | Interleukin-20 receptor subunit alpha; IL10 family | 99.64 | |
| 3n1f_C | 102 | Cell adhesion molecule-related/DOWN-regulated BY; | 99.63 | |
| 2edx_A | 134 | Protein tyrosine phosphatase, receptor type, F; LA | 99.62 | |
| 4doh_R | 221 | Interleukin-20 receptor subunit alpha; IL10 family | 99.61 | |
| 1eer_B | 227 | Epobp, erythropoietin receptor; signal transductio | 99.61 | |
| 4doh_B | 206 | Interleukin-20 receptor subunit beta; IL10 family | 99.61 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 99.61 | |
| 1wj3_A | 117 | KIAA1496 protein; beta sandwich, PANG, structural | 99.61 | |
| 1x5h_A | 132 | Neogenin; RGM binding, fibronectin type III domain | 99.61 | |
| 1x4y_A | 114 | Biregional cell adhesion molecule-related/DOWN- re | 99.6 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 99.6 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 99.59 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 99.59 | |
| 1x3d_A | 118 | Fibronectin type-III domain containing protein 3A; | 99.58 | |
| 2ed9_A | 124 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.57 | |
| 1wfo_A | 130 | Sidekick 2; FN3, cell adhesion, structural genomic | 99.57 | |
| 1uen_A | 125 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 99.57 | |
| 1va9_A | 122 | DOWN syndrome cell adhesion molecule like- protein | 99.57 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 99.57 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.57 | |
| 3v6o_A | 206 | Leptin receptor; receptor-antibody complex, cytoki | 99.56 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 99.56 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.56 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 99.56 | |
| 2haz_A | 105 | N-CAM 1, neural cell adhesion molecule 1; fibronec | 99.55 | |
| 1x5g_A | 116 | Neogenin; RGM binding, fibronectin type III domain | 99.55 | |
| 3g9v_A | 211 | Interleukin 22 receptor, alpha 2; cytokine, cytoki | 99.55 | |
| 1eer_B | 227 | Epobp, erythropoietin receptor; signal transductio | 99.54 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 99.54 | |
| 3v6o_A | 206 | Leptin receptor; receptor-antibody complex, cytoki | 99.54 | |
| 2dm4_A | 108 | Sortilin-related receptor; beta-sandwich, sorting | 99.53 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 99.53 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.53 | |
| 1x3d_A | 118 | Fibronectin type-III domain containing protein 3A; | 99.53 | |
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 99.53 | |
| 1v5j_A | 108 | KIAA1355 protein, RSGI RUH-008; FN3 domain, human | 99.52 | |
| 2crm_A | 120 | Fibronectin type-III domain containing protein 3A; | 99.52 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 99.52 | |
| 2edx_A | 134 | Protein tyrosine phosphatase, receptor type, F; LA | 99.51 | |
| 3qt2_A | 317 | Interleukin-5 receptor subunit alpha; cytokine typ | 99.51 | |
| 3g9v_A | 211 | Interleukin 22 receptor, alpha 2; cytokine, cytoki | 99.51 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 99.51 | |
| 2ed8_A | 106 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.5 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 99.5 | |
| 1x4x_A | 106 | Fibronectin type-III domain containing protein 3A; | 99.5 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 99.5 | |
| 4doh_B | 206 | Interleukin-20 receptor subunit beta; IL10 family | 99.5 | |
| 2w1n_A | 238 | O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol | 99.5 | |
| 1x5i_A | 126 | Neogenin; RGM binding, fibronectin type III domain | 99.5 | |
| 1wis_A | 124 | KIAA1514 protein; FNIII domain, sidekick-2, struct | 99.5 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 99.49 | |
| 2dm4_A | 108 | Sortilin-related receptor; beta-sandwich, sorting | 99.49 | |
| 1x5x_A | 109 | Fibronectin type-III domain containing protein 3A; | 99.49 | |
| 2ee2_A | 119 | Contactin-1; neural cell surface protein F3, glyco | 99.49 | |
| 1x5a_A | 107 | Ephrin type-A receptor 1; tyrosine-protein kinase | 99.48 | |
| 1x5f_A | 120 | Neogenin; RGM binding, fibronectin type III domain | 99.48 | |
| 2edd_A | 123 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.48 | |
| 1x5h_A | 132 | Neogenin; RGM binding, fibronectin type III domain | 99.48 | |
| 1x5z_A | 115 | Receptor-type tyrosine-protein phosphatase delta; | 99.48 | |
| 1x4z_A | 121 | Biregional cell adhesion molecule-related/DOWN- re | 99.48 | |
| 2e3v_A | 122 | Neural cell adhesion molecule 1, 140 kDa isoform; | 99.48 | |
| 2djs_A | 108 | Ephrin type-B receptor 1; tyrosine-protein kinase | 99.48 | |
| 1wj3_A | 117 | KIAA1496 protein; beta sandwich, PANG, structural | 99.47 | |
| 2crz_A | 110 | Fibronectin type-III domain containing protein 3A; | 99.47 | |
| 1x5x_A | 109 | Fibronectin type-III domain containing protein 3A; | 99.47 | |
| 2dbj_A | 124 | Proto-oncogene tyrosine-protein kinase MER precurs | 99.47 | |
| 2ed7_A | 119 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.47 | |
| 2crm_A | 120 | Fibronectin type-III domain containing protein 3A; | 99.46 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 99.46 | |
| 2e7h_A | 109 | Ephrin type-B receptor 4; FN3 domain, tyrosine- pr | 99.46 | |
| 1wfu_A | 120 | Unnamed protein product; FN3 domain, similar to 17 | 99.46 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 99.46 | |
| 1v5j_A | 108 | KIAA1355 protein, RSGI RUH-008; FN3 domain, human | 99.45 | |
| 2dlh_A | 121 | Receptor-type tyrosine-protein phosphatase delta; | 99.45 | |
| 1wis_A | 124 | KIAA1514 protein; FNIII domain, sidekick-2, struct | 99.45 | |
| 1uem_A | 117 | KIAA1568 protein; immunoglobulin-like beta-sandwic | 99.45 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.44 | |
| 1wfn_A | 119 | Sidekick 2; FN3, cell adhesion, structural genomic | 99.44 | |
| 1uem_A | 117 | KIAA1568 protein; immunoglobulin-like beta-sandwic | 99.44 | |
| 2dju_A | 106 | Receptor-type tyrosine-protein phosphatase F; LAR | 99.44 | |
| 2kbg_A | 114 | N-CAM 2, neural cell adhesion molecule 2; fibronec | 99.43 | |
| 2dju_A | 106 | Receptor-type tyrosine-protein phosphatase F; LAR | 99.43 | |
| 1wf5_A | 121 | Sidekick 2 protein; FNIII domain, structural genom | 99.43 | |
| 2crz_A | 110 | Fibronectin type-III domain containing protein 3A; | 99.42 | |
| 2e3v_A | 122 | Neural cell adhesion molecule 1, 140 kDa isoform; | 99.42 | |
| 1x5l_A | 111 | Ephrin type-A receptor 8; FN3 domain, structural g | 99.42 | |
| 2dn7_A | 107 | Receptor-type tyrosine-protein phosphatase F; LAR | 99.42 | |
| 1x5j_A | 113 | Neogenin; RGM binding, fibronectin type III domain | 99.42 | |
| 1va9_A | 122 | DOWN syndrome cell adhesion molecule like- protein | 99.42 | |
| 2haz_A | 105 | N-CAM 1, neural cell adhesion molecule 1; fibronec | 99.41 | |
| 2w1n_A | 238 | O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrol | 99.41 | |
| 1uey_A | 127 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 99.41 | |
| 1wk0_A | 137 | KIAA0970 protein; fibronectin type III domain, str | 99.41 | |
| 1uey_A | 127 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 99.41 | |
| 1wf5_A | 121 | Sidekick 2 protein; FNIII domain, structural genom | 99.4 | |
| 2yrz_A | 118 | Integrin beta-4; GP150, CD104 antigen, structural | 99.4 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 99.4 | |
| 1x5y_A | 111 | Myosin binding protein C, fast-type; fast MYBP-C, | 99.4 | |
| 2ede_A | 114 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.39 | |
| 1uen_A | 125 | KIAA0343 protein; immunoglobulin-like beta-sandwic | 99.39 | |
| 3t04_D | 103 | Monobody 7C12; engineered binding protein, antibod | 99.39 | |
| 1wfu_A | 120 | Unnamed protein product; FN3 domain, similar to 17 | 99.39 | |
| 1ujt_A | 120 | KIAA1568 protein; fibronectin type III domain, str | 99.38 | |
| 2edb_A | 116 | Netrin receptor DCC; tumor suppressor protein DCC, | 99.38 | |
| 1x4z_A | 121 | Biregional cell adhesion molecule-related/DOWN- re | 99.38 | |
| 2erj_C | 247 | Cytokine receptor common gamma chain; immune syste | 99.38 | |
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 99.37 | |
| 1x5y_A | 111 | Myosin binding protein C, fast-type; fast MYBP-C, | 99.37 | |
| 2yuw_A | 110 | Myosin binding protein C, SLOW type; fibronectin I | 99.37 | |
| 1x4y_A | 114 | Biregional cell adhesion molecule-related/DOWN- re | 99.37 | |
| 1bpv_A | 112 | Titin, A71, connectin; fibronectin type III; NMR { | 99.37 | |
| 1x5a_A | 107 | Ephrin type-A receptor 1; tyrosine-protein kinase | 99.37 | |
| 2edy_A | 103 | Receptor-type tyrosine-protein phosphatase F; LAR | 99.36 | |
| 2yuw_A | 110 | Myosin binding protein C, SLOW type; fibronectin I | 99.35 | |
| 2yux_A | 120 | Myosin-binding protein C, SLOW-type; fibronectin I | 99.35 | |
| 2ee3_A | 108 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 99.33 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 99.33 | |
| 3n1f_C | 102 | Cell adhesion molecule-related/DOWN-regulated BY; | 99.33 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 99.33 | |
| 2ic2_A | 115 | CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t | 99.33 | |
| 1bpv_A | 112 | Titin, A71, connectin; fibronectin type III; NMR { | 99.32 | |
| 2cum_A | 105 | Tenascin-X; hexabrachion-like, fibronectin type II | 99.31 | |
| 2kbg_A | 114 | N-CAM 2, neural cell adhesion molecule 2; fibronec | 99.31 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 99.3 | |
| 2erj_C | 247 | Cytokine receptor common gamma chain; immune syste | 99.29 | |
| 1wk0_A | 137 | KIAA0970 protein; fibronectin type III domain, str | 99.29 | |
| 2cuh_A | 115 | Tenascin-X; fibronectin type III domain, extracell | 99.29 | |
| 3up1_A | 223 | Interleukin-7 receptor subunit alpha; cytokine rec | 99.28 | |
| 2b5i_C | 199 | Cytokine receptor common gamma chain; four-helix b | 99.28 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 99.28 | |
| 2db8_A | 110 | Tripartite motif protein 9, isoform 2; ring finger | 99.26 | |
| 2cum_A | 105 | Tenascin-X; hexabrachion-like, fibronectin type II | 99.26 | |
| 2dmk_A | 127 | Midline 2 isoform 2; midline defect 2, tripartite | 99.25 | |
| 2b5i_C | 199 | Cytokine receptor common gamma chain; four-helix b | 99.24 | |
| 2cuh_A | 115 | Tenascin-X; fibronectin type III domain, extracell | 99.24 | |
| 3k2m_C | 101 | Monobody HA4; engineered binding protein, antibody | 99.24 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 99.24 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 99.24 | |
| 2yux_A | 120 | Myosin-binding protein C, SLOW-type; fibronectin I | 99.24 | |
| 2rb8_A | 104 | Tenascin; beta sheet,loop design, alternative spli | 99.24 | |
| 3b83_A | 100 | Ten-D3; beta sheet, computational redesigned prote | 99.23 | |
| 2ic2_A | 115 | CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin t | 99.23 | |
| 2dmk_A | 127 | Midline 2 isoform 2; midline defect 2, tripartite | 99.23 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 99.22 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 99.22 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 99.22 | |
| 3qht_C | 97 | Monobody YSMB-1; fibronectin type III, yeast small | 99.22 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 99.21 | |
| 2b5i_B | 214 | Interleukin-2 receptor beta chain; four-helix bund | 99.2 | |
| 1k85_A | 88 | Chitinase A1; fibronectin type III domain, chitin | 99.2 | |
| 1uc6_A | 109 | CNTF receptor, ciliary neurotrophic factor recepto | 99.19 | |
| 3qwq_B | 114 | Adnectin; cell surface receptor, tyrosine kinase, | 99.19 | |
| 1ujt_A | 120 | KIAA1568 protein; fibronectin type III domain, str | 99.18 | |
| 2cui_A | 112 | Tenascin-X; fibronectin type III domain, extracell | 99.18 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 99.16 | |
| 2cui_A | 112 | Tenascin-X; fibronectin type III domain, extracell | 99.15 | |
| 2ocf_D | 121 | Fibronectin; estrogen receptor, LBD, monobody, est | 99.15 | |
| 1iar_B | 207 | Protein (interleukin-4 receptor alpha chain); cyto | 99.14 | |
| 3teu_A | 98 | Fibcon; FN3 domain, fibronectin TPYE III domain, c | 99.14 | |
| 2b5i_B | 214 | Interleukin-2 receptor beta chain; four-helix bund | 99.13 | |
| 3tes_A | 98 | Tencon; fibronectin type III domain, FN3, consensu | 99.13 | |
| 1k85_A | 88 | Chitinase A1; fibronectin type III domain, chitin | 99.12 | |
| 2dle_A | 104 | Receptor-type tyrosine-protein phosphatase ETA; pr | 99.12 | |
| 2dle_A | 104 | Receptor-type tyrosine-protein phosphatase ETA; pr | 99.12 | |
| 1j8k_A | 94 | Fibronectin; EDA, TYPEIII domain, protein binding; | 99.11 | |
| 3mtr_A | 215 | N-CAM-1, NCAM-1, neural cell adhesion molecule 1; | 99.11 | |
| 3d85_D | 306 | IL-12B, interleukin-12 subunit P40, cytotoxic lymp | 99.1 | |
| 2nzi_A | 305 | Titin; IG-domain, FNIII-domain, transferase; 2.90A | 99.08 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 99.08 | |
| 2dkm_A | 104 | Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, | 99.07 | |
| 3tgx_A | 219 | Interleukin-21 receptor; class I cytokine, class I | 99.06 | |
| 3up1_A | 223 | Interleukin-7 receptor subunit alpha; cytokine rec | 99.04 | |
| 1iar_B | 207 | Protein (interleukin-4 receptor alpha chain); cyto | 99.03 | |
| 2ekj_A | 105 | Collagen alpha-1(XX) chain; KIAA1510, structural g | 99.03 | |
| 3d85_D | 306 | IL-12B, interleukin-12 subunit P40, cytotoxic lymp | 99.0 | |
| 1uc6_A | 109 | CNTF receptor, ciliary neurotrophic factor recepto | 98.98 | |
| 3og6_B | 226 | Interleukin 28 receptor, alpha (interferon, lambd | 98.97 | |
| 2h41_A | 95 | Fibronectin; beta sandwich, cell adhesion, structu | 98.96 | |
| 1wft_A | 123 | 1700129L13RIK protein; FN3 domain, similar to HOST | 98.96 | |
| 1fyh_B | 229 | Interferon-gamma receptor alpha chain; cytokine-re | 98.96 | |
| 2qbw_A | 195 | PDZ-fibronectin fusion protein; fibronectin PDZ, u | 98.94 | |
| 3mpc_A | 103 | FN3-like protein; fibronectin, FN(III), unknown fu | 98.92 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 98.91 | |
| 2h41_A | 95 | Fibronectin; beta sandwich, cell adhesion, structu | 98.9 | |
| 3mpc_A | 103 | FN3-like protein; fibronectin, FN(III), unknown fu | 98.88 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 98.88 | |
| 3dlq_R | 211 | Interleukin-22 receptor subunit alpha-1; cytokine- | 98.83 | |
| 3og6_B | 226 | Interleukin 28 receptor, alpha (interferon, lambd | 98.81 | |
| 1fyh_B | 229 | Interferon-gamma receptor alpha chain; cytokine-re | 98.81 | |
| 3dlq_R | 211 | Interleukin-22 receptor subunit alpha-1; cytokine- | 98.8 | |
| 1oww_A | 98 | FN, fibronectin first type III module, CIG; fibron | 98.79 | |
| 3tgx_A | 219 | Interleukin-21 receptor; class I cytokine, class I | 98.79 | |
| 3csg_A | 461 | MBP, maltose-binding protein monobody YS1 fusion, | 98.69 | |
| 1y6k_R | 214 | Interleukin-10 receptor alpha chain; helix bundle, | 98.65 | |
| 1y6k_R | 214 | Interleukin-10 receptor alpha chain; helix bundle, | 98.64 | |
| 1q38_A | 89 | Fibronectin; amyloid fibril, anastellin, extracell | 98.47 | |
| 3s9d_B | 199 | Interferon alpha/beta receptor 2; human, type I in | 98.45 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 98.44 | |
| 2hft_A | 218 | Human tissue factor; coagulation factor; 1.69A {Ho | 98.44 | |
| 2hft_A | 218 | Human tissue factor; coagulation factor; 1.69A {Ho | 98.43 | |
| 1q38_A | 89 | Fibronectin; amyloid fibril, anastellin, extracell | 98.38 | |
| 3s9d_B | 199 | Interferon alpha/beta receptor 2; human, type I in | 98.38 | |
| 1wft_A | 123 | 1700129L13RIK protein; FN3 domain, similar to HOST | 98.37 | |
| 1oww_A | 98 | FN, fibronectin first type III module, CIG; fibron | 98.26 | |
| 3csg_A | 461 | MBP, maltose-binding protein monobody YS1 fusion, | 98.24 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 98.18 | |
| 1e07_A | 642 | Carcinoembryonic antigen; glycoprotein, CEA, tumou | 97.92 | |
| 3o71_B | 27 | Peptide of deleted in colorectal cancer; protein-p | 97.91 | |
| 3b43_A | 570 | Titin; I-SET IG fold, extended poly-IG filament, e | 97.91 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 97.9 | |
| 3dmk_A | 816 | DOWN syndrome cell adhesion molecule (dscam) ISOF | 97.84 | |
| 3bes_R | 250 | Interferon-gamma binding protein C4R; orthopoxviru | 97.64 | |
| 3pdd_A | 190 | Glycoside hydrolase, family 9; CBHA, beta-sandwich | 97.63 | |
| 3bes_R | 250 | Interferon-gamma binding protein C4R; orthopoxviru | 97.54 | |
| 3b4n_A | 344 | Endo-pectate lyase; pectin, galacturonic acid, rig | 97.25 | |
| 2csp_A | 130 | RIM-BP2, RIM binding protein 2; FN3 domain, struct | 97.06 | |
| 3cxe_C | 120 | Granulocyte-macrophage colony-stimulating factor s | 96.96 | |
| 3pdd_A | 190 | Glycoside hydrolase, family 9; CBHA, beta-sandwich | 96.87 | |
| 2uvf_A | 608 | Exopolygalacturonase; GH28, pectin, cell WALL, hyd | 96.66 | |
| 3b4n_A | 344 | Endo-pectate lyase; pectin, galacturonic acid, rig | 96.61 | |
| 2csp_A | 130 | RIM-BP2, RIM binding protein 2; FN3 domain, struct | 96.57 | |
| 2ocw_A | 585 | Polymeric-immunoglobulin receptor; SC, secretory, | 96.23 | |
| 4go6_A | 45 | HCF N-terminal chain 1; tandem fibronectin repeat, | 96.11 | |
| 3cxe_C | 120 | Granulocyte-macrophage colony-stimulating factor s | 96.02 | |
| 2ocw_A | 585 | Polymeric-immunoglobulin receptor; SC, secretory, | 96.0 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 95.6 | |
| 2uvf_A | 608 | Exopolygalacturonase; GH28, pectin, cell WALL, hyd | 95.6 | |
| 3laf_A | 403 | Deleted in colorectal cancer; netrin-1 receptor, i | 94.28 | |
| 3arx_A | 584 | Chitinase A; TIM barrel, inhibitor complex, glycos | 93.72 | |
| 4gns_A | 290 | Chitin biosynthesis protein CHS5; FN3, BRCT, tetra | 93.29 | |
| 4go6_A | 45 | HCF N-terminal chain 1; tandem fibronectin repeat, | 92.92 | |
| 2v5m_A | 388 | Dscam; neurobiology SPL immunoglobulin domain, cel | 92.37 | |
| 3arx_A | 584 | Chitinase A; TIM barrel, inhibitor complex, glycos | 92.13 | |
| 3kld_A | 384 | Contactin 4, axcam, BIG-2; cell adhesion, protein | 91.74 | |
| 2ec8_A | 524 | MAST/stem cell growth factor receptor; glycoprotei | 91.19 | |
| 2wim_A | 291 | N-CAM 2, NCAM2, neural cell adhesion molecule 2; c | 90.58 | |
| 1cs6_A | 382 | Axonin-1; neural cell adhesion, cell adhesion; 1.8 | 90.47 | |
| 3p3y_A | 404 | Neurofascin; IG domains, cell adhesion; HET: NAG; | 90.04 | |
| 2rik_A | 284 | Titin; I-SET IG fold, poly-IG linear array, struct | 89.8 | |
| 2qfp_A | 424 | Purple acid phosphatase; binuclear, Fe-Zn, hydrola | 89.29 | |
| 3v2a_R | 772 | Vascular endothelial growth factor receptor 2; IG- | 89.17 | |
| 4gns_A | 290 | Chitin biosynthesis protein CHS5; FN3, BRCT, tetra | 89.15 | |
| 1bih_A | 395 | Hemolin; insect immunity, LPS-binding, homophilic | 88.88 | |
| 1q55_A | 880 | EP-cadherin, C-cadherin; trans interaction, desmos | 87.38 | |
| 2w91_A | 653 | Endo-beta-N-acetylglucosaminidase D; hydrolase, N- | 86.95 | |
| 1xzw_A | 426 | Purple acid phosphatase; hydrolase; HET: NAG FUC M | 85.7 | |
| 1edq_A | 540 | Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1 | 85.4 | |
| 2qfp_A | 424 | Purple acid phosphatase; binuclear, Fe-Zn, hydrola | 85.04 | |
| 1xzw_A | 426 | Purple acid phosphatase; hydrolase; HET: NAG FUC M | 84.16 | |
| 4a2l_A | 795 | BT_4663, two-component system sensor histidine kin | 83.74 | |
| 1f97_A | 212 | Junction adhesion molecule; immunoglobulin superfa | 81.77 | |
| 2w91_A | 653 | Endo-beta-N-acetylglucosaminidase D; hydrolase, N- | 81.44 | |
| 1qz1_A | 291 | Neural cell adhesion molecule 1, 140 kDa isoform; | 81.09 | |
| 3ott_A | 758 | Two-component system sensor histidine kinase; beta | 80.69 |
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} | Back alignment and structure |
|---|
Probab=100.00 E-value=4.5e-44 Score=400.39 Aligned_cols=461 Identities=18% Similarity=0.240 Sum_probs=348.3
Q ss_pred cccCCCCCCcccEEEEEcCcEEEEEEcCCCCCCCcceEEEEEEEEcCCCCceEEeeccccceE-ee-CCcCCCEEEEEEE
Q psy241 52 ETLTLPSAPQSVSAIMVGPRSVALRWLPPTLPRGEILVYCVLYKREGSERERAYNATARVEAI-IQ-GLHPNTSYTFRVV 129 (753)
Q Consensus 52 ~~~~~P~~P~~l~~~~~~~~si~lsW~~~~~~~~~~~~Y~v~~~~~~~~~~~~~~~~~~~~~~-i~-~L~p~t~Y~~~V~ 129 (753)
....+|++|.+|++...+..++.|+|.++.+. +.+..|.|+|+..+.....+........++ +. +|.+++.|.|+|.
T Consensus 98 ~v~~pP~~P~nl~c~~~~~~~~~~~W~~~~~~-~~~~~y~l~~~~~~~~~~~c~~~~~~~~~c~~~~~l~~~~~Y~~~v~ 176 (589)
T 3l5h_A 98 ISGLPPEKPKNLSCIVNEGKKMRCEWDGGRET-HLETNFTLKSEWATHKFADCKAKRDTPTSCTVDYSTVYFVNIEVWVE 176 (589)
T ss_dssp CC-CCCCCCEEEEEEEETTSCEEEEEECCSCC-SSCEEEEECCBCSSSBCCCEECBTTBSSCCBCCSCCCSSSCEEECEE
T ss_pred eccCCCCCCEeeEEEECCCceEEEEECCCCcC-CcCceEEEEEEEcCCCcccCCCCCCCcEEEEECCCCchheeEEEEEE
Confidence 45578999999999999999999999998754 457899999876554444444333344666 76 8999999999999
Q ss_pred EEeCCCCccCCCceEEEccCCCCCCCCCcceEE--eeecCcEEEEEEeCCCCCCCcceEEEEEEEEcCCcceEEE-----
Q psy241 130 AYNALGAGLASSALPVKTEPEDHVPSPPLNVNI--PVVGTSSLLVTWEKPTVTNGEIKHYTLYYLEEDTSVERHV----- 202 (753)
Q Consensus 130 a~~~~g~~~~s~~~~~~t~~~~~~P~~p~~l~~--~~~~~~sv~lsW~~p~~~~~~~~~Y~v~~~~~~~~~~~~~----- 202 (753)
|.|..|.+. +..+.+.+... ..|.+|.++.+ ...+.+++.|+|++|...++.+.+|.|+|+..+...+..+
T Consensus 177 a~n~~G~~~-s~~~~~~~~~~-~~p~pP~~~~~~~~~~~~~~v~l~W~~p~~~~~~~~~Y~v~~~~~~~~~w~~~~~~~~ 254 (589)
T 3l5h_A 177 AENALGKVT-SDHINFDPVYK-VKPNPPHNLSVINSEELSSILKLTWTNPSIKSVIILKYNIQYRTKDASTWSQIPPEDT 254 (589)
T ss_dssp EEESSCCBC-CCCEEECGGGS-EECCCCCSCEEECTTTCTTCEEEECCCCGGGGTSCEEEEEEEEETTCSCCBCCCTTSS
T ss_pred EEeCCCCcc-cccEEEccccE-EEcCCCceEEEEecCCCCCeEEEEeCCCCCCCeeeEEEEEEECCCCCCCcEEEccccC
Confidence 999999864 34444544322 36889999998 4568899999999998777889999999999876655443
Q ss_pred eecccEEEEcCCCCCcEEEEEEEEEeCCCCCCC---CceeEEEecCCCCCCCCC-------------CcEEEEEeCCCCC
Q psy241 203 VTPQLSYELTGLSHFTLYSIWVVAHNGNGAGTT---SQELSVQTLSDKPSEPPA-------------NSITVRWQPPSRR 266 (753)
Q Consensus 203 ~~~~~~~~i~~L~p~t~Y~~~V~a~n~~g~~~~---s~~~~~~t~~~~p~~~~~-------------~si~l~W~~p~~~ 266 (753)
....+++.+.+|.|++.|.|+|+|.|..|.|.+ |..+.+.|.+.+|..++. .++.|+|+++...
T Consensus 255 ~~~~~~~~i~~L~p~t~Y~~~V~a~~~~g~g~~S~~S~~~~~~T~~~~P~~~p~~~~~v~~~~~~~~~~v~l~W~p~~~~ 334 (589)
T 3l5h_A 255 ASTRSSFTVQDLKPFTEYVFRIRCMKEDGKGYWSDWSEEASGITYEDRPSKAPSFWYKIDPSHTQGYRTVQLVWKTLPPF 334 (589)
T ss_dssp CSCCSEEEECSCCSSCCEEEEEEEEESSSCSCCCCCCCCBCCCCCCCCCCSCCCEEEECCSCSSTTSCCEEEEECCCCTT
T ss_pred cCceeEEEECCCCCCCEEEEEEEEEeCCCCCccCCCCCccccccCccCCCCCCcEEEEeecCcCCCcceEEEEEeeCCch
Confidence 334588999999999999999999999988655 566778888888754443 1899999987767
Q ss_pred CCCceeeEEEEEEEEcCccCCCCcEEEecCceeEEEEcCCCCCCeEEEEEEEEeCCCCCCCCcceeeeeeeccCCCcccC
Q psy241 267 GQNGIITGYKLRYKKKDVKKDKGETVTTAGDRRLYVITGLNKSTTYQIKLWAMNVNGSGPATDWFSAETFSQDLGEFTVP 346 (753)
Q Consensus 267 ~~~~~~~~Y~v~~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~t~Y~i~V~a~~~~g~~~~s~~~~~~t~~~~~~~~~~p 346 (753)
+.+|.+.+|+|.|+..+... .. .......+.+ |.+++.|.|+|+|.|..|.|+.+..... +. ...+|
T Consensus 335 ~~~g~i~~Y~v~~~~~~~~~---~~--~~~~~~~~~~--l~~~~~Y~~~V~A~n~~G~~~~s~~~~~-~~-----~~~~~ 401 (589)
T 3l5h_A 335 EANGKILDYEVTLTRWKSHL---QN--YTVNATKLTV--NLTNDRYLATLTVRNLVGKSDAAVLTIP-AC-----DFQAT 401 (589)
T ss_dssp TSSSCCCEEEEEECCTTSCC---CB--CCCSSSCCEE--CCCSSCCCEEEEEEBTTBCCCCCCCCCC-CT-----TCCCC
T ss_pred hccCceeeEEEEEecCCCCc---ee--eccCCceEEE--EeCCCCEEEEEEEEeCCccCCCeEEEee-cc-----cccCC
Confidence 78999999999997665321 11 2233344443 8899999999999999999988754322 11 11245
Q ss_pred CCCcceeeecCCCCeEEEEEeCCCCCCcceeEEEEEEeeCCCCcc---EEEEe-cCcccEEEeCCCCCCCeEEEEEEEEc
Q psy241 347 DIPASLKARPGGPSSIIVSWTPPADQSIMVRGFTLGWGKGVPDEF---VKQIL-DVKQRSDEITGLEPNSDYVISLRAFN 422 (753)
Q Consensus 347 ~~p~~~~~~~~~~~~v~l~W~~~~~~~~~i~~Y~v~~~~~~~~~~---~~~~~-~~~~~~~~i~~L~p~~~Y~v~V~a~~ 422 (753)
.++.++.+...+ +++.|+|+++.. .+.+|.|+|........ ....+ ......+.+.+|.|++.|.|+|+|++
T Consensus 402 ~p~~~l~~~~~~-~si~l~W~~p~~---~i~~Y~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~p~t~Y~~~V~A~~ 477 (589)
T 3l5h_A 402 HPVMDLKAFPKD-NMLWVEWTTPRE---SVKKYILEWCVLSDKAPCITDWQQEDGTVHRTYLRGNLAESKCYLITVTPVY 477 (589)
T ss_dssp SCCCSCEEEECS-SSEEEECCCCSS---CCSCBCCEEEEECSSSCCCEEECCBCSSCCEEECCSCCCSSSEEEEEECBEE
T ss_pred CCcceEEEEECC-CeEEEEEECCCC---CccEEEEEEEECCCCCCCccCcEEeeCCcceEEehhccccCcEEEEEEEEEe
Confidence 566788888764 899999999875 48999999987654321 11222 33344667799999999999999999
Q ss_pred CCCCCCCceeEEEecCCCCCCCCCCCCCCceeEEEecCCCeEEEEEeCCCCCcccccCCCCccEEEEEEEeecCCCCCce
Q psy241 423 EMGDGPQKYESLRTRNEPPPQAPKVLIPPMGLKSEVLSPYSMRISWIDTTLPDQFQQHGEEGRHYLVRYTHLLGASNPRY 502 (753)
Q Consensus 423 ~~G~~~~s~~~~~t~~~~~p~~~~p~~~p~~l~~~~~~~~sv~v~W~~p~~~~~~~~~~~~~~~Y~v~~~~~~~~~~~~~ 502 (753)
..|.|.++.....+.. ..|. +|.++.+...+.+++.|+|.++.. ....+.+.+|.|+|+..++ ....
T Consensus 478 ~~g~g~~~~~~~~t~~-~~P~------~pp~l~~~~~~~~sv~l~W~~~~~----~~~~g~i~~Y~v~~~~~~~--~~~~ 544 (589)
T 3l5h_A 478 ADGPGSPESIKAYLKQ-APPS------KGPTVRTKKVGKNEAVLEWDQLPV----DVQNGFIRNYTIFYRTIIG--NETA 544 (589)
T ss_dssp TTEECCCEEEEEESSC-CCCS------SCCCCCEECCCSSCBEEBCCCCCH----HHHCSCEEEEEECCBCSSC--CCCC
T ss_pred CCcccCCEEEEEEecc-CCCC------CCCeEEEeecccceEEEEecCCCH----HHcCccceeEEEEEEeCCC--CeEE
Confidence 9999988765555433 3333 334688888999999999998532 1224678899999987653 2234
Q ss_pred EEeccccceEEecCcccCceeEEEEEEEeCCCCCcceEEEEeee
Q psy241 503 KYINANITSVQINDLRPSTQYEFTVKVVRAKKESEWSMIVLNTT 546 (753)
Q Consensus 503 ~~~~~~~~~~~l~~L~p~t~Y~~~V~a~~~~g~s~~s~~~~~~t 546 (753)
...+...+++++.+|.|++.|.|+|+|.+..| +.++..+.++|
T Consensus 545 ~~~~~~~~~~~~~~L~p~t~Y~~~V~A~n~~G-~~~S~~~~~~T 587 (589)
T 3l5h_A 545 VNVDSSHTEYTLSSLTSDTLYMVRMAAYTDEG-GKDGPEFTFTT 587 (589)
T ss_dssp EEECTTCCBCCBCSCCSSCCEECCEEEEETTE-EEECCCCEECC
T ss_pred EEeCCcccEEEecCCCCCCEEEEEEEEEeCCC-CCCCCCeEEec
Confidence 56678889999999999999999999999999 77777777766
|
| >3l5h_A Interleukin-6 receptor subunit beta; IG-like, FNIII, cell membrane, disulfide bond, glycoprotein, immunoglobulin domain, membrane, phosphoprotein; HET: NAG NDG BMA FUC; 3.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1zlg_A Anosmin 1; insulin-like growth factor receptor Cys-rich fold, WHEY acidic protein fold, fibronectin type III fold, hormone- growth factor complex; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B | Back alignment and structure |
|---|
| >3t1w_A Four-domain fibronectin fragment; human fibronectin, FN type-III domain, oncofetal splice VARI extra-domain B, EIIIB, ED-B, angiogenesis, integrin; 2.40A {Homo sapiens} PDB: 4gh7_B | Back alignment and structure |
|---|
| >1fnf_A Fibronectin; RGD, extracellular matrix, cell adhesion protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1mfn_A 2mfn_A 2ck2_A | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2v5y_A Receptor-type tyrosine-protein phosphatase MU; membrane, hydrolase, glycoprotein, receptor protei tyrosine phosphatase, cell adhesion; HET: NAG; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* | Back alignment and structure |
|---|
| >3se4_A Interferon alpha/beta receptor 1; type I interferon signaling complex, extracellular space, IM system receptor; HET: NAG; 3.50A {Homo sapiens} PDB: 3se3_A* | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E | Back alignment and structure |
|---|
| >3r8q_A Fibronectin; heparin, FNIII, heparin binding, cell adhesion; 2.40A {Homo sapiens} PDB: 1fnh_A | Back alignment and structure |
|---|
| >1tdq_A Tenascin-R; extracellular matrix, lecticans, tenascins, protein-protein interactions, C-type lectin domain; 2.60A {Rattus norvegicus} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3l5i_A Interleukin-6 receptor subunit beta; cytokine receptor, fibronectin type III domain, alternative cell membrane, disulfide bond; 1.90A {Homo sapiens} PDB: 3l5j_A | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3s98_A Interferon alpha/beta receptor 1; human, type I interferons, receptor chain, ifnar1, fibronect III, type I interferon receptor chain; HET: NAG; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3p4l_A Neogenin; iron homeostasis, hemojuvelin receptor, FNIII domain, fibron type III, cell adhesion; 1.80A {Homo sapiens} PDB: 1x5k_A | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* | Back alignment and structure |
|---|
| >1cfb_A Drosophila neuroglian; neural adhesion molecule; HET: NAG; 2.00A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A | Back alignment and structure |
|---|
| >3f7q_A Integrin beta-4, GP150; hemidesmosome, cell adhesion, carcinoma, epidermolysis bullosa, alternative splicing, disease mutation, glycoprotein; HET: 1PE PG4; 1.75A {Homo sapiens} PDB: 3f7r_A 3f7p_C 1qg3_A | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A | Back alignment and structure |
|---|
| >2q7n_A Leukemia inhibitory factor receptor; cytokine cell surface receptor complex LIFR LIF, cytokine RE cytokine complex; HET: NAG FUC MAN; 4.00A {Mus musculus} | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2vkw_A Neural cell adhesion molecule 1,140 kDa isoform; adhesion receptor; 2.3A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 2vkx_A 1lwr_A | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A | Back alignment and structure |
|---|
| >2gys_A Cytokine receptor common beta chain; dimer of interlocking chains of fibronectin-III domains, FOU fibronectin-III domains PER chain; HET: NAG FUC BMA NDG; 2.70A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1gh7_A* 3cxe_A* 1egj_A* 1c8p_A | Back alignment and structure |
|---|
| >1bqu_A Protein (GP130); cytokine receptor, glycoprotein 130, interleukine 6 R beta subunit, signaling protein; 2.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1pvh_A 1bj8_A | Back alignment and structure |
|---|
| >2ibg_A CG9211-PA, GH03927P; IHOG, fibronectin type III, protein binding; 2.20A {Drosophila melanogaster} SCOP: b.1.2.1 b.1.2.1 PDB: 2ibb_A | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A | Back alignment and structure |
|---|
| >3lpw_A A77-A78 domain from titin; intracellular FNIII-tandem, structural protein; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A | Back alignment and structure |
|---|
| >3bpo_C Interleukin-13 receptor alpha-1 chain; IL4, IL13, IL4R, IL13R, cytokine, glycoprotein, IM response, membrane, phosphoprotein, secreted; HET: NAG; 3.00A {Homo sapiens} PDB: 3bpn_C* | Back alignment and structure |
|---|
| >3lb6_C IL-13, interleukin-13 receptor subunit alpha-2; cytokine, decoy, decoy receptor, glycoprotein; HET: MLY NAG; 3.05A {Homo sapiens} PDB: 3lb6_D* | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1qr4_A Protein (tenascin); fibronectin type-III, heparin, extracellular matrix, adhesion, fusion protein, structural protein; 2.55A {Gallus gallus} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >1i1r_A GP130, interleukin-6 receptor beta chain; cytokine/receptor complex, GP130; 2.40A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 PDB: 1p9m_A | Back alignment and structure |
|---|
| >2gee_A Hypothetical protein; fibronectin, EIIIB, cancer, neovascularization, cell adhesion, protein binding, oncoprotein; 2.01A {Homo sapiens} PDB: 2fnb_A | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* | Back alignment and structure |
|---|
| >3fl7_A Ephrin receptor; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase, glycoprotein; HET: NAG; 2.50A {Homo sapiens} PDB: 2x10_A* 2x11_A 3mx0_A* 3mbw_A* | Back alignment and structure |
|---|
| >3e0g_A Leukemia inhibitory factor receptor; IG domain, cytokine binding homology region (CHR), cell MEMB disease mutation, glycoprotein, membrane; HET: NAG MAN FUC; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2ha1_A Fibronectin; beta sandwich, protein-protein complex, rigid BODY docking, cell adhesion, structural protein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A | Back alignment and structure |
|---|
| >3n06_B PRL-R, prolactin receptor; PH dependence, hematopoietic cytokine, hormone-hormone recep complex; 2.00A {Homo sapiens} PDB: 3mzg_B 3n0p_B 3ncb_B 1bp3_B 3d48_R 3nce_B 3ncc_B 3ncf_B 3ew3_B 3npz_B 1f6f_B 2lfg_A | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >1cd9_B G-CSF-R, protein (G-CSF receptor); class1 cytokine, hematopoietic receptor, signal transduction cytokine; HET: NAG; 2.80A {Mus musculus} SCOP: b.1.2.1 b.1.2.1 PDB: 1pgr_B 1cto_A 1gcf_A | Back alignment and structure |
|---|
| >2d9q_B Granulocyte colony-stimulating factor receptor; cytokine, ligand-receptor complex, signaling protein-cytokin; HET: NAG; 2.80A {Homo sapiens} SCOP: b.1.1.3 b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3lqm_A Interleukin-10 receptor subunit beta; IL-10R2, common chain, cytokine, IL-10, IL-22, IL- 28, IL-29, disulfide bond, glycoprotein, membrane; 2.14A {Homo sapiens} | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A | Back alignment and structure |
|---|
| >1n26_A IL-6 receptor alpha chain; transmembrane, glycoprotein, immunoglobulin domain, cytokine; HET: NAG BMA MAN NDG; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 1p9m_C 2arw_A | Back alignment and structure |
|---|
| >4go6_B HCF C-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1axi_B HGHBP, growth hormone receptor; complex (hormone-receptor), complex (hormone-receptor) compl; 2.10A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1a22_B 1kf9_B 1hwg_B 1hwh_B 3hhr_B 2aew_A | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4doh_R Interleukin-20 receptor subunit alpha; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A | Back alignment and structure |
|---|
| >4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ed9_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfo_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5g_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} | Back alignment and structure |
|---|
| >1eer_B Epobp, erythropoietin receptor; signal transduction, hematopoietic cytokine, cytokine receptor class 1, complex (cytokine/receptor); 1.90A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1cn4_A 2jix_B 1eba_A* 1ern_A 1ebp_A | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3v6o_A Leptin receptor; receptor-antibody complex, cytokine receptor, antibody FAB F immunoglobulin fold; HET: NAG; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x3d_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2edx_A Protein tyrosine phosphatase, receptor type, F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qt2_A Interleukin-5 receptor subunit alpha; cytokine type I receptor fold, fibronectin type III modules, helical bundle, cytokine, ligand-receptor complex; HET: BGC; 2.55A {Homo sapiens} PDB: 3va2_C | Back alignment and structure |
|---|
| >3g9v_A Interleukin 22 receptor, alpha 2; cytokine, cytokine receptor, receptor, glycoprotein, polymorphism, secreted, cytokine/cytokine receptor complex; 2.76A {Homo sapiens} | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ed8_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1x4x_A Fibronectin type-III domain containing protein 3A; FN3, immunoglobulin-like beta- sandwich fold, KIAA0970, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >4doh_B Interleukin-20 receptor subunit beta; IL10 family cytokine receptor complex, alpha helical cytokin beta sandwhich receptor fold, signaling complex; HET: NAG; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} | Back alignment and structure |
|---|
| >1x5i_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dm4_A Sortilin-related receptor; beta-sandwich, sorting protein-related receptor containing LDLR class A repeats, sorla; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ee2_A Contactin-1; neural cell surface protein F3, glycoprotein GP135, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5f_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2edd_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x5h_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5z_A Receptor-type tyrosine-protein phosphatase delta; fibronectin type III domain containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2djs_A Ephrin type-B receptor 1; tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wj3_A KIAA1496 protein; beta sandwich, PANG, structural genomics, riken structural genomics/proteomics initiative, RSGI, neuropeptide; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5x_A Fibronectin type-III domain containing protein 3A; structural genomics, KIAA0970, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dbj_A Proto-oncogene tyrosine-protein kinase MER precursor; C-MER, receptor tyrosine kinase mertk, FN3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ed7_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2crm_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2e7h_A Ephrin type-B receptor 4; FN3 domain, tyrosine- protein kinase receptor HTK, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1v5j_A KIAA1355 protein, RSGI RUH-008; FN3 domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dlh_A Receptor-type tyrosine-protein phosphatase delta; protein-tyrosine phosphatase delta, R-PTP-delta, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wis_A KIAA1514 protein; FNIII domain, sidekick-2, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfn_A Sidekick 2; FN3, cell adhesion, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1uem_A KIAA1568 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dju_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2crz_A Fibronectin type-III domain containing protein 3A; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2e3v_A Neural cell adhesion molecule 1, 140 kDa isoform; NCAM, N-CAM 1, NCAM-120, CD56 antigen, membra protein, glycoprotein, structural genomics, NPPSFA; HET: PGE BTB; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1x5l_A Ephrin type-A receptor 8; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dn7_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5j_A Neogenin; RGM binding, fibronectin type III domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1va9_A DOWN syndrome cell adhesion molecule like- protein 1B; FNIII domain, dscaml1 protein, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2haz_A N-CAM 1, neural cell adhesion molecule 1; fibronectin type III repeat, FN1, beta sandwich; 1.70A {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2w1n_A O-GLCNACASE NAGJ; hexosaminidase, glycoside hydrolase, fibronectin type-III, beta-N-acetylglucosaminidase, cohesin, hydrolase; 1.80A {Clostridium perfringens} | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1uey_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, NG-CAM related cell adhesion molecule, fibronectin type III domain, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1wf5_A Sidekick 2 protein; FNIII domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2yrz_A Integrin beta-4; GP150, CD104 antigen, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ede_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1uen_A KIAA0343 protein; immunoglobulin-like beta-sandwich fold, fibronectin type III, NG-CAM related cell adhesion molecule, structural genomics; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3t04_D Monobody 7C12; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1wfu_A Unnamed protein product; FN3 domain, similar to 1700007B22RIK protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2edb_A Netrin receptor DCC; tumor suppressor protein DCC, colorectal cancer suppressor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4z_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1x5y_A Myosin binding protein C, fast-type; fast MYBP-C, fibronectin type III domain containing protein, cytoskeleton, muscle contraction; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x4y_A Biregional cell adhesion molecule-related/DOWN- regulated oncogenes (CDON)binding...; fibronectin type III, FN3; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1x5a_A Ephrin type-A receptor 1; tyrosine-protein kinase receptor, ESK, fibronectin type III (FN3) domain, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2edy_A Receptor-type tyrosine-protein phosphatase F; LAR protein, leukocyte antigen related, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yuw_A Myosin binding protein C, SLOW type; fibronectin III domain, SLOW- type protein, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ee3_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} | Back alignment and structure |
|---|
| >3n1f_C Cell adhesion molecule-related/DOWN-regulated BY; binding sites, calcium, cell adhesion molecules, cell cycle cell LINE, conserved sequence; 1.60A {Homo sapiens} SCOP: b.1.2.1 PDB: 3d1m_C 3n1q_C 3n1m_C 3n1g_C 3n1p_C | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1bpv_A Titin, A71, connectin; fibronectin type III; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2kbg_A N-CAM 2, neural cell adhesion molecule 2; fibronectin type III module, beta-sheet sandwich, cell membrane, glycoprotein, immunoglobulin domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A | Back alignment and structure |
|---|
| >2erj_C Cytokine receptor common gamma chain; immune system-cytok complex; HET: NAG FUC BMA; 3.00A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 | Back alignment and structure |
|---|
| >1wk0_A KIAA0970 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} | Back alignment and structure |
|---|
| >2db8_A Tripartite motif protein 9, isoform 2; ring finger protein 91, TRIM9, KIAA0282, RNF91, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cum_A Tenascin-X; hexabrachion-like, fibronectin type III domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2b5i_C Cytokine receptor common gamma chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_C* 3qb7_C* 3qaz_C* | Back alignment and structure |
|---|
| >2cuh_A Tenascin-X; fibronectin type III domain, extracellular matrix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3k2m_C Monobody HA4; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_D 1ttf_A 1ttg_A 3rzw_A 1fna_A | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A | Back alignment and structure |
|---|
| >2yux_A Myosin-binding protein C, SLOW-type; fibronectin III domain, structural genomics., NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2rb8_A Tenascin; beta sheet,loop design, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix, glycoprotein; 1.45A {Homo sapiens} PDB: 2rbl_A 1ten_A | Back alignment and structure |
|---|
| >3b83_A Ten-D3; beta sheet, computational redesigned protein, alternative splicing, cell adhesion, coiled coil, EGF-like domain, extracellular matrix; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2ic2_A CG9211-PA, GH03927P; IHOG, hedgehog, fibronectin type III, protein binding; HET: MSE; 1.30A {Drosophila melanogaster} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dmk_A Midline 2 isoform 2; midline defect 2, tripartite motif protein 1, midin-2, ring finger protein 60, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* | Back alignment and structure |
|---|
| >3qht_C Monobody YSMB-1; fibronectin type III, yeast small ubiquitin-like modifier, S NOVO protein; 2.40A {Artificial gene} | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* | Back alignment and structure |
|---|
| >1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3qwq_B Adnectin; cell surface receptor, tyrosine kinase, glycoprotein, adnect antitumor, drug, engineered binding protein; HET: NAG BMA MAN FUC; 2.75A {Homo sapiens} PDB: 3qwr_D* | Back alignment and structure |
|---|
| >1ujt_A KIAA1568 protein; fibronectin type III domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2cui_A Tenascin-X; fibronectin type III domain, extracellular matirx, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ocf_D Fibronectin; estrogen receptor, LBD, monobody, estradiol, hormone-growth complex; HET: CME EST; 2.95A {Homo sapiens} | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* | Back alignment and structure |
|---|
| >3teu_A Fibcon; FN3 domain, fibronectin TPYE III domain, consensus design, S de novo protein; HET: DIO; 1.00A {Synthetic} | Back alignment and structure |
|---|
| >2b5i_B Interleukin-2 receptor beta chain; four-helix bundle, fibronectin domain, cytokine-cytokine REC complex; HET: NAG; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3qaz_B* 2erj_B* | Back alignment and structure |
|---|
| >3tes_A Tencon; fibronectin type III domain, FN3, consensus design, de novo; 2.50A {Synthetic} | Back alignment and structure |
|---|
| >1k85_A Chitinase A1; fibronectin type III domain, chitin binding domain, carbohydrase, horizontal gene transfer, hydrolase; NMR {Bacillus circulans} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dle_A Receptor-type tyrosine-protein phosphatase ETA; protein-tyrosine phosphatase ETA, R-PTP-ETA, HPTP ETA, protein-tyrosine phosphatase receptor type J; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1j8k_A Fibronectin; EDA, TYPEIII domain, protein binding; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* | Back alignment and structure |
|---|
| >2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dkm_A Collagen alpha-1(XX) chain; FN3 domain, KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3up1_A Interleukin-7 receptor subunit alpha; cytokine receptor, fibronectin type 3 fold, membrane and SOL glycosylation, immune system; HET: NAG FUC NGA; 2.15A {Homo sapiens} PDB: 3di3_B* 3di2_B* | Back alignment and structure |
|---|
| >1iar_B Protein (interleukin-4 receptor alpha chain); cytokine receptor,interleukin-4, cytokine/receptor complex; 2.30A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 3bpl_B* 3bpn_B* 3bpo_B* | Back alignment and structure |
|---|
| >2ekj_A Collagen alpha-1(XX) chain; KIAA1510, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3d85_D IL-12B, interleukin-12 subunit P40, cytotoxic lymphocyte; FAB, immune system/cytokine complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 b.1.2.1 b.1.2.1 PDB: 3d87_B* 3duh_A* 1f42_A* 1f45_A* 3hmx_A* 3qwr_A* | Back alignment and structure |
|---|
| >1uc6_A CNTF receptor, ciliary neurotrophic factor receptor alpha; cytokine, leukemia inhibitory factor, cytokine receptor; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A | Back alignment and structure |
|---|
| >1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I | Back alignment and structure |
|---|
| >2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A | Back alignment and structure |
|---|
| >3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >2h41_A Fibronectin; beta sandwich, cell adhesion, structural protein; NMR {Homo sapiens} PDB: 2h45_A | Back alignment and structure |
|---|
| >3mpc_A FN3-like protein; fibronectin, FN(III), unknown function; 1.60A {Clostridium thermocellum} | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* | Back alignment and structure |
|---|
| >3og6_B Interleukin 28 receptor, alpha (interferon, lambd receptor); helical bundle, fibronectin type III domain, beta-sandwich, signaling, membrane; HET: BMA NAG; 2.10A {Homo sapiens} PDB: 3og4_B* | Back alignment and structure |
|---|
| >1fyh_B Interferon-gamma receptor alpha chain; cytokine-receptor complex, fibronectin type-III, immune system; 2.04A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1fg9_C 1jrh_I | Back alignment and structure |
|---|
| >3dlq_R Interleukin-22 receptor subunit alpha-1; cytokine-receptor complex, fibronectin-III, cytokine, glycoprotein, polymorphism, secreted, membrane; 1.90A {Homo sapiens} PDB: 3dgc_R* | Back alignment and structure |
|---|
| >1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3tgx_A Interleukin-21 receptor; class I cytokine, class I cytokine receptor, sugarbridge, fibronectine domain, signaling, cytokine-cytokine receptor; HET: MAN FUL NAG BMA FUC; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* | Back alignment and structure |
|---|
| >1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R | Back alignment and structure |
|---|
| >1y6k_R Interleukin-10 receptor alpha chain; helix bundle, receptor complex, immune system; 2.52A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1j7v_R* 1lqs_R 1y6m_R 1y6n_R | Back alignment and structure |
|---|
| >1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... | Back alignment and structure |
|---|
| >2hft_A Human tissue factor; coagulation factor; 1.69A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 PDB: 1jps_T 1ahw_C 1boy_A 1tfh_A 1wtg_T* 1wss_T* 1wqv_T* 1wun_T* 1wv7_T* 2zp0_T* 2zwl_T* 2zzu_T* 1z6j_T* 2aei_T* 2flb_T* 2b7d_T* 2f9b_T* 1o5d_T* 2flr_T* 1w0y_T* ... | Back alignment and structure |
|---|
| >1q38_A Fibronectin; amyloid fibril, anastellin, extracellular matrix, dynamic fluctuations, conformational exchange, chaps, cell adhesion; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3s9d_B Interferon alpha/beta receptor 2; human, type I interferons, IFNA2, ifnar2, SUB-complex of the interferon signaling complex; 2.00A {Homo sapiens} PDB: 1n6u_A 1n6v_A 2hym_A 2ksx_B 2kz1_B 2lag_B 3se4_C* 3se3_C* 3s8w_A* | Back alignment and structure |
|---|
| >1wft_A 1700129L13RIK protein; FN3 domain, similar to HOST cell factor 2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >1oww_A FN, fibronectin first type III module, CIG; fibronectin type III module, structural protein; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A | Back alignment and structure |
|---|
| >1e07_A Carcinoembryonic antigen; glycoprotein, CEA, tumour marker, immunoglobulin-fold; NMR {Homo sapiens} PDB: 2dks_A | Back alignment and structure |
|---|
| >3o71_B Peptide of deleted in colorectal cancer; protein-peptide complex, kinase, DCC, transferase-protein BI complex; 1.95A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3b43_A Titin; I-SET IG fold, extended poly-IG filament, elastic FIL structural protein; 3.30A {Oryctolagus cuniculus} | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3dmk_A DOWN syndrome cell adhesion molecule (dscam) ISOF 1.30.30, N-terminal eight IG domains...; immunoglobulin domain; HET: NAG NDG; 4.19A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3bes_R Interferon-gamma binding protein C4R; orthopoxvirus, protein complex antiviral defense, cytokine, glycoprotein, receptor, immune; HET: NAG BMA; 2.20A {Ectromelia virus} | Back alignment and structure |
|---|
| >3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A | Back alignment and structure |
|---|
| >3bes_R Interferon-gamma binding protein C4R; orthopoxvirus, protein complex antiviral defense, cytokine, glycoprotein, receptor, immune; HET: NAG BMA; 2.20A {Ectromelia virus} | Back alignment and structure |
|---|
| >3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A | Back alignment and structure |
|---|
| >2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A | Back alignment and structure |
|---|
| >2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* | Back alignment and structure |
|---|
| >3b4n_A Endo-pectate lyase; pectin, galacturonic acid, right-handed parallel beta helix fold; 1.45A {Erwinia chrysanthemi} PDB: 3b8y_A* 3b90_A | Back alignment and structure |
|---|
| >2csp_A RIM-BP2, RIM binding protein 2; FN3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.2.1 | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J | Back alignment and structure |
|---|
| >4go6_A HCF N-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3cxe_C Granulocyte-macrophage colony-stimulating factor subunit alpha; GM-CSF, receptor complex, dodecamer, disease mutation, glyco membrane; HET: NAG BMA; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A | Back alignment and structure |
|---|
| >2uvf_A Exopolygalacturonase; GH28, pectin, cell WALL, hydrolase, periplasm, beta-helix, glycosidase, EXO-activity; HET: AD0; 2.1A {Yersinia enterocolitica} PDB: 2uve_A* | Back alignment and structure |
|---|
| >3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* | Back alignment and structure |
|---|
| >4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4go6_A HCF N-terminal chain 1; tandem fibronectin repeat, protein interaction, transcriptio protein binding; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* | Back alignment and structure |
|---|
| >3arx_A Chitinase A; TIM barrel, inhibitor complex, glycosidase, hydrolase, hydro hydrolase inhibitor complex; HET: POY; 1.16A {Vibrio harveyi} PDB: 3aro_A* 3arp_A* 3arr_A* 3arv_A* 3arw_A* 3arq_A* 3ary_A* 3arz_A* 3b8s_A 3b9e_A 3b9a_A* 3b9d_A 3as2_A* 3ars_A* 3art_A* 3as0_A* 3as1_A* 3aru_A* 3as3_A* | Back alignment and structure |
|---|
| >3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* | Back alignment and structure |
|---|
| >2ec8_A MAST/stem cell growth factor receptor; glycoprotein, receptor tyrosine kinase, growth factor cytoki dimerization, transferase; HET: NAG; 3.00A {Homo sapiens} PDB: 2e9w_A* | Back alignment and structure |
|---|
| >2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A | Back alignment and structure |
|---|
| >3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* | Back alignment and structure |
|---|
| >2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A | Back alignment and structure |
|---|
| >2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* | Back alignment and structure |
|---|
| >3v2a_R Vascular endothelial growth factor receptor 2; IG-homology domain, vegfr-2, growth factor receptor, VEGF LI hormone-signaling protein complex, angiogenesis; 3.20A {Homo sapiens} PDB: 3v6b_R | Back alignment and structure |
|---|
| >4gns_A Chitin biosynthesis protein CHS5; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 | Back alignment and structure |
|---|
| >1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* | Back alignment and structure |
|---|
| >2w91_A Endo-beta-N-acetylglucosaminidase D; hydrolase, N-glycan, secreted, oxazoline, NAG-thiazoline, substrate-participation; 1.40A {Streptococcus pneumoniae} PDB: 2w92_A* | Back alignment and structure |
|---|
| >1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 | Back alignment and structure |
|---|
| >1edq_A Chitinase A; beta-alpha (TIM) barrel, hydrolase; 1.55A {Serratia marcescens} SCOP: b.1.18.2 c.1.8.5 d.26.3.1 PDB: 1ffq_A* 1ffr_A* 1ehn_A* 1ctn_A 1k9t_A* 1eib_A* 2wlz_A* 2wly_A* 2wm0_A* 2wk2_A* 1nh6_A* 1x6l_A 1rd6_A 1x6n_A* | Back alignment and structure |
|---|
| >2qfp_A Purple acid phosphatase; binuclear, Fe-Zn, hydrolase; HET: NAG NDG; 2.20A {Phaseolus vulgaris} SCOP: b.1.12.1 d.159.1.1 PDB: 2qfr_A* 1kbp_A* 3kbp_A* 4kbp_A* | Back alignment and structure |
|---|
| >1xzw_A Purple acid phosphatase; hydrolase; HET: NAG FUC MAN; 2.50A {Ipomoea batatas} SCOP: b.1.12.1 d.159.1.1 | Back alignment and structure |
|---|
| >4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* | Back alignment and structure |
|---|
| >1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 | Back alignment and structure |
|---|
| >2w91_A Endo-beta-N-acetylglucosaminidase D; hydrolase, N-glycan, secreted, oxazoline, NAG-thiazoline, substrate-participation; 1.40A {Streptococcus pneumoniae} PDB: 2w92_A* | Back alignment and structure |
|---|
| >1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A | Back alignment and structure |
|---|
| >3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 753 | ||||
| d1x5ga1 | 103 | b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ | 3e-22 | |
| d1x5ga1 | 103 | b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ | 3e-16 | |
| d1x5ga1 | 103 | b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ | 1e-15 | |
| d1x5ga1 | 103 | b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ | 1e-11 | |
| d1x5ga1 | 103 | b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ | 4e-09 | |
| d1x5ga1 | 103 | b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [ | 2e-06 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 2e-21 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 1e-17 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 5e-14 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 3e-13 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 5e-13 | |
| d2dtge2 | 196 | b.1.2.1 (E:593-807) Insulin receptor {Human (Homo | 2e-08 | |
| d1x5ka1 | 111 | b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ | 3e-20 | |
| d1x5ka1 | 111 | b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ | 5e-11 | |
| d1x5ka1 | 111 | b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ | 1e-10 | |
| d1x5ka1 | 111 | b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ | 2e-09 | |
| d1x5ka1 | 111 | b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ | 3e-07 | |
| d1x5ka1 | 111 | b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [ | 1e-05 | |
| d1x5ha1 | 119 | b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ | 7e-19 | |
| d1x5ha1 | 119 | b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ | 7e-16 | |
| d1x5ha1 | 119 | b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ | 5e-13 | |
| d1x5ha1 | 119 | b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ | 3e-12 | |
| d1x5ha1 | 119 | b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ | 1e-07 | |
| d1x5ha1 | 119 | b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [ | 4e-06 | |
| d1x5fa1 | 107 | b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ | 3e-16 | |
| d1x5fa1 | 107 | b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ | 5e-14 | |
| d1x5fa1 | 107 | b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ | 1e-12 | |
| d1x5fa1 | 107 | b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ | 2e-07 | |
| d1x5fa1 | 107 | b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ | 2e-07 | |
| d1x5fa1 | 107 | b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [ | 3e-05 | |
| d1x5la1 | 98 | b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human | 5e-16 | |
| d1x5la1 | 98 | b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human | 2e-15 | |
| d1x5la1 | 98 | b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human | 7e-15 | |
| d1x5la1 | 98 | b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human | 1e-11 | |
| d1x5la1 | 98 | b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human | 7e-11 | |
| d1x5la1 | 98 | b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human | 7e-05 | |
| d1va9a1 | 109 | b.1.2.1 (A:8-116) Down syndrome cell adhesion mole | 2e-15 | |
| d1va9a1 | 109 | b.1.2.1 (A:8-116) Down syndrome cell adhesion mole | 3e-14 | |
| d1va9a1 | 109 | b.1.2.1 (A:8-116) Down syndrome cell adhesion mole | 2e-12 | |
| d1va9a1 | 109 | b.1.2.1 (A:8-116) Down syndrome cell adhesion mole | 4e-10 | |
| d1va9a1 | 109 | b.1.2.1 (A:8-116) Down syndrome cell adhesion mole | 5e-07 | |
| d1va9a1 | 109 | b.1.2.1 (A:8-116) Down syndrome cell adhesion mole | 8e-07 | |
| d1wfoa1 | 117 | b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) | 4e-15 | |
| d1wfoa1 | 117 | b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) | 9e-15 | |
| d1wfoa1 | 117 | b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) | 3e-14 | |
| d1wfoa1 | 117 | b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) | 7e-11 | |
| d1wfoa1 | 117 | b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) | 1e-08 | |
| d1wfoa1 | 117 | b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) | 1e-06 | |
| d1x5za1 | 102 | b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p | 8e-15 | |
| d1x5za1 | 102 | b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p | 7e-14 | |
| d1x5za1 | 102 | b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p | 1e-13 | |
| d1x5za1 | 102 | b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p | 2e-11 | |
| d1x5za1 | 102 | b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p | 9e-10 | |
| d1x5za1 | 102 | b.1.2.1 (A:8-109) Receptor-type tyrosine-protein p | 2e-05 | |
| d1wf5a1 | 108 | b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) | 1e-14 | |
| d1wf5a1 | 108 | b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) | 2e-12 | |
| d1wf5a1 | 108 | b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) | 1e-09 | |
| d1wf5a1 | 108 | b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) | 6e-08 | |
| d1wf5a1 | 108 | b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) | 5e-06 | |
| d1wf5a1 | 108 | b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) | 4e-04 | |
| d1wfna1 | 106 | b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) | 2e-14 | |
| d1wfna1 | 106 | b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) | 1e-12 | |
| d1wfna1 | 106 | b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) | 6e-12 | |
| d1wfna1 | 106 | b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) | 3e-10 | |
| d1wfna1 | 106 | b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) | 9e-10 | |
| d1wfna1 | 106 | b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) | 5e-04 | |
| d1x3da1 | 105 | b.1.2.1 (A:8-112) Fibronectin type-III domain cont | 3e-14 | |
| d1x3da1 | 105 | b.1.2.1 (A:8-112) Fibronectin type-III domain cont | 6e-11 | |
| d1x3da1 | 105 | b.1.2.1 (A:8-112) Fibronectin type-III domain cont | 6e-11 | |
| d1x3da1 | 105 | b.1.2.1 (A:8-112) Fibronectin type-III domain cont | 4e-08 | |
| d1x3da1 | 105 | b.1.2.1 (A:8-112) Fibronectin type-III domain cont | 8e-07 | |
| d1uena_ | 125 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 4e-13 | |
| d1uena_ | 125 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 2e-11 | |
| d1uena_ | 125 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 6e-11 | |
| d1uena_ | 125 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 3e-10 | |
| d1uena_ | 125 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 1e-07 | |
| d1uena_ | 125 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 3e-06 | |
| d1x4za1 | 108 | b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { | 8e-12 | |
| d1x4za1 | 108 | b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { | 7e-11 | |
| d1x4za1 | 108 | b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { | 3e-09 | |
| d1x4za1 | 108 | b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { | 8e-08 | |
| d1x4za1 | 108 | b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) { | 2e-04 | |
| d2crza1 | 97 | b.1.2.1 (A:8-104) Fibronectin type-III domain cont | 1e-11 | |
| d2crza1 | 97 | b.1.2.1 (A:8-104) Fibronectin type-III domain cont | 5e-11 | |
| d2crza1 | 97 | b.1.2.1 (A:8-104) Fibronectin type-III domain cont | 5e-08 | |
| d2crza1 | 97 | b.1.2.1 (A:8-104) Fibronectin type-III domain cont | 9e-07 | |
| d2crza1 | 97 | b.1.2.1 (A:8-104) Fibronectin type-III domain cont | 7e-04 | |
| d2dn7a1 | 94 | b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p | 1e-11 | |
| d2dn7a1 | 94 | b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p | 1e-11 | |
| d2dn7a1 | 94 | b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p | 6e-11 | |
| d2dn7a1 | 94 | b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p | 7e-08 | |
| d2dn7a1 | 94 | b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p | 9e-08 | |
| d2dn7a1 | 94 | b.1.2.1 (A:8-101) Receptor-type tyrosine-protein p | 0.002 | |
| d1uema_ | 117 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 1e-11 | |
| d1uema_ | 117 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 8e-11 | |
| d1uema_ | 117 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 2e-09 | |
| d1uema_ | 117 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 3e-08 | |
| d1uema_ | 117 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 8e-06 | |
| d1uema_ | 117 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 8e-05 | |
| d2crma1 | 107 | b.1.2.1 (A:8-114) Fibronectin type-III domain cont | 3e-11 | |
| d2crma1 | 107 | b.1.2.1 (A:8-114) Fibronectin type-III domain cont | 1e-08 | |
| d2crma1 | 107 | b.1.2.1 (A:8-114) Fibronectin type-III domain cont | 6e-07 | |
| d2crma1 | 107 | b.1.2.1 (A:8-114) Fibronectin type-III domain cont | 4e-05 | |
| d1x5xa1 | 96 | b.1.2.1 (A:8-103) Fibronectin type-III domain cont | 3e-11 | |
| d1x5xa1 | 96 | b.1.2.1 (A:8-103) Fibronectin type-III domain cont | 4e-11 | |
| d1x5xa1 | 96 | b.1.2.1 (A:8-103) Fibronectin type-III domain cont | 5e-11 | |
| d1x5xa1 | 96 | b.1.2.1 (A:8-103) Fibronectin type-III domain cont | 4e-06 | |
| d1x5xa1 | 96 | b.1.2.1 (A:8-103) Fibronectin type-III domain cont | 2e-05 | |
| d1x5xa1 | 96 | b.1.2.1 (A:8-103) Fibronectin type-III domain cont | 9e-05 | |
| d1x5ia1 | 113 | b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [ | 4e-11 | |
| d1x5ia1 | 113 | b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [ | 1e-04 | |
| d1x5ia1 | 113 | b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [ | 9e-04 | |
| d1x5ia1 | 113 | b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [ | 0.002 | |
| d2djsa1 | 95 | b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human | 5e-11 | |
| d2djsa1 | 95 | b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human | 1e-10 | |
| d2djsa1 | 95 | b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human | 5e-10 | |
| d2djsa1 | 95 | b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human | 7e-07 | |
| d2djsa1 | 95 | b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human | 8e-06 | |
| d1x4xa1 | 93 | b.1.2.1 (A:8-100) Fibronectin type-III domain cont | 8e-11 | |
| d1x4xa1 | 93 | b.1.2.1 (A:8-100) Fibronectin type-III domain cont | 5e-09 | |
| d1x4xa1 | 93 | b.1.2.1 (A:8-100) Fibronectin type-III domain cont | 1e-07 | |
| d1x4xa1 | 93 | b.1.2.1 (A:8-100) Fibronectin type-III domain cont | 3e-05 | |
| d1fnfa1 | 94 | b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m | 1e-10 | |
| d1fnfa1 | 94 | b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m | 1e-06 | |
| d1fnfa1 | 94 | b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m | 3e-06 | |
| d1fnfa1 | 94 | b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m | 7e-06 | |
| d1fnfa1 | 94 | b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 m | 9e-05 | |
| d1wfta_ | 123 | b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus | 1e-10 | |
| d1wfta_ | 123 | b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus | 1e-09 | |
| d1wfta_ | 123 | b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus | 1e-09 | |
| d1wfta_ | 123 | b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus | 4e-05 | |
| d1wfta_ | 123 | b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus | 0.001 | |
| d1x5aa1 | 94 | b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse | 1e-10 | |
| d1x5aa1 | 94 | b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse | 3e-10 | |
| d1x5aa1 | 94 | b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse | 1e-09 | |
| d1x5aa1 | 94 | b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse | 1e-06 | |
| d1x5aa1 | 94 | b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse | 3e-05 | |
| d1fnaa_ | 91 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 2e-10 | |
| d1fnaa_ | 91 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 5e-07 | |
| d1fnaa_ | 91 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 6e-07 | |
| d1fnaa_ | 91 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 1e-06 | |
| d1fnaa_ | 91 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 6e-06 | |
| d1fnaa_ | 91 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 4e-05 | |
| d1ueya_ | 127 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 3e-10 | |
| d1ueya_ | 127 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 3e-08 | |
| d1ueya_ | 127 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 2e-07 | |
| d1ueya_ | 127 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 8e-07 | |
| d1ueya_ | 127 | b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens | 1e-04 | |
| d1x5ja1 | 100 | b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ | 4e-10 | |
| d1x5ja1 | 100 | b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ | 1e-09 | |
| d1x5ja1 | 100 | b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ | 4e-09 | |
| d1x5ja1 | 100 | b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ | 2e-08 | |
| d1x5ja1 | 100 | b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ | 3e-06 | |
| d1x5ja1 | 100 | b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [ | 1e-05 | |
| d1x4ya1 | 101 | b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { | 5e-10 | |
| d1x4ya1 | 101 | b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { | 2e-09 | |
| d1x4ya1 | 101 | b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { | 6e-09 | |
| d1x4ya1 | 101 | b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { | 6e-08 | |
| d1x4ya1 | 101 | b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { | 2e-05 | |
| d1x4ya1 | 101 | b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) { | 0.001 | |
| d1fnfa3 | 89 | b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m | 7e-10 | |
| d1fnfa3 | 89 | b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m | 1e-08 | |
| d1fnfa3 | 89 | b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m | 5e-08 | |
| d1fnfa3 | 89 | b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m | 1e-06 | |
| d1fnfa3 | 89 | b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m | 2e-06 | |
| d1fnfa3 | 89 | b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 m | 3e-06 | |
| d1j8ka_ | 94 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 8e-10 | |
| d1j8ka_ | 94 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 1e-08 | |
| d1j8ka_ | 94 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 6e-08 | |
| d1j8ka_ | 94 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 4e-06 | |
| d1j8ka_ | 94 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 2e-04 | |
| d1j8ka_ | 94 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 2e-04 | |
| d1x5ya1 | 98 | b.1.2.1 (A:8-105) Myosin binding protein C, fast-t | 9e-10 | |
| d1x5ya1 | 98 | b.1.2.1 (A:8-105) Myosin binding protein C, fast-t | 2e-09 | |
| d1x5ya1 | 98 | b.1.2.1 (A:8-105) Myosin binding protein C, fast-t | 2e-06 | |
| d1x5ya1 | 98 | b.1.2.1 (A:8-105) Myosin binding protein C, fast-t | 5e-05 | |
| d1x5ya1 | 98 | b.1.2.1 (A:8-105) Myosin binding protein C, fast-t | 6e-05 | |
| d1wisa1 | 111 | b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) | 1e-09 | |
| d1wisa1 | 111 | b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) | 4e-08 | |
| d1wisa1 | 111 | b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) | 8e-07 | |
| d1wisa1 | 111 | b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) | 1e-05 | |
| d1wk0a_ | 137 | b.1.2.1 (A:) Fibronectin type-III domain containin | 2e-09 | |
| d1wk0a_ | 137 | b.1.2.1 (A:) Fibronectin type-III domain containin | 2e-08 | |
| d1wk0a_ | 137 | b.1.2.1 (A:) Fibronectin type-III domain containin | 7e-08 | |
| d1wk0a_ | 137 | b.1.2.1 (A:) Fibronectin type-III domain containin | 5e-07 | |
| d1wk0a_ | 137 | b.1.2.1 (A:) Fibronectin type-III domain containin | 1e-04 | |
| d1cfba2 | 105 | b.1.2.1 (A:710-814) Neuroglian, two amino proximal | 2e-09 | |
| d1cfba2 | 105 | b.1.2.1 (A:710-814) Neuroglian, two amino proximal | 5e-07 | |
| d1cfba2 | 105 | b.1.2.1 (A:710-814) Neuroglian, two amino proximal | 8e-07 | |
| d1cfba2 | 105 | b.1.2.1 (A:710-814) Neuroglian, two amino proximal | 8e-06 | |
| d1cfba2 | 105 | b.1.2.1 (A:710-814) Neuroglian, two amino proximal | 5e-05 | |
| d1cfba2 | 105 | b.1.2.1 (A:710-814) Neuroglian, two amino proximal | 0.002 | |
| d1qg3a2 | 103 | b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum | 4e-09 | |
| d1qg3a2 | 103 | b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum | 7e-07 | |
| d1qg3a2 | 103 | b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum | 8e-07 | |
| d1qg3a2 | 103 | b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Hum | 1e-04 | |
| d1tdqa2 | 92 | b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu | 4e-09 | |
| d1tdqa2 | 92 | b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu | 2e-08 | |
| d1tdqa2 | 92 | b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu | 1e-07 | |
| d1tdqa2 | 92 | b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu | 8e-07 | |
| d1tdqa2 | 92 | b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu | 2e-05 | |
| d1tdqa2 | 92 | b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicu | 3e-04 | |
| d1qg3a1 | 92 | b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum | 5e-09 | |
| d1qg3a1 | 92 | b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum | 9e-09 | |
| d1qg3a1 | 92 | b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum | 2e-08 | |
| d1qg3a1 | 92 | b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum | 3e-05 | |
| d1qg3a1 | 92 | b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum | 7e-05 | |
| d1qg3a1 | 92 | b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Hum | 9e-04 | |
| d1qr4a1 | 87 | b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) | 1e-08 | |
| d1qr4a1 | 87 | b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) | 8e-08 | |
| d1qr4a1 | 87 | b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) | 9e-07 | |
| d1qr4a1 | 87 | b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) | 3e-06 | |
| d1qr4a1 | 87 | b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) | 4e-04 | |
| d1qr4a1 | 87 | b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) | 0.001 | |
| d1fyhb1 | 98 | b.1.2.1 (B:12-109) Interferon-gamma receptor alpha | 1e-08 | |
| d1fnha1 | 90 | b.1.2.1 (A:3-92) Fibronectin, different Fn3 module | 1e-08 | |
| d1fnha1 | 90 | b.1.2.1 (A:3-92) Fibronectin, different Fn3 module | 2e-07 | |
| d1fnha1 | 90 | b.1.2.1 (A:3-92) Fibronectin, different Fn3 module | 2e-06 | |
| d1fnha1 | 90 | b.1.2.1 (A:3-92) Fibronectin, different Fn3 module | 1e-04 | |
| d1fnha1 | 90 | b.1.2.1 (A:3-92) Fibronectin, different Fn3 module | 6e-04 | |
| d1axib2 | 106 | b.1.2.1 (B:131-236) Growth hormone receptor {Human | 2e-08 | |
| d1axib2 | 106 | b.1.2.1 (B:131-236) Growth hormone receptor {Human | 1e-05 | |
| d1axib2 | 106 | b.1.2.1 (B:131-236) Growth hormone receptor {Human | 8e-05 | |
| d1axib2 | 106 | b.1.2.1 (B:131-236) Growth hormone receptor {Human | 0.001 | |
| d1bpva_ | 104 | b.1.2.1 (A:) Type I titin module {Human (Homo sapi | 2e-08 | |
| d1bpva_ | 104 | b.1.2.1 (A:) Type I titin module {Human (Homo sapi | 3e-06 | |
| d1bpva_ | 104 | b.1.2.1 (A:) Type I titin module {Human (Homo sapi | 0.002 | |
| d2cuma1 | 93 | b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) | 2e-08 | |
| d2cuma1 | 93 | b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) | 2e-07 | |
| d2cuma1 | 93 | b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) | 2e-06 | |
| d2cuma1 | 93 | b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) | 7e-05 | |
| d2cuma1 | 93 | b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) | 3e-04 | |
| d2cuma1 | 93 | b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) | 4e-04 | |
| d1uc6a_ | 109 | b.1.2.1 (A:) Ciliary neurotrophic factor receptor | 3e-08 | |
| d1uc6a_ | 109 | b.1.2.1 (A:) Ciliary neurotrophic factor receptor | 7e-06 | |
| d1uc6a_ | 109 | b.1.2.1 (A:) Ciliary neurotrophic factor receptor | 1e-04 | |
| d1uc6a_ | 109 | b.1.2.1 (A:) Ciliary neurotrophic factor receptor | 0.002 | |
| d1owwa_ | 93 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 3e-08 | |
| d1owwa_ | 93 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 2e-04 | |
| d1owwa_ | 93 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 0.002 | |
| d1owwa_ | 93 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 0.003 | |
| d1wfua_ | 120 | b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat | 3e-08 | |
| d1wfua_ | 120 | b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat | 3e-06 | |
| d1wfua_ | 120 | b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat | 7e-06 | |
| d1wfua_ | 120 | b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat | 7e-05 | |
| d1wfua_ | 120 | b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat | 2e-04 | |
| d1fnha3 | 89 | b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod | 4e-08 | |
| d1fnha3 | 89 | b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod | 7e-08 | |
| d1fnha3 | 89 | b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod | 5e-06 | |
| d1fnha3 | 89 | b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod | 1e-04 | |
| d1fnha3 | 89 | b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod | 3e-04 | |
| d1fnha3 | 89 | b.1.2.1 (A:183-271) Fibronectin, different Fn3 mod | 0.002 | |
| d1n26a3 | 104 | b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c | 4e-08 | |
| d1n26a3 | 104 | b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c | 7e-05 | |
| d1n26a3 | 104 | b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c | 8e-05 | |
| d1n26a3 | 104 | b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c | 2e-04 | |
| d1n26a3 | 104 | b.1.2.1 (A:196-299) Interleukin-6 receptor alpha c | 9e-04 | |
| d1cfba1 | 100 | b.1.2.1 (A:610-709) Neuroglian, two amino proximal | 4e-08 | |
| d1cfba1 | 100 | b.1.2.1 (A:610-709) Neuroglian, two amino proximal | 1e-06 | |
| d1cfba1 | 100 | b.1.2.1 (A:610-709) Neuroglian, two amino proximal | 5e-06 | |
| d1cfba1 | 100 | b.1.2.1 (A:610-709) Neuroglian, two amino proximal | 7e-04 | |
| d1cfba1 | 100 | b.1.2.1 (A:610-709) Neuroglian, two amino proximal | 0.001 | |
| d1f6fb2 | 103 | b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu | 4e-08 | |
| d1f6fb2 | 103 | b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu | 2e-06 | |
| d1f6fb2 | 103 | b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu | 4e-06 | |
| d1f6fb2 | 103 | b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattu | 0.003 | |
| d1fnfa2 | 91 | b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m | 8e-08 | |
| d1fnfa2 | 91 | b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m | 1e-06 | |
| d1fnfa2 | 91 | b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m | 2e-06 | |
| d1fnfa2 | 91 | b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m | 4e-05 | |
| d1fnfa2 | 91 | b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m | 3e-04 | |
| d1fnfa2 | 91 | b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 m | 0.001 | |
| d2dtge1 | 102 | b.1.2.1 (E:808-909) Insulin receptor {Human (Homo | 9e-08 | |
| d2dtge1 | 102 | b.1.2.1 (E:808-909) Insulin receptor {Human (Homo | 2e-07 | |
| d2dtge1 | 102 | b.1.2.1 (E:808-909) Insulin receptor {Human (Homo | 5e-06 | |
| d2dtge1 | 102 | b.1.2.1 (E:808-909) Insulin receptor {Human (Homo | 2e-04 | |
| d3d48r2 | 104 | b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom | 1e-07 | |
| d3d48r2 | 104 | b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom | 2e-05 | |
| d3d48r2 | 104 | b.1.2.1 (R:101-204) Prolactin receptor {Human (Hom | 2e-04 | |
| d1bqua2 | 115 | b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki | 1e-07 | |
| d1bqua2 | 115 | b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki | 2e-07 | |
| d1bqua2 | 115 | b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki | 2e-04 | |
| d1bqua2 | 115 | b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki | 2e-04 | |
| d1bqua2 | 115 | b.1.2.1 (A:100-214) Cytokine receptor gp130 cytoki | 0.004 | |
| d2ic2a1 | 107 | b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit | 2e-07 | |
| d2ic2a1 | 107 | b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit | 3e-06 | |
| d2ic2a1 | 107 | b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit | 5e-04 | |
| d2ic2a1 | 107 | b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit | 0.002 | |
| d2cuha1 | 102 | b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) | 2e-07 | |
| d2cuha1 | 102 | b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) | 8e-06 | |
| d2cuha1 | 102 | b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) | 0.002 | |
| d1tdqa3 | 86 | b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic | 2e-07 | |
| d1tdqa3 | 86 | b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic | 6e-07 | |
| d1tdqa3 | 86 | b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic | 8e-07 | |
| d1tdqa3 | 86 | b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic | 9e-05 | |
| d1tdqa3 | 86 | b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic | 0.001 | |
| d1tdqa3 | 86 | b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegic | 0.002 | |
| d2gysa4 | 100 | b.1.2.1 (A:317-416) Common beta-chain in the GM-CS | 2e-07 | |
| d2gysa4 | 100 | b.1.2.1 (A:317-416) Common beta-chain in the GM-CS | 0.001 | |
| d2gysa4 | 100 | b.1.2.1 (A:317-416) Common beta-chain in the GM-CS | 0.004 | |
| d1fnha2 | 90 | b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu | 3e-07 | |
| d1fnha2 | 90 | b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu | 7e-07 | |
| d1fnha2 | 90 | b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu | 9e-06 | |
| d1fnha2 | 90 | b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu | 1e-04 | |
| d1fnha2 | 90 | b.1.2.1 (A:93-182) Fibronectin, different Fn3 modu | 0.001 | |
| d1k85a_ | 88 | b.1.2.1 (A:) Fibronectin type III domain from chit | 3e-07 | |
| d1k85a_ | 88 | b.1.2.1 (A:) Fibronectin type III domain from chit | 5e-07 | |
| d1k85a_ | 88 | b.1.2.1 (A:) Fibronectin type III domain from chit | 9e-07 | |
| d1k85a_ | 88 | b.1.2.1 (A:) Fibronectin type III domain from chit | 0.002 | |
| d1wj3a_ | 117 | b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s | 3e-07 | |
| d1wj3a_ | 117 | b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s | 2e-05 | |
| d1wj3a_ | 117 | b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s | 6e-05 | |
| d1wj3a_ | 117 | b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo s | 1e-04 | |
| d2dtge3 | 125 | b.1.2.1 (E:468-592) Insulin receptor {Human (Homo | 3e-07 | |
| d2dtge3 | 125 | b.1.2.1 (E:468-592) Insulin receptor {Human (Homo | 3e-06 | |
| d2dtge3 | 125 | b.1.2.1 (E:468-592) Insulin receptor {Human (Homo | 2e-05 | |
| d2dtge3 | 125 | b.1.2.1 (E:468-592) Insulin receptor {Human (Homo | 0.004 | |
| d1bqua1 | 95 | b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- | 4e-07 | |
| d1bqua1 | 95 | b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- | 9e-06 | |
| d1bqua1 | 95 | b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine- | 2e-04 | |
| d2vkwa2 | 93 | b.1.2.1 (A:601-693) Neural cell adhesion molecule | 4e-07 | |
| d2vkwa2 | 93 | b.1.2.1 (A:601-693) Neural cell adhesion molecule | 3e-06 | |
| d2vkwa2 | 93 | b.1.2.1 (A:601-693) Neural cell adhesion molecule | 6e-06 | |
| d2vkwa2 | 93 | b.1.2.1 (A:601-693) Neural cell adhesion molecule | 6e-04 | |
| d2b5ib2 | 104 | b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch | 4e-07 | |
| d2b5ib2 | 104 | b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch | 4e-06 | |
| d2b5ib2 | 104 | b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch | 2e-05 | |
| d2b5ib2 | 104 | b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch | 4e-05 | |
| d2b5ib2 | 104 | b.1.2.1 (B:104-207) Interleukin-2 receptor beta ch | 3e-04 | |
| d1ujta_ | 120 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 5e-07 | |
| d1ujta_ | 120 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 9e-07 | |
| d1ujta_ | 120 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 1e-06 | |
| d1ujta_ | 120 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 3e-06 | |
| d1ujta_ | 120 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 9e-05 | |
| d1ujta_ | 120 | b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens | 6e-04 | |
| d1tdqa1 | 93 | b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) | 6e-07 | |
| d1tdqa1 | 93 | b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) | 9e-07 | |
| d1tdqa1 | 93 | b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) | 9e-07 | |
| d1tdqa1 | 93 | b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) | 9e-05 | |
| d1tdqa1 | 93 | b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) | 2e-04 | |
| d1erna2 | 105 | b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor | 6e-07 | |
| d1erna2 | 105 | b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor | 4e-04 | |
| d1qr4a2 | 88 | b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu | 7e-07 | |
| d1qr4a2 | 88 | b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu | 1e-06 | |
| d1qr4a2 | 88 | b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu | 1e-06 | |
| d1qr4a2 | 88 | b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu | 2e-05 | |
| d1qr4a2 | 88 | b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu | 6e-05 | |
| d1qr4a2 | 88 | b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallu | 2e-04 | |
| d1tena_ | 90 | b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId | 8e-07 | |
| d1tena_ | 90 | b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId | 1e-06 | |
| d1tena_ | 90 | b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId | 6e-05 | |
| d1tena_ | 90 | b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId | 1e-04 | |
| d1tena_ | 90 | b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId | 3e-04 | |
| d1iarb2 | 101 | b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch | 1e-06 | |
| d1iarb2 | 101 | b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch | 2e-06 | |
| d1iarb2 | 101 | b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch | 3e-05 | |
| d1iarb2 | 101 | b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch | 7e-04 | |
| d1iarb2 | 101 | b.1.2.1 (B:97-197) Interleukin-4 receptor alpha ch | 0.004 | |
| d1cd9b1 | 107 | b.1.2.1 (B:1-107) Granulocyte colony-stimulating f | 1e-06 | |
| d1cd9b1 | 107 | b.1.2.1 (B:1-107) Granulocyte colony-stimulating f | 1e-05 | |
| d1cd9b1 | 107 | b.1.2.1 (B:1-107) Granulocyte colony-stimulating f | 2e-04 | |
| d1v5ja_ | 108 | b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId | 1e-06 | |
| d1v5ja_ | 108 | b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId | 4e-04 | |
| d2cspa1 | 117 | b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho | 1e-06 | |
| d2cspa1 | 117 | b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho | 3e-06 | |
| d2cspa1 | 117 | b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho | 9e-06 | |
| d2cspa1 | 117 | b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Ho | 3e-05 | |
| d1cd9b2 | 106 | b.1.2.1 (B:108-213) Granulocyte colony-stimulating | 3e-06 | |
| d1cd9b2 | 106 | b.1.2.1 (B:108-213) Granulocyte colony-stimulating | 2e-04 | |
| d1cd9b2 | 106 | b.1.2.1 (B:108-213) Granulocyte colony-stimulating | 0.001 | |
| d1cd9b2 | 106 | b.1.2.1 (B:108-213) Granulocyte colony-stimulating | 0.002 | |
| d1cd9b2 | 106 | b.1.2.1 (B:108-213) Granulocyte colony-stimulating | 0.003 | |
| d2b5ic1 | 95 | b.1.2.1 (C:130-224) Cytokine receptor common gamma | 3e-06 | |
| d2b5ic1 | 95 | b.1.2.1 (C:130-224) Cytokine receptor common gamma | 7e-06 | |
| d2b5ic1 | 95 | b.1.2.1 (C:130-224) Cytokine receptor common gamma | 8e-05 | |
| d2ibga1 | 95 | b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit | 5e-06 | |
| d2ibga1 | 95 | b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit | 8e-06 | |
| d2ibga1 | 95 | b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit | 2e-04 | |
| d2ibga1 | 95 | b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit | 5e-04 | |
| d2gysa2 | 114 | b.1.2.1 (A:104-217) Common beta-chain in the GM-CS | 2e-05 | |
| d2gysa2 | 114 | b.1.2.1 (A:104-217) Common beta-chain in the GM-CS | 4e-04 | |
| d2gysa2 | 114 | b.1.2.1 (A:104-217) Common beta-chain in the GM-CS | 0.003 | |
| d2d9qb2 | 105 | b.1.2.1 (B:204-308) Granulocyte colony-stimulating | 2e-05 | |
| d2d9qb2 | 105 | b.1.2.1 (B:204-308) Granulocyte colony-stimulating | 3e-04 | |
| d2d9qb2 | 105 | b.1.2.1 (B:204-308) Granulocyte colony-stimulating | 5e-04 | |
| d3d85d3 | 94 | b.1.2.1 (D:212-305) The p40 domain of interleukin- | 3e-05 | |
| d3d85d3 | 94 | b.1.2.1 (D:212-305) The p40 domain of interleukin- | 6e-04 | |
| d3d85d3 | 94 | b.1.2.1 (D:212-305) The p40 domain of interleukin- | 0.004 | |
| d2haza1 | 101 | b.1.2.1 (A:489-589) Neural cell adhesion molecule | 5e-05 | |
| d2haza1 | 101 | b.1.2.1 (A:489-589) Neural cell adhesion molecule | 1e-04 | |
| d2haza1 | 101 | b.1.2.1 (A:489-589) Neural cell adhesion molecule | 0.001 | |
| d1y6kr1 | 99 | b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10 | 9e-05 | |
| d2fnba_ | 95 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 2e-04 | |
| d2fnba_ | 95 | b.1.2.1 (A:) Fibronectin, different Fn3 modules {H | 8e-04 | |
| d2cuia1 | 101 | b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) | 8e-04 | |
| d2cuia1 | 101 | b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) | 0.001 |
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Fibronectin type III family: Fibronectin type III domain: Neogenin species: Human (Homo sapiens) [TaxId: 9606]
Score = 89.8 bits (222), Expect = 3e-22
Identities = 43/102 (42%), Positives = 64/102 (62%)
Query: 145 VKTEPEDHVPSPPLNVNIPVVGTSSLLVTWEKPTVTNGEIKHYTLYYLEEDTSVERHVVT 204
V+T+PE +P P N+ +S+ VTWE P NGEI++Y LYY+E+ T E+ V
Sbjct: 2 VETQPEVQLPGPAPNLRAYAASPTSITVTWETPVSGNGEIQNYKLYYMEKGTDKEQDVDV 61
Query: 205 PQLSYELTGLSHFTLYSIWVVAHNGNGAGTTSQELSVQTLSD 246
SY + GL +T YS VVA+N +G G ++ +++V+TLSD
Sbjct: 62 SSHSYTINGLKKYTEYSFRVVAYNKHGPGVSTPDVAVRTLSD 103
|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 196 | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 119 | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 107 | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 123 | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 127 | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 105 | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 92 | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 92 | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 87 | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 98 | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 120 | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 89 | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} Length = 100 | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 103 | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 91 | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 115 | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 107 | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 102 | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} Length = 88 | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 93 | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 120 | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 93 | Back information, alignment and structure |
|---|
| >d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} Length = 88 | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} Length = 90 | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 107 | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} Length = 106 | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 95 | Back information, alignment and structure |
|---|
| >d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
| >d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 94 | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} Length = 95 | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 753 | |||
| d1x5ka1 | 111 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.67 | |
| d1x5ha1 | 119 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.63 | |
| d1wfoa1 | 117 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.61 | |
| d1x5ga1 | 103 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.6 | |
| d1x5la1 | 98 | Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta | 99.59 | |
| d2djsa1 | 95 | Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta | 99.57 | |
| d1x5ga1 | 103 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.56 | |
| d1wfna1 | 106 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.55 | |
| d1x5fa1 | 107 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.54 | |
| d1wf5a1 | 108 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.54 | |
| d1x3da1 | 105 | Fibronectin type-III domain containing protein 3a, | 99.54 | |
| d2crza1 | 97 | Fibronectin type-III domain containing protein 3a, | 99.54 | |
| d2dtge2 | 196 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 99.54 | |
| d1va9a1 | 109 | Down syndrome cell adhesion molecule-like protein | 99.53 | |
| d1x4xa1 | 93 | Fibronectin type-III domain containing protein 3a, | 99.53 | |
| d1x5aa1 | 94 | Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta | 99.53 | |
| d1uema_ | 117 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 99.53 | |
| d1x5ya1 | 98 | Myosin binding protein C, fast-type {Mouse (Mus mu | 99.52 | |
| d2vkwa2 | 93 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 99.51 | |
| d1x5xa1 | 96 | Fibronectin type-III domain containing protein 3a, | 99.51 | |
| d1qg3a1 | 92 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 99.51 | |
| d1x5za1 | 102 | Receptor-type tyrosine-protein phosphatase delta, | 99.5 | |
| d1uema_ | 117 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 99.5 | |
| d1x4xa1 | 93 | Fibronectin type-III domain containing protein 3a, | 99.5 | |
| d1cfba2 | 105 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 99.5 | |
| d1wfoa1 | 117 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.5 | |
| d1x4za1 | 108 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 99.49 | |
| d1x4ya1 | 101 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 99.49 | |
| d1x5fa1 | 107 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.49 | |
| d2haza1 | 101 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 99.49 | |
| d1x5ya1 | 98 | Myosin binding protein C, fast-type {Mouse (Mus mu | 99.48 | |
| d2vkwa2 | 93 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 99.48 | |
| d1v5ja_ | 108 | KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | 99.48 | |
| d1x5ia1 | 113 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.48 | |
| d1uena_ | 125 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 99.47 | |
| d1x3da1 | 105 | Fibronectin type-III domain containing protein 3a, | 99.47 | |
| d1x5la1 | 98 | Ephrin type-A receptor 8 {Human (Homo sapiens) [Ta | 99.47 | |
| d2djsa1 | 95 | Ephrin type-B receptor 1 {Human (Homo sapiens) [Ta | 99.47 | |
| d1wj3a_ | 117 | Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI | 99.46 | |
| d2crma1 | 107 | Fibronectin type-III domain containing protein 3a, | 99.46 | |
| d2ibga1 | 95 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 99.46 | |
| d2dn7a1 | 94 | Receptor-type tyrosine-protein phosphatase F, PTPR | 99.46 | |
| d2dtge2 | 196 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 99.46 | |
| d1x5xa1 | 96 | Fibronectin type-III domain containing protein 3a, | 99.45 | |
| d1wf5a1 | 108 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.44 | |
| d1cfba1 | 100 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 99.44 | |
| d1cfba1 | 100 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 99.43 | |
| d1wfta_ | 123 | Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T | 99.42 | |
| d1n26a3 | 104 | Interleukin-6 receptor alpha chain, domains 2 and | 99.42 | |
| d1bpva_ | 104 | Type I titin module {Human (Homo sapiens) [TaxId: | 99.42 | |
| d2dtge1 | 102 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 99.42 | |
| d1wisa1 | 111 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.41 | |
| d1owwa_ | 93 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.41 | |
| d2crma1 | 107 | Fibronectin type-III domain containing protein 3a, | 99.41 | |
| d1x4za1 | 108 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 99.4 | |
| d1x5za1 | 102 | Receptor-type tyrosine-protein phosphatase delta, | 99.4 | |
| d1wfua_ | 120 | Fibronectin type 3 and ankyrin repeat domains 1 pr | 99.4 | |
| d1wfna1 | 106 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.4 | |
| d1x5aa1 | 94 | Ephrin type-A receptor 1 {Mouse (Mus musculus) [Ta | 99.39 | |
| d1qg3a1 | 92 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 99.39 | |
| d1x5ha1 | 119 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.39 | |
| d1x5ja1 | 100 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.38 | |
| d1k85a_ | 88 | Fibronectin type III domain from chitinase A1. {Ba | 99.38 | |
| d2haza1 | 101 | Neural cell adhesion molecule 1, NCAM {Human (Homo | 99.38 | |
| d1ueya_ | 127 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 99.38 | |
| d2ic2a1 | 107 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 99.37 | |
| d2fnba_ | 95 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.37 | |
| d1tena_ | 90 | Tenascin {Human (Homo sapiens) [TaxId: 9606]} | 99.37 | |
| d2dn7a1 | 94 | Receptor-type tyrosine-protein phosphatase F, PTPR | 99.36 | |
| d1x5ia1 | 113 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.35 | |
| d1wj3a_ | 117 | Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxI | 99.35 | |
| d2crza1 | 97 | Fibronectin type-III domain containing protein 3a, | 99.35 | |
| d1qg3a2 | 103 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 99.35 | |
| d2cuha1 | 102 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 99.35 | |
| d1bpva_ | 104 | Type I titin module {Human (Homo sapiens) [TaxId: | 99.34 | |
| d1ueya_ | 127 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 99.34 | |
| d1f6fb2 | 103 | Prolactin receptor {Rat (Rattus norvegicus) [TaxId | 99.34 | |
| d2d9qb2 | 105 | Granulocyte colony-stimulating factor (GC-SF) rece | 99.34 | |
| d1v5ja_ | 108 | KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | 99.34 | |
| d1x5ja1 | 100 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.34 | |
| d2cuha1 | 102 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 99.33 | |
| d2b5ib2 | 104 | Interleukin-2 receptor beta chain {Human (Homo sap | 99.33 | |
| d1qr4a1 | 87 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.33 | |
| d1fnfa3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.33 | |
| d1bqua2 | 115 | Cytokine receptor gp130 cytokine-binding domains { | 99.32 | |
| d1tdqa1 | 93 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.32 | |
| d1fnaa_ | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.32 | |
| d1tdqa2 | 92 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.32 | |
| d1wisa1 | 111 | Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | 99.32 | |
| d1k85a_ | 88 | Fibronectin type III domain from chitinase A1. {Ba | 99.32 | |
| d3d48r2 | 104 | Prolactin receptor {Human (Homo sapiens) [TaxId: 9 | 99.31 | |
| d2cuma1 | 93 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 99.31 | |
| d1x5ka1 | 111 | Neogenin {Human (Homo sapiens) [TaxId: 9606]} | 99.31 | |
| d1wfua_ | 120 | Fibronectin type 3 and ankyrin repeat domains 1 pr | 99.31 | |
| d1ujta_ | 120 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 99.3 | |
| d1fnha1 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.3 | |
| d1axib2 | 106 | Growth hormone receptor {Human (Homo sapiens) [Tax | 99.3 | |
| d1qg3a2 | 103 | Integrin beta-4 subunit {Human (Homo sapiens) [Tax | 99.29 | |
| d1cd9b2 | 106 | Granulocyte colony-stimulating factor (GC-SF) rece | 99.29 | |
| d1erna2 | 105 | Erythropoietin (EPO) receptor {Human (Homo sapiens | 99.29 | |
| d2gysa2 | 114 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 99.29 | |
| d1fnfa2 | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.29 | |
| d1qr4a1 | 87 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.28 | |
| d1n26a3 | 104 | Interleukin-6 receptor alpha chain, domains 2 and | 99.28 | |
| d2fnba_ | 95 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.28 | |
| d1wfta_ | 123 | Host cell factor 2, HCF-2 {Mouse (Mus musculus) [T | 99.28 | |
| d1qr4a2 | 88 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.27 | |
| d1fnha2 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.27 | |
| d1fnfa1 | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.27 | |
| d1qr4a2 | 88 | Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | 99.26 | |
| d2cspa1 | 117 | Rim binding protein 2 {Human (Homo sapiens) [TaxId | 99.26 | |
| d2cuma1 | 93 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 99.26 | |
| d1x4ya1 | 101 | Brother of CDO precursor (BOC) {Mouse (Mus musculu | 99.26 | |
| d1j8ka_ | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.26 | |
| d2ibga1 | 95 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 99.25 | |
| d1fnfa3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.25 | |
| d1wk0a_ | 137 | Fibronectin type-III domain containing protein 3a, | 99.25 | |
| d1tdqa3 | 86 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.25 | |
| d1iarb2 | 101 | Interleukin-4 receptor alpha chain {Human (Homo sa | 99.25 | |
| d1fnha3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.24 | |
| d1va9a1 | 109 | Down syndrome cell adhesion molecule-like protein | 99.24 | |
| d1f6fb2 | 103 | Prolactin receptor {Rat (Rattus norvegicus) [TaxId | 99.23 | |
| d2ic2a1 | 107 | Hedgehog receptor iHog {Fruit fly (Drosophila mela | 99.23 | |
| d1bqua1 | 95 | Cytokine receptor gp130 cytokine-binding domains { | 99.23 | |
| d1tena_ | 90 | Tenascin {Human (Homo sapiens) [TaxId: 9606]} | 99.23 | |
| d1cfba2 | 105 | Neuroglian, two amino proximal Fn3 repeats {Drosop | 99.22 | |
| d1tdqa3 | 86 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.22 | |
| d1uena_ | 125 | KIAA0343 protein {Human (Homo sapiens) [TaxId: 960 | 99.22 | |
| d2b5ic1 | 95 | Cytokine receptor common gamma chain {Human (Homo | 99.22 | |
| d1fnha2 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.22 | |
| d1fnfa2 | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.21 | |
| d3d48r2 | 104 | Prolactin receptor {Human (Homo sapiens) [TaxId: 9 | 99.2 | |
| d1bqua1 | 95 | Cytokine receptor gp130 cytokine-binding domains { | 99.19 | |
| d2b5ic1 | 95 | Cytokine receptor common gamma chain {Human (Homo | 99.19 | |
| d2d9qb2 | 105 | Granulocyte colony-stimulating factor (GC-SF) rece | 99.19 | |
| d1owwa_ | 93 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.17 | |
| d1axib2 | 106 | Growth hormone receptor {Human (Homo sapiens) [Tax | 99.17 | |
| d1tdqa1 | 93 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.17 | |
| d1bqua2 | 115 | Cytokine receptor gp130 cytokine-binding domains { | 99.17 | |
| d1j8ka_ | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.17 | |
| d1iarb2 | 101 | Interleukin-4 receptor alpha chain {Human (Homo sa | 99.17 | |
| d1fnha3 | 89 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.16 | |
| d1wk0a_ | 137 | Fibronectin type-III domain containing protein 3a, | 99.16 | |
| d1tdqa2 | 92 | Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | 99.15 | |
| d1fnha1 | 90 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.15 | |
| d2cuia1 | 101 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 99.14 | |
| d2dtge3 | 125 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 99.14 | |
| d2b5ib2 | 104 | Interleukin-2 receptor beta chain {Human (Homo sap | 99.13 | |
| d1fnfa1 | 94 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.13 | |
| d1cd9b2 | 106 | Granulocyte colony-stimulating factor (GC-SF) rece | 99.12 | |
| d2gysa4 | 100 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 99.11 | |
| d2gysa2 | 114 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 99.1 | |
| d2dtge1 | 102 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 99.09 | |
| d1fnaa_ | 91 | Fibronectin, different Fn3 modules {Human (Homo sa | 99.08 | |
| d1uc6a_ | 109 | Ciliary neurotrophic factor receptor alpha {Human | 99.07 | |
| d1erna2 | 105 | Erythropoietin (EPO) receptor {Human (Homo sapiens | 99.06 | |
| d2cuia1 | 101 | Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | 99.04 | |
| d2cspa1 | 117 | Rim binding protein 2 {Human (Homo sapiens) [TaxId | 99.02 | |
| d1cd9b1 | 107 | Granulocyte colony-stimulating factor (GC-SF) rece | 98.98 | |
| d1ujta_ | 120 | KIAA1568 protein {Human (Homo sapiens) [TaxId: 960 | 98.97 | |
| d1uc6a_ | 109 | Ciliary neurotrophic factor receptor alpha {Human | 98.94 | |
| d1cd9b1 | 107 | Granulocyte colony-stimulating factor (GC-SF) rece | 98.91 | |
| d3d85d3 | 94 | The p40 domain of interleukin-12 (IL-12 beta chain | 98.9 | |
| d2dtge3 | 125 | Insulin receptor {Human (Homo sapiens) [TaxId: 960 | 98.89 | |
| d1fyhb1 | 98 | Interferon-gamma receptor alpha chain {Human (Homo | 98.85 | |
| d3d85d3 | 94 | The p40 domain of interleukin-12 (IL-12 beta chain | 98.85 | |
| d1fyhb1 | 98 | Interferon-gamma receptor alpha chain {Human (Homo | 98.83 | |
| d2gysa4 | 100 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 98.78 | |
| d1y6kr1 | 99 | Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa | 98.67 | |
| d1y6kr1 | 99 | Interleukin-10 receptor 1, IL-10R1 {Human (Homo sa | 98.66 | |
| d2qfra1 | 112 | Purple acid phosphatase, N-terminal domain {Kidney | 97.73 | |
| d1xzwa1 | 119 | Purple acid phosphatase, N-terminal domain {Sweet | 97.62 | |
| d1xzwa1 | 119 | Purple acid phosphatase, N-terminal domain {Sweet | 97.02 | |
| d2hyma1 | 109 | Interferon-alpha/beta receptor beta chain {Human ( | 97.02 | |
| d2qfra1 | 112 | Purple acid phosphatase, N-terminal domain {Kidney | 96.92 | |
| d2hyma1 | 109 | Interferon-alpha/beta receptor beta chain {Human ( | 96.84 | |
| d1f6fb1 | 96 | Prolactin receptor {Rat (Rattus norvegicus) [TaxId | 96.78 | |
| d2hfta1 | 106 | Extracellular region of human tissue factor {Human | 96.36 | |
| d2hfta1 | 106 | Extracellular region of human tissue factor {Human | 96.15 | |
| d1a21a1 | 103 | Extracellular region of human tissue factor {Rabbi | 96.12 | |
| d1f6fb1 | 96 | Prolactin receptor {Rat (Rattus norvegicus) [TaxId | 96.0 | |
| d1a21a1 | 103 | Extracellular region of human tissue factor {Rabbi | 95.81 | |
| d2c4fu1 | 116 | Extracellular region of human tissue factor {Human | 95.78 | |
| d2c4fu1 | 116 | Extracellular region of human tissue factor {Human | 93.47 | |
| d2gysa3 | 99 | Common beta-chain in the GM-CSF, IL-3 and IL-5 rec | 88.37 | |
| d2cqva1 | 101 | Telokin {Human (Homo sapiens) [TaxId: 9606]} | 85.46 | |
| d1axib1 | 99 | Growth hormone receptor {Human (Homo sapiens) [Tax | 85.3 |
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Immunoglobulin-like beta-sandwich superfamily: Fibronectin type III family: Fibronectin type III domain: Neogenin species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.67 E-value=4.1e-16 Score=128.92 Aligned_cols=105 Identities=49% Similarity=0.871 Sum_probs=92.5
Q ss_pred eeecCCCCCCCCcceEEeecCCCCeeEEEEeeCCCCCCCceeEEEEEEEeCCCC--CceEEEEeeCceeEEEEcCCCCCC
Q psy241 544 NTTQEAAPASAPRDLTVVSKEGDPSLVNLNWQPPKSANGQISGYTILYSSDPNT--DQWIEESVVGDKMSTNVRGLEPGR 621 (753)
Q Consensus 544 ~~t~~~~p~~~P~~l~~~~~~~~~~~v~l~W~~p~~~~g~i~~Y~V~~~~~~~~--~~~~~~~~~~~~~~~~l~~L~p~t 621 (753)
.+|.+.+|..+|.++.+.....+.++|.|+|++|...+|.|.+|.|+|+..... ..|......+..+.++|.+|+|++
T Consensus 4 ~~T~~~~P~~pP~~~~v~~~~~~~~sv~v~W~~P~~~~g~i~~Y~i~~~~~~~~~~~~~~~~~~~~~~~~~~i~~L~p~t 83 (111)
T d1x5ka1 4 GTTFELVPTSPPKDVTVVSKEGKPKTIIVNWQPPSEANGKITGYIIYYSTDVNAEIHDWVIEPVVGNRLTHQIQELTLDT 83 (111)
T ss_dssp SCSCCCCCCSCCEEEEEEECSSCTTCEEEEEECCSCCSSCCCEEEEEEESCSSSCTTTSEEEEESTTCSEEEECSCCSSS
T ss_pred eEeCCCCCCCCCCCcEEEEecCCCCEEEEEEEccccCCCceeeeEEeeeecCCCCcceeEEEEeCCCeeEEEECCCCCCC
Confidence 467788898999999988766678899999999998899999999999876544 456666778888899999999999
Q ss_pred EEEEEEEEEcCCCCCCCCCceEEEcCC
Q psy241 622 IYYFKIKARNSAGSSPYSSTVTWTTAS 648 (753)
Q Consensus 622 ~Y~~~V~A~~~~G~g~~S~~~~~~T~~ 648 (753)
.|.|+|+|+|..|.|++|+.+.++|..
T Consensus 84 ~Y~~~V~A~n~~G~g~~S~~v~~~T~~ 110 (111)
T d1x5ka1 84 PYYFKIQARNSKGMGPMSEAVQFRTPK 110 (111)
T ss_dssp EEEEEEEEECSSCBCCCCCCEEEECCC
T ss_pred EEEEEEEEEcCCCCcCCCCCEEEECCC
Confidence 999999999999999999999999975
|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ga1 b.1.2.1 (A:8-110) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uema_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4xa1 b.1.2.1 (A:8-100) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wfoa1 b.1.2.1 (A:8-124) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5fa1 b.1.2.1 (A:8-114) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ya1 b.1.2.1 (A:8-105) Myosin binding protein C, fast-type {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2vkwa2 b.1.2.1 (A:601-693) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3da1 b.1.2.1 (A:8-112) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5la1 b.1.2.1 (A:8-105) Ephrin type-A receptor 8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2djsa1 b.1.2.1 (A:8-102) Ephrin type-B receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge2 b.1.2.1 (E:593-807) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5xa1 b.1.2.1 (A:8-103) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf5a1 b.1.2.1 (A:8-115) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1cfba1 b.1.2.1 (A:610-709) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crma1 b.1.2.1 (A:8-114) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4za1 b.1.2.1 (A:8-115) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x5za1 b.1.2.1 (A:8-109) Receptor-type tyrosine-protein phosphatase delta, PTPRD {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wfna1 b.1.2.1 (A:8-113) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5aa1 b.1.2.1 (A:8-101) Ephrin type-A receptor 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qg3a1 b.1.2.1 (A:1126-1217) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ha1 b.1.2.1 (A:8-126) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d2haza1 b.1.2.1 (A:489-589) Neural cell adhesion molecule 1, NCAM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dn7a1 b.1.2.1 (A:8-101) Receptor-type tyrosine-protein phosphatase F, PTPRF {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ia1 b.1.2.1 (A:8-120) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wj3a_ b.1.2.1 (A:) Contactin 3 (KIAA1496) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crza1 b.1.2.1 (A:8-104) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bpva_ b.1.2.1 (A:) Type I titin module {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ueya_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v5ja_ b.1.2.1 (A:) KIAA1355 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ja1 b.1.2.1 (A:8-107) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuha1 b.1.2.1 (A:8-109) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1wisa1 b.1.2.1 (A:8-118) Sidekick 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k85a_ b.1.2.1 (A:) Fibronectin type III domain from chitinase A1. {Bacillus circulans [TaxId: 1397]} | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x5ka1 b.1.2.1 (A:8-118) Neogenin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfua_ b.1.2.1 (A:) Fibronectin type 3 and ankyrin repeat domains 1 protein, FANK1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qg3a2 b.1.2.1 (A:1218-1320) Integrin beta-4 subunit {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qr4a1 b.1.2.1 (A:1-87) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1n26a3 b.1.2.1 (A:196-299) Interleukin-6 receptor alpha chain, domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fnba_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfta_ b.1.2.1 (A:) Host cell factor 2, HCF-2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qr4a2 b.1.2.1 (A:88-175) Tenascin {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuma1 b.1.2.1 (A:7-99) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ya1 b.1.2.1 (A:8-108) Brother of CDO precursor (BOC) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ibga1 b.1.2.1 (A:573-667) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1fnfa3 b.1.2.1 (A:1327-1415) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1va9a1 b.1.2.1 (A:8-116) Down syndrome cell adhesion molecule-like protein 1, DSCAML1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f6fb2 b.1.2.1 (B:101-203) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2ic2a1 b.1.2.1 (A:466-572) Hedgehog receptor iHog {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tena_ b.1.2.1 (A:) Tenascin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cfba2 b.1.2.1 (A:710-814) Neuroglian, two amino proximal Fn3 repeats {Drosophila melanogaster [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1tdqa3 b.1.2.1 (A:186-271) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uena_ b.1.2.1 (A:) KIAA0343 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha2 b.1.2.1 (A:93-182) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa2 b.1.2.1 (A:1236-1326) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d48r2 b.1.2.1 (R:101-204) Prolactin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bqua1 b.1.2.1 (A:5-99) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ic1 b.1.2.1 (C:130-224) Cytokine receptor common gamma chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d9qb2 b.1.2.1 (B:204-308) Granulocyte colony-stimulating factor (GC-SF) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1owwa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1axib2 b.1.2.1 (B:131-236) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa1 b.1.2.1 (A:1-93) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1bqua2 b.1.2.1 (A:100-214) Cytokine receptor gp130 cytokine-binding domains {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1iarb2 b.1.2.1 (B:97-197) Interleukin-4 receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnha3 b.1.2.1 (A:183-271) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wk0a_ b.1.2.1 (A:) Fibronectin type-III domain containing protein 3a, FNDC3A (KIAA0970) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tdqa2 b.1.2.1 (A:94-185) Tenascin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fnha1 b.1.2.1 (A:3-92) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b5ib2 b.1.2.1 (B:104-207) Interleukin-2 receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnfa1 b.1.2.1 (A:1142-1235) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd9b2 b.1.2.1 (B:108-213) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gysa2 b.1.2.1 (A:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge1 b.1.2.1 (E:808-909) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnaa_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1erna2 b.1.2.1 (A:117-221) Erythropoietin (EPO) receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuia1 b.1.2.1 (A:6-106) Tenascin-X {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cspa1 b.1.2.1 (A:8-124) Rim binding protein 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ujta_ b.1.2.1 (A:) KIAA1568 protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uc6a_ b.1.2.1 (A:) Ciliary neurotrophic factor receptor alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cd9b1 b.1.2.1 (B:1-107) Granulocyte colony-stimulating factor (GC-SF) receptor {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dtge3 b.1.2.1 (E:468-592) Insulin receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3d85d3 b.1.2.1 (D:212-305) The p40 domain of interleukin-12 (IL-12 beta chain), domains 2 and 3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fyhb1 b.1.2.1 (B:12-109) Interferon-gamma receptor alpha chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gysa4 b.1.2.1 (A:317-416) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1y6kr1 b.1.2.1 (R:2-100) Interleukin-10 receptor 1, IL-10R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} | Back information, alignment and structure |
|---|
| >d1xzwa1 b.1.12.1 (A:1-119) Purple acid phosphatase, N-terminal domain {Sweet potato (Ipomoea batatas) [TaxId: 4120]} | Back information, alignment and structure |
|---|
| >d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qfra1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2hyma1 b.1.2.1 (A:1-109) Interferon-alpha/beta receptor beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hfta1 b.1.2.1 (A:1-106) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1f6fb1 b.1.2.1 (B:5-100) Prolactin receptor {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a21a1 b.1.2.1 (A:4-106) Extracellular region of human tissue factor {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c4fu1 b.1.2.1 (U:91-210) Extracellular region of human tissue factor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gysa3 b.1.2.1 (A:218-316) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1axib1 b.1.2.1 (B:32-130) Growth hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|