Psyllid ID: psy2479

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150------
MKIGYCQQIELEYVHNSANILSDKFSLSSEARKIPVLLTRILTEVDKLKNTEFQPSSLKIDLTRADSSDFDCILCRSTIWKPVTTPCGHSYCWMCLDRCLDYSSSCPLCKTSLADVGILATTCIEKRLKAINKTFELIDQSERSQEFTMAPPIKRG
ccccHHHccHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHcccccccccccc
ccEEEEEEEEEcccHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccccccHcccccccccHcHccHHHHHHHHccccccccccHHHHHHHHHHccccccccccHccHHHHHHHccccHHHHHHHHHHHHcHHHHHHHHHHHccccccccc
MKIGYCQQIELEYVhnsanilsdkfslssearkIPVLLTRILTEVdklkntefqpsslkidltradssdfdcilcrstiwkpvttpcghsycwmcldrcldyssscplcktslaDVGILATTCIEKRLKAINKTFELIdqsersqeftmappikrg
MKIGYCQQIELEYVHNSANILSDKfslssearkIPVLLTRIltevdklkntefqpsslkidltradssdFDCILCRSTIWKPVTTPCGHSYCWMCLDRCLDYSSSCPLCKTSLADVGILATTCIEKRLKAINKTfelidqsersqeftmappikrg
MKIGYCQQIELEYVHNSANILSDKFSLSSEARKIPVLLTRILTEVDKLKNTEFQPSSLKIDLTRADSSDFDCILCRSTIWKPVTTPCGHSYCWMCLDRCLDYSSSCPLCKTSLADVGILATTCIEKRLKAINKTFELIDQSERSQEFTMAPPIKRG
**IGYCQQIELEYVHNSANILSDKFSLSSEARKIPVLLTRILTEVDKLKNTEFQPSSLKIDLTRADSSDFDCILCRSTIWKPVTTPCGHSYCWMCLDRCLDYSSSCPLCKTSLADVGILATTCIEKRLKAINKTFELI******************
*********************************************************************FDCILCRSTIWKPVTTPCGHSYCWMCLDRCLDYSSSCPLCKTSLADVGILATTCIEKRLK***************************
MKIGYCQQIELEYVHNSANILSDKFSLSSEARKIPVLLTRILTEVDKLKNTEFQPSSLKIDLTRADSSDFDCILCRSTIWKPVTTPCGHSYCWMCLDRCLDYSSSCPLCKTSLADVGILATTCIEKRLKAINKTFELIDQ****************
MKIGYCQQIELEYVHNSANILSDKFSLSSEARKIPVLLTRILTEVDKLKNT**QPSSLKIDLTRADSSDFDCILCRSTIWKPVTTPCGHSYCWMCLDRCLDYSSSCPLCKTSLADVGILATTCIEKRLKAINKTFELIDQSERSQEFTM*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKIGYCQQIELEYVHNSANILSDKFSLSSEARKIPVLLTRILTEVDKLKNTEFQPSSLKIDLTRADSSDFDCILCRSTIWKPVTTPCGHSYCWMCLDRCLDYSSSCPLCKTSLADVGILATTCIEKRLKAINKTFELIDQSERSQEFTMAPPIKRG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query156 2.2.26 [Sep-21-2011]
Q17RB8 773 LON peptidase N-terminal yes N/A 0.435 0.087 0.437 6e-14
Q8HXH0 718 LON peptidase N-terminal N/A N/A 0.371 0.080 0.5 8e-14
Q496Y0 759 LON peptidase N-terminal no N/A 0.371 0.076 0.5 8e-14
Q1L5Z9 754 LON peptidase N-terminal no N/A 0.326 0.067 0.529 2e-13
Q9D4H7 753 LON peptidase N-terminal no N/A 0.307 0.063 0.562 1e-12
Q9UTL9 1375 Uncharacterized ATP-depen yes N/A 0.269 0.030 0.547 2e-07
O64425 249 E3 ubiquitin-protein liga no N/A 0.429 0.269 0.307 1e-06
Q9SYU4381 Peroxisome biogenesis fac no N/A 0.506 0.207 0.321 2e-06
Q5E9G4 489 Tripartite motif-containi no N/A 0.282 0.089 0.392 2e-05
O60106 486 LON peptidase N-terminal no N/A 0.339 0.109 0.358 2e-05
>sp|Q17RB8|LONF1_HUMAN LON peptidase N-terminal domain and RING finger protein 1 OS=Homo sapiens GN=LONRF1 PE=2 SV=2 Back     alignment and function desciption
 Score = 76.6 bits (187), Expect = 6e-14,   Method: Composition-based stats.
 Identities = 35/80 (43%), Positives = 50/80 (62%)

Query: 66  DSSDFDCILCRSTIWKPVTTPCGHSYCWMCLDRCLDYSSSCPLCKTSLADVGILATTCIE 125
           D SDF+C LC    ++PVTTPCGHS+C  CL+RCLD++  CPLCK SL +       C+ 
Sbjct: 473 DVSDFECSLCMRLFFEPVTTPCGHSFCKNCLERCLDHAPYCPLCKESLKEYLADRRYCVT 532

Query: 126 KRLKAINKTFELIDQSERSQ 145
           + L+ +   +   + SER +
Sbjct: 533 QLLEELIVKYLPDELSERKK 552

Homo sapiens (taxid: 9606)
>sp|Q8HXH0|LONF3_MACFA LON peptidase N-terminal domain and RING finger protein 3 OS=Macaca fascicularis GN=LONRF3 PE=2 SV=1 Back     alignment and function description
>sp|Q496Y0|LONF3_HUMAN LON peptidase N-terminal domain and RING finger protein 3 OS=Homo sapiens GN=LONRF3 PE=1 SV=1 Back     alignment and function description
>sp|Q1L5Z9|LONF2_HUMAN LON peptidase N-terminal domain and RING finger protein 2 OS=Homo sapiens GN=LONRF2 PE=2 SV=3 Back     alignment and function description
>sp|Q9D4H7|LONF3_MOUSE LON peptidase N-terminal domain and RING finger protein 3 OS=Mus musculus GN=Lonrf3 PE=2 SV=1 Back     alignment and function description
>sp|Q9UTL9|YIV5_SCHPO Uncharacterized ATP-dependent helicase C144.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.05 PE=3 SV=1 Back     alignment and function description
>sp|O64425|RMA1_ARATH E3 ubiquitin-protein ligase RMA1 OS=Arabidopsis thaliana GN=RMA1 PE=1 SV=1 Back     alignment and function description
>sp|Q9SYU4|PEX10_ARATH Peroxisome biogenesis factor 10 OS=Arabidopsis thaliana GN=PEX10 PE=1 SV=1 Back     alignment and function description
>sp|Q5E9G4|TRI10_BOVIN Tripartite motif-containing protein 10 OS=Bos taurus GN=TRIM10 PE=2 SV=1 Back     alignment and function description
>sp|O60106|YOXA_SCHPO LON peptidase N-terminal domain and RING finger protein C14F5.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC14F5.10c PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
307167420 555 LON peptidase N-terminal domain and RING 0.653 0.183 0.504 2e-21
345497763 577 PREDICTED: LON peptidase N-terminal doma 0.532 0.143 0.564 2e-21
350415011 724 PREDICTED: LON peptidase N-terminal doma 0.532 0.114 0.547 2e-21
340714815 724 PREDICTED: LON peptidase N-terminal doma 0.532 0.114 0.547 2e-21
332027519 418 LON peptidase N-terminal domain and RING 0.532 0.198 0.559 3e-21
322797331 520 hypothetical protein SINV_00469 [Solenop 0.634 0.190 0.5 3e-21
383854414 554 PREDICTED: LON peptidase N-terminal doma 0.532 0.149 0.559 4e-21
380017069 543 PREDICTED: LON peptidase N-terminal doma 0.634 0.182 0.490 5e-21
307191752 418 LON peptidase N-terminal domain and RING 0.5 0.186 0.594 8e-21
328791939 538 PREDICTED: LON peptidase N-terminal doma 0.634 0.184 0.480 2e-20
>gi|307167420|gb|EFN61005.1| LON peptidase N-terminal domain and RING finger protein 3 [Camponotus floridanus] Back     alignment and taxonomy information
 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 70/107 (65%), Gaps = 5/107 (4%)

Query: 33  KIPVLLTRILTEVDKLKNTEFQPSSLKID-LTRADSSDFDCILCRSTIWKPVTTPCGHSY 91
           K+   L R+  +V+KLK  E +P+ + +  L+   + + DCILC   +WKPVTTPCGH+Y
Sbjct: 182 KLQASLNRVYQDVEKLKRIEPRPAEILLPPLSGCTAGELDCILCCRLLWKPVTTPCGHTY 241

Query: 92  CWMCLDRCLDYSSSCPLCKTSLADV----GILATTCIEKRLKAINKT 134
           CWMCLDRCLDYSS+CPLC TSLAD         T  +EK LK +  T
Sbjct: 242 CWMCLDRCLDYSSACPLCVTSLADYLASSQKTVTDFVEKALKTVAPT 288

Source: Camponotus floridanus

Species: Camponotus floridanus

Genus: Camponotus

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|345497763|ref|XP_001599271.2| PREDICTED: LON peptidase N-terminal domain and RING finger protein 3-like, partial [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350415011|ref|XP_003490502.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340714815|ref|XP_003395919.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 3-like isoform 1 [Bombus terrestris] gi|340714817|ref|XP_003395920.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 3-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|332027519|gb|EGI67596.1| LON peptidase N-terminal domain and RING finger protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322797331|gb|EFZ19443.1| hypothetical protein SINV_00469 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|383854414|ref|XP_003702716.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 3-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380017069|ref|XP_003692488.1| PREDICTED: LON peptidase N-terminal domain and RING finger protein 3-like [Apis florea] Back     alignment and taxonomy information
>gi|307191752|gb|EFN75194.1| LON peptidase N-terminal domain and RING finger protein 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|328791939|ref|XP_395138.3| PREDICTED: LON peptidase N-terminal domain and RING finger protein 3-like [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query156
FB|FBgn0052369 1066 CG32369 [Drosophila melanogast 0.544 0.079 0.454 1.2e-24
UNIPROTKB|E1B964 638 LOC100849413 "Uncharacterized 0.512 0.125 0.437 1.7e-15
UNIPROTKB|J9P3L7 769 LONRF1 "Uncharacterized protei 0.512 0.104 0.437 3.1e-15
UNIPROTKB|F1P5G6 753 LONRF2 "Uncharacterized protei 0.628 0.130 0.407 4.2e-15
UNIPROTKB|F1SEU6 770 LONRF1 "Uncharacterized protei 0.512 0.103 0.437 4.9e-15
UNIPROTKB|H7C5V9 376 LONRF1 "LON peptidase N-termin 0.730 0.303 0.359 6.9e-15
ZFIN|ZDB-GENE-030131-8303 488 si:ch1073-440b2.1 "si:ch1073-4 0.435 0.139 0.471 2.3e-14
UNIPROTKB|B3KUN7 503 LONRF3 "LON peptidase N-termin 0.371 0.115 0.5 5.1e-14
RGD|1562137 517 Lonrf2 "LON peptidase N-termin 0.346 0.104 0.535 5.4e-14
UNIPROTKB|H0Y7Q8 525 LONRF3 "LON peptidase N-termin 0.371 0.110 0.5 5.6e-14
FB|FBgn0052369 CG32369 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 236 (88.1 bits), Expect = 1.2e-24, Sum P(3) = 1.2e-24
 Identities = 40/88 (45%), Positives = 57/88 (64%)

Query:    37 LLTRILTEVDKLKNTEFQPSSLKIDLTRA---DSSDFDCILCRSTIWKPVTTPCGHSYCW 93
             +L R   E+ +LK  +    SL +        D+SDFDC++C  T+WKPV TPCGH+YC 
Sbjct:   650 VLDRTQQELQRLKKLDKSAPSLAVSSVAGQLIDASDFDCVVCSRTLWKPVVTPCGHTYCL 709

Query:    94 MCLDRCLDYSSSCPLCKTSLADVGILAT 121
             +CLDRC+DY+S CPLC + L +  + A+
Sbjct:   710 VCLDRCMDYNSPCPLCMSPLVEFNVNAS 737
GO:0006508 "proteolysis" evidence=IEA
GO:0008270 "zinc ion binding" evidence=IEA
GO:0004176 "ATP-dependent peptidase activity" evidence=IEA
UNIPROTKB|E1B964 LOC100849413 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9P3L7 LONRF1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1P5G6 LONRF2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SEU6 LONRF1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|H7C5V9 LONRF1 "LON peptidase N-terminal domain and RING finger protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-8303 si:ch1073-440b2.1 "si:ch1073-440b2.1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|B3KUN7 LONRF3 "LON peptidase N-terminal domain and RING finger protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1562137 Lonrf2 "LON peptidase N-terminal domain and ring finger 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|H0Y7Q8 LONRF3 "LON peptidase N-terminal domain and RING finger protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 3e-08
cd0016245 cd00162, RING, RING-finger (Really Interesting New 1e-07
COG5574271 COG5574, PEX10, RING-finger-containing E3 ubiquiti 3e-07
TIGR00599 397 TIGR00599, rad18, DNA repair protein rad18 4e-07
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 5e-07
PLN03208193 PLN03208, PLN03208, E3 ubiquitin-protein ligase RM 3e-06
COG5432 391 COG5432, RAD18, RING-finger-containing E3 ubiquiti 2e-05
smart0018440 smart00184, RING, Ring finger 3e-05
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 1e-04
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 3e-04
COG5152259 COG5152, COG5152, Uncharacterized conserved protei 0.002
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information 
 Score = 47.0 bits (112), Expect = 3e-08
 Identities = 16/46 (34%), Positives = 24/46 (52%), Gaps = 3/46 (6%)

Query: 70  FDCILCRSTI---WKPVTTPCGHSYCWMCLDRCLDYSSSCPLCKTS 112
            +C +C        + V  PCGH +   CLD+ L  S++CPLC+  
Sbjct: 1   DECPICLDEFEPGEEVVVLPCGHVFHKECLDKWLRSSNTCPLCRAP 46

Length = 46
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|227861 COG5574, PEX10, RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>gnl|CDD|227719 COG5432, RAD18, RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227481 COG5152, COG5152, Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 156
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.51
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 99.48
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.46
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 99.45
KOG0287|consensus 442 99.39
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.39
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.33
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.31
KOG0823|consensus230 99.31
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.29
KOG0317|consensus293 99.28
KOG0320|consensus187 99.24
PHA02929238 N1R/p28-like protein; Provisional 99.21
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 99.16
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 99.13
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 99.13
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 99.09
cd0016245 RING RING-finger (Really Interesting New Gene) dom 99.07
KOG0978|consensus698 99.05
PF1463444 zf-RING_5: zinc-RING finger domain 99.01
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.95
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.93
PHA02926242 zinc finger-like protein; Provisional 98.92
KOG2177|consensus 386 98.88
KOG4628|consensus348 98.86
KOG2660|consensus 331 98.83
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.79
KOG2164|consensus 513 98.79
KOG4159|consensus 398 98.76
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.64
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.64
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.63
KOG0802|consensus 543 98.6
KOG0311|consensus 381 98.58
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.58
COG5222427 Uncharacterized conserved protein, contains RING Z 98.53
COG5152259 Uncharacterized conserved protein, contains RING a 98.51
KOG1813|consensus313 98.36
KOG0824|consensus 324 98.3
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 98.21
KOG4265|consensus349 98.16
KOG2879|consensus298 98.14
KOG0297|consensus 391 98.1
KOG1002|consensus 791 97.98
KOG4172|consensus62 97.97
KOG0827|consensus 465 97.91
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.91
KOG1734|consensus328 97.85
KOG0804|consensus 493 97.76
PF04641260 Rtf2: Rtf2 RING-finger 97.75
KOG1785|consensus 563 97.69
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.68
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 97.62
KOG1039|consensus344 97.6
COG52191525 Uncharacterized conserved protein, contains RING Z 97.53
KOG1645|consensus 463 97.53
KOG4692|consensus489 97.53
KOG0828|consensus636 97.47
KOG0825|consensus 1134 97.45
KOG3039|consensus303 97.44
KOG4367|consensus 699 97.41
KOG1493|consensus84 97.39
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 97.26
KOG4185|consensus 296 97.17
KOG2817|consensus394 97.09
KOG4275|consensus350 96.91
KOG1814|consensus 445 96.8
KOG1941|consensus518 96.73
KOG2114|consensus933 96.72
KOG2930|consensus114 96.7
KOG1571|consensus355 96.66
KOG0826|consensus357 96.61
KOG1001|consensus 674 96.5
KOG3002|consensus 299 96.47
KOG4739|consensus 233 96.44
KOG3800|consensus 300 96.2
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.17
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.17
KOG3970|consensus 299 96.04
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 95.84
KOG1940|consensus276 95.7
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 95.64
KOG2932|consensus 389 95.36
KOG3113|consensus293 95.28
KOG3268|consensus234 95.27
KOG0298|consensus 1394 95.15
KOG4445|consensus 368 95.12
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 95.0
COG5175 480 MOT2 Transcriptional repressor [Transcription] 94.93
KOG3161|consensus 861 94.77
COG5109396 Uncharacterized conserved protein, contains RING Z 94.48
PHA03096284 p28-like protein; Provisional 94.34
PHA02825162 LAP/PHD finger-like protein; Provisional 94.15
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 94.01
KOG4362|consensus 684 93.89
KOG1100|consensus207 93.6
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 93.52
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 93.5
KOG1428|consensus 3738 92.94
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 92.91
KOG3039|consensus 303 92.44
PHA02862156 5L protein; Provisional 92.33
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 92.19
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 92.14
KOG3579|consensus352 91.59
COG381384 Uncharacterized protein conserved in bacteria [Fun 91.14
PF10272358 Tmpp129: Putative transmembrane protein precursor; 89.88
KOG1812|consensus 384 89.86
KOG1952|consensus 950 89.45
PF0690657 DUF1272: Protein of unknown function (DUF1272); In 87.77
KOG0827|consensus 465 86.58
PF1023590 Cript: Microtubule-associated protein CRIPT; Inter 86.3
KOG2042|consensus943 85.27
KOG3899|consensus381 85.12
KOG4718|consensus235 84.73
KOG2034|consensus911 84.71
KOG1815|consensus 444 84.6
KOG0309|consensus1081 84.58
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 84.15
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 83.62
KOG4642|consensus284 82.96
PF04216290 FdhE: Protein involved in formate dehydrogenase fo 81.35
KOG2113|consensus394 81.2
PRK06266178 transcription initiation factor E subunit alpha; V 80.94
PF0797551 C1_4: TFIIH C1-like domain; InterPro: IPR004595 Al 80.89
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information 
Probab=99.51  E-value=1.4e-14  Score=88.89  Aligned_cols=61  Identities=20%  Similarity=0.360  Sum_probs=52.4

Q ss_pred             ccccccccccccccEEcccCCcchHHhHHHHhcCCCCCcccccCCcCCCccccHHHHHHHHHHHH
Q psy2479          69 DFDCILCRSTIWKPVTTPCGHSYCWMCLDRCLDYSSSCPLCKTSLADVGILATTCIEKRLKAINK  133 (156)
Q Consensus        69 ~~~C~IC~~~~~~pv~~~CgH~fC~~Ci~~~~~~~~~CP~Cr~~~~~~~~~~~~~~n~~l~~l~~  133 (156)
                      ++.||||.+.+.+|+.++|||+||+.||.+|+.....||.|+.++...+++    .|..+++.++
T Consensus         1 ~~~Cpi~~~~~~~Pv~~~~G~v~~~~~i~~~~~~~~~cP~~~~~~~~~~l~----~~~~l~~~i~   61 (63)
T smart00504        1 EFLCPISLEVMKDPVILPSGQTYERRAIEKWLLSHGTDPVTGQPLTHEDLI----PNLALKSAIQ   61 (63)
T ss_pred             CcCCcCCCCcCCCCEECCCCCEEeHHHHHHHHHHCCCCCCCcCCCChhhce----eCHHHHHHHH
Confidence            367999999999999999999999999999998888999999999888884    4455555544

Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>KOG2177|consensus Back     alignment and domain information
>KOG4628|consensus Back     alignment and domain information
>KOG2660|consensus Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>KOG4159|consensus Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>KOG0311|consensus Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>KOG0824|consensus Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG4265|consensus Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>KOG0297|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG4172|consensus Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG1734|consensus Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG4692|consensus Back     alignment and domain information
>KOG0828|consensus Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>KOG1493|consensus Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG4185|consensus Back     alignment and domain information
>KOG2817|consensus Back     alignment and domain information
>KOG4275|consensus Back     alignment and domain information
>KOG1814|consensus Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG2930|consensus Back     alignment and domain information
>KOG1571|consensus Back     alignment and domain information
>KOG0826|consensus Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>KOG3002|consensus Back     alignment and domain information
>KOG4739|consensus Back     alignment and domain information
>KOG3800|consensus Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG3970|consensus Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG1940|consensus Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG2932|consensus Back     alignment and domain information
>KOG3113|consensus Back     alignment and domain information
>KOG3268|consensus Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>KOG4445|consensus Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG3161|consensus Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG4362|consensus Back     alignment and domain information
>KOG1100|consensus Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG1428|consensus Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG3579|consensus Back     alignment and domain information
>COG3813 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG1812|consensus Back     alignment and domain information
>KOG1952|consensus Back     alignment and domain information
>PF06906 DUF1272: Protein of unknown function (DUF1272); InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>PF10235 Cript: Microtubule-associated protein CRIPT; InterPro: IPR019367 The CRIPT protein is a cytoskeletal protein involved in microtubule production Back     alignment and domain information
>KOG2042|consensus Back     alignment and domain information
>KOG3899|consensus Back     alignment and domain information
>KOG4718|consensus Back     alignment and domain information
>KOG2034|consensus Back     alignment and domain information
>KOG1815|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>PF04216 FdhE: Protein involved in formate dehydrogenase formation; InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex [] Back     alignment and domain information
>KOG2113|consensus Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PF07975 C1_4: TFIIH C1-like domain; InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
3fl2_A124 Crystal Structure Of The Ring Domain Of The E3 Ubiq 4e-05
1z6u_A150 Np95-Like Ring Finger Protein Isoform B [homo Sapie 4e-04
4ayc_A138 Rnf8 Ring Domain Structure Length = 138 5e-04
4ayc_B138 Rnf8 Ring Domain Structure Length = 138 6e-04
4epo_C149 Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE 7e-04
1jm7_A112 Solution Structure Of The Brca1/bard1 Ring-domain H 7e-04
2ysl_A73 Solution Structure Of The Ring Domain (1-66) From T 8e-04
>pdb|3FL2|A Chain A, Crystal Structure Of The Ring Domain Of The E3 Ubiquitin- Protein Ligase Uhrf1 Length = 124 Back     alignment and structure 
Iteration: 1

 Score = 43.9 bits (102), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 2/68 (2%)
Query: 48  LKNTEFQPSSLKIDLTRADSSDFDCILCRSTIWKPVTTPCGHSYCWMCLDRCLDYSS-SC 106
           LK+     S  ++ L++ + + F CI C+  +++P+TT C H+ C  CLDR       SC
Sbjct: 32  LKDRPASGSPFQLFLSKVEET-FQCICCQELVFRPITTVCQHNVCKDCLDRSFRAQVFSC 90
Query: 107 PLCKTSLA 114
           P C+  L 
Sbjct: 91  PACRYDLG 98
>pdb|1Z6U|A Chain A, Np95-Like Ring Finger Protein Isoform B [homo Sapiens] Length = 150 Back     alignment and structure
>pdb|4AYC|A Chain A, Rnf8 Ring Domain Structure Length = 138 Back     alignment and structure
>pdb|4AYC|B Chain B, Rnf8 Ring Domain Structure Length = 138 Back     alignment and structure
>pdb|4EPO|C Chain C, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 149 Back     alignment and structure
>pdb|2YSL|A Chain A, Solution Structure Of The Ring Domain (1-66) From Tripartite Motif-containing Protein 31 Length = 73 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query156
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 1e-16
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 8e-15
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 9e-15
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 4e-13
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 5e-13
1z6u_A150 NP95-like ring finger protein isoform B; structura 6e-12
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 1e-11
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 6e-11
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 1e-10
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 2e-10
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 3e-10
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 9e-10
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 1e-09
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 1e-09
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 2e-09
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 2e-09
2ecw_A85 Tripartite motif-containing protein 30; metal bind 2e-09
2ysl_A73 Tripartite motif-containing protein 31; ring-type 5e-09
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 5e-09
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 5e-09
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 6e-09
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 9e-09
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 1e-08
2ysj_A63 Tripartite motif-containing protein 31; ring-type 3e-08
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 3e-08
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 4e-08
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 8e-08
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 1e-07
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 3e-07
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 1e-04
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 4e-07
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 5e-07
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 5e-07
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 7e-07
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 2e-06
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 5e-06
2ecm_A55 Ring finger and CHY zinc finger domain- containing 3e-05
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 4e-05
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 1e-04
2ect_A78 Ring finger protein 126; metal binding protein, st 2e-04
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 3e-04
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
 Score = 70.8 bits (173), Expect = 1e-16
 Identities = 17/93 (18%), Positives = 40/93 (43%), Gaps = 2/93 (2%)

Query: 46  DKLKNTEFQPSSLKIDLTRADSSDFDCILCRSTIWKPVTTPCGHSYCWMCLDRCLDYSSS 105
           ++ +  + Q   +   +     ++  CI+C     + VT  C HS+C  C++  +     
Sbjct: 41  EEKEKMQAQKEEVLSHMNDVLENELQCIICSEYFIEAVTLNCAHSFCSYCINEWMKRKIE 100

Query: 106 CPLCKTSLA--DVGILATTCIEKRLKAINKTFE 136
           CP+C+  +      ++   CI K +  ++   +
Sbjct: 101 CPICRKDIKSKTYSLVLDNCINKMVNNLSSEVK 133
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 65 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.72
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.72
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.72
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.71
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.7
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.66
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.66
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.65
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.65
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.62
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.62
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.61
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.61
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.6
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.59
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.59
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.58
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.58
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.58
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.56
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.55
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.55
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.55
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.55
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.55
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.55
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.55
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.55
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.53
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.53
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.52
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.51
2ect_A78 Ring finger protein 126; metal binding protein, st 99.49
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.49
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.48
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.48
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.47
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.47
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.46
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.46
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.45
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.45
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.44
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.43
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.42
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.42
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.42
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.38
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.37
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.37
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.34
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.33
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.31
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.3
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.22
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.21
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.21
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.19
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 99.19
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 99.17
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.15
2ea5_A68 Cell growth regulator with ring finger domain prot 99.09
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 99.08
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.99
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.97
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.93
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.91
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.69
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.43
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.36
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.26
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 98.22
3nw0_A238 Non-structural maintenance of chromosomes element 97.33
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 97.14
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 94.79
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 93.14
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 92.63
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 91.46
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 85.2
1z60_A59 TFIIH basal transcription factor complex P44 subun 85.13
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 84.47
3zyq_A226 Hepatocyte growth factor-regulated tyrosine kinas 83.59
1wil_A89 KIAA1045 protein; ring finger domain, structural g 83.17
1dvp_A220 HRS, hepatocyte growth factor-regulated tyrosine k 83.08
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
Probab=99.72  E-value=2.3e-18  Score=111.28  Aligned_cols=74  Identities=20%  Similarity=0.167  Sum_probs=64.0

Q ss_pred             cCCCcccccccccccccccEEcccCCcchHHhHHHHhcCCCCCcccccCCcCCCccccHHHHHHHHHHHHHHHHhccc
Q psy2479          64 RADSSDFDCILCRSTIWKPVTTPCGHSYCWMCLDRCLDYSSSCPLCKTSLADVGILATTCIEKRLKAINKTFELIDQS  141 (156)
Q Consensus        64 ~~~~~~~~C~IC~~~~~~pv~~~CgH~fC~~Ci~~~~~~~~~CP~Cr~~~~~~~~~~~~~~n~~l~~l~~~~~~~~~~  141 (156)
                      ..+.+.+.||||+++|.+||+++|||+||+.||..|+....+||.|+.++....+    .+|..+.++++.|......
T Consensus         9 ~~~p~~~~CpI~~~~m~dPV~~~cGhtf~r~~I~~~l~~~~~cP~~~~~l~~~~l----~pn~~L~~~i~~~~~~~~~   82 (85)
T 2kr4_A            9 SDAPDEFRDPLMDTLMTDPVRLPSGTVMDRSIILRHLLNSPTDPFNRQMLTESML----EPVPELKEQIQAWMREKQS   82 (85)
T ss_dssp             TTCCTTTBCTTTCSBCSSEEECTTSCEEEHHHHHHHHHHCSBCTTTCCBCCGGGC----EECHHHHHHHHHHHHHHHH
T ss_pred             hcCchheECcccCchhcCCeECCCCCEECHHHHHHHHhcCCCCCCCcCCCChHhc----chHHHHHHHHHHHHHHhhh
Confidence            4567789999999999999999999999999999999888999999999988877    5566677888888765543
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1z60_A TFIIH basal transcription factor complex P44 subunit; basic transcription factor, zinc binding protein, ring finger; NMR {Homo sapiens} SCOP: g.49.1.2 Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>3zyq_A Hepatocyte growth factor-regulated tyrosine kinas substrate; signaling; 1.48A {Homo sapiens} PDB: 4avx_A* Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>1dvp_A HRS, hepatocyte growth factor-regulated tyrosine kinase substrate; VHS, FYVE, zinc finger, superhelix, transferase; HET: CIT; 2.00A {Drosophila melanogaster} SCOP: a.118.9.2 g.50.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 156
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 4e-09
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 6e-09
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 1e-08
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 7e-08
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 8e-08
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 6e-06
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 1e-05
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 6e-05
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 0.001
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 0.003
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: V(D)J recombination activating protein 1 (RAG1), dimerization domain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 48.8 bits (116), Expect = 4e-09
 Identities = 18/66 (27%), Positives = 25/66 (37%), Gaps = 1/66 (1%)

Query: 49  KNTEFQPSSLKIDLTRADSSDFDCILCRSTIWKPVTTPCGHSYCWMCLDRCLDY-SSSCP 107
                    L +D          C +C   +  PV T C H +C +C+ RCL    S CP
Sbjct: 3   SKIHLSTKLLAVDFPAHFVKSISCQICEHILADPVETSCKHLFCRICILRCLKVMGSYCP 62

Query: 108 LCKTSL 113
            C+   
Sbjct: 63  SCRYPC 68
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query156
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.73
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.72
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.65
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.65
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.63
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.63
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.57
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.49
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.48
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.47
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.45
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.4
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.19
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.18
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.0
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.61
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 95.26
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 95.13
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 88.59
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 82.46
d1y02a251 Rififylin (FYVE-RING finger protein Sakura) {Human 82.2
d1dvpa272 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 80.28
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: STIP1 homology and U box-containing protein 1, STUB1
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.73  E-value=6.3e-19  Score=111.17  Aligned_cols=70  Identities=14%  Similarity=0.166  Sum_probs=60.4

Q ss_pred             CCCcccccccccccccccEEcccCCcchHHhHHHHhcC-CCCCcccccCCcCCCccccHHHHHHHHHHHHHHHHh
Q psy2479          65 ADSSDFDCILCRSTIWKPVTTPCGHSYCWMCLDRCLDY-SSSCPLCKTSLADVGILATTCIEKRLKAINKTFELI  138 (156)
Q Consensus        65 ~~~~~~~C~IC~~~~~~pv~~~CgH~fC~~Ci~~~~~~-~~~CP~Cr~~~~~~~~~~~~~~n~~l~~l~~~~~~~  138 (156)
                      ++.+++.||||.++|.+||+++|||+||..||..|+.. ...||.||.++....+    .+|..|+++++.|...
T Consensus         3 eiP~~l~CpIc~~l~~dPv~~~cGhtfc~~ci~~~l~~~~~~cP~c~~~l~~~~l----~pN~~L~~~I~~~l~~   73 (80)
T d2c2la2           3 DIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFNPVTRSPLTQEQL----IPNLAMKEVIDAFISE   73 (80)
T ss_dssp             CCCSTTBCTTTCSBCSSEEECSSCCEEETTHHHHHHHHTCSSCTTTCCCCCGGGC----EECHHHHHHHHHHHTT
T ss_pred             CCCccccCcCcCchhhhhcccCCcCeecHHHHHHHHhcCCccCCCcccccccccc----ccHHHHHHHHHHHHHH
Confidence            45688999999999999999999999999999999965 5689999999988877    4567778888887643
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure