Psyllid ID: psy2501


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130
VAPQQLEHSVTDSSSVSYSKPNQPVHQKGKQLDCMLDSLTAEMSRQGVTTTQKGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILDVSIRNT
ccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccEEEccccccccccccccccccccccccEEcccccccHHHHHHHccccccccccccccccEEcc
ccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccHHHEHHcccccccccEEEHHcccccccccEEEcccccccHHHHHHHcccHHccccccccccEEccc
vapqqlehsvtdsssvsyskpnqpvhqkgkqLDCMLDSLTAEMsrqgvtttqkgccsscdkpiVGQVITAlgktwhpehficthcnqelgtrnfferdsrpycepdyhnlfsprcsycngpildvsirnt
vapqqlehsvtdsssvsyskpnqpvhqkgkQLDCMLDSLTAEMSRQGVtttqkgccsscdKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYhnlfsprcsycngpILDVSIRNT
VAPQQLEHsvtdsssvsysKPNQPVHQKGKQLDCMLDSLTAEMSRQGVTTTQKGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILDVSIRNT
***********************************************VTTTQKGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILDVS****
**************************************************TQKGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILDVSIRN*
*****************************KQLDCMLDSLTAEMS**********CCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILDVSIRNT
*********************************C*L*S**A**SRQGVTTTQKGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILDVSI***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VAPQQLEHSVTDSSSVSYSKPNQPVHQKGKQLDCMLDSLTAEMSRQGVTTTQKGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILDVSIRNT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query130 2.2.26 [Sep-21-2011]
P49024 559 Paxillin OS=Gallus gallus yes N/A 0.8 0.186 0.650 3e-40
Q66H76 586 Paxillin OS=Rattus norveg yes N/A 0.8 0.177 0.641 7e-40
Q8VI36 591 Paxillin OS=Mus musculus yes N/A 0.930 0.204 0.569 7e-40
P49023 591 Paxillin OS=Homo sapiens yes N/A 0.730 0.160 0.680 3e-39
Q5R7I1 591 Paxillin OS=Pongo abelii yes N/A 0.730 0.160 0.680 3e-39
Q9N261 386 Leupaxin OS=Oryctolagus c no N/A 0.7 0.235 0.612 2e-30
Q2TCH4 506 Transforming growth facto N/A N/A 0.838 0.215 0.532 5e-30
Q99N69 386 Leupaxin OS=Mus musculus no N/A 0.784 0.264 0.557 1e-29
O60711 386 Leupaxin OS=Homo sapiens no N/A 0.638 0.215 0.591 2e-29
Q3MHZ4 456 Transforming growth facto no N/A 0.838 0.239 0.513 1e-27
>sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 Back     alignment and function desciption
 Score =  163 bits (412), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 83/106 (78%)

Query: 19  SKPNQPVHQKGKQLDCMLDSLTAEMSRQGVTTTQKGCCSSCDKPIVGQVITALGKTWHPE 78
           S P     + G QLD ML SL +++++ GV T  KG C +C KPI GQV+TA+GKTWHPE
Sbjct: 289 SSPPSTTPKPGSQLDTMLGSLQSDLNKLGVATVAKGVCGACKKPIAGQVVTAMGKTWHPE 348

Query: 79  HFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILD 124
           HF+CTHC +E+G+RNFFERD +PYCE DYHNLFSPRC YCNGPILD
Sbjct: 349 HFVCTHCQEEIGSRNFFERDGQPYCEKDYHNLFSPRCYYCNGPILD 394




Cytoskeletal protein involved in actin-membrane attachment at sites of cell adhesion to the extracellular matrix (focal adhesion). Binds in vitro to vinculin as well as to the SH3 domain of c-SRC and, when tyrosine phosphorylated, to the SH2 domain of v-CRK.
Gallus gallus (taxid: 9031)
>sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 Back     alignment and function description
>sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 Back     alignment and function description
>sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 Back     alignment and function description
>sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 Back     alignment and function description
>sp|Q9N261|LPXN_RABIT Leupaxin OS=Oryctolagus cuniculus GN=LPXN PE=2 SV=1 Back     alignment and function description
>sp|Q2TCH4|TGFI1_XENLA Transforming growth factor beta-1-induced transcript 1 protein OS=Xenopus laevis GN=tgfb1i1 PE=1 SV=2 Back     alignment and function description
>sp|Q99N69|LPXN_MOUSE Leupaxin OS=Mus musculus GN=Lpxn PE=1 SV=2 Back     alignment and function description
>sp|O60711|LPXN_HUMAN Leupaxin OS=Homo sapiens GN=LPXN PE=1 SV=1 Back     alignment and function description
>sp|Q3MHZ4|TGFI1_BOVIN Transforming growth factor beta-1-induced transcript 1 protein OS=Bos taurus GN=TGFB1I1 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
328709648 424 PREDICTED: paxillin-like isoform 2 [Acyr 0.861 0.264 0.758 1e-46
383863879 607 PREDICTED: paxillin-like [Megachile rotu 0.8 0.171 0.819 2e-46
270016014 488 hypothetical protein TcasGA2_TC010609 [T 0.9 0.239 0.726 3e-46
328709646 474 PREDICTED: paxillin-like isoform 3 [Acyr 0.861 0.236 0.758 3e-46
312372729 286 hypothetical protein AND_19782 [Anophele 0.915 0.416 0.739 4e-46
380025704 572 PREDICTED: paxillin-like isoform 1 [Apis 0.8 0.181 0.819 4e-46
189242184 448 PREDICTED: similar to paxillin [Triboliu 0.9 0.261 0.726 4e-46
380025706 607 PREDICTED: paxillin-like isoform 2 [Apis 0.8 0.171 0.819 5e-46
350421197 607 PREDICTED: paxillin-like [Bombus impatie 0.8 0.171 0.819 5e-46
340714019 605 PREDICTED: paxillin-like [Bombus terrest 0.8 0.171 0.819 6e-46
>gi|328709648|ref|XP_003244023.1| PREDICTED: paxillin-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 85/112 (75%), Positives = 93/112 (83%)

Query: 13  SSSVSYSKPNQPVHQKGKQLDCMLDSLTAEMSRQGVTTTQKGCCSSCDKPIVGQVITALG 72
           SS V  S   +       +LDCML SLTAEM+RQGV TTQKGCC++CDK IVGQVITALG
Sbjct: 206 SSPVRASYATESADSAAPRLDCMLGSLTAEMNRQGVNTTQKGCCTACDKAIVGQVITALG 265

Query: 73  KTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILD 124
           KTWHPEHF C HC+QELGTRNFFER+ RPYCEPDYHNLFSPRC+YCNGPILD
Sbjct: 266 KTWHPEHFTCNHCSQELGTRNFFEREGRPYCEPDYHNLFSPRCAYCNGPILD 317




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383863879|ref|XP_003707407.1| PREDICTED: paxillin-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|270016014|gb|EFA12462.1| hypothetical protein TcasGA2_TC010609 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328709646|ref|XP_001945795.2| PREDICTED: paxillin-like isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|312372729|gb|EFR20625.1| hypothetical protein AND_19782 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|380025704|ref|XP_003696608.1| PREDICTED: paxillin-like isoform 1 [Apis florea] Back     alignment and taxonomy information
>gi|189242184|ref|XP_969819.2| PREDICTED: similar to paxillin [Tribolium castaneum] Back     alignment and taxonomy information
>gi|380025706|ref|XP_003696609.1| PREDICTED: paxillin-like isoform 2 [Apis florea] Back     alignment and taxonomy information
>gi|350421197|ref|XP_003492766.1| PREDICTED: paxillin-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340714019|ref|XP_003395530.1| PREDICTED: paxillin-like [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query130
FB|FBgn0041789 581 Pax "Paxillin" [Drosophila mel 0.723 0.161 0.819 1.5e-42
UNIPROTKB|F1NB68 559 PXN "Paxillin" [Gallus gallus 0.8 0.186 0.653 4.8e-39
UNIPROTKB|P49024 559 PXN "Paxillin" [Gallus gallus 0.8 0.186 0.653 4.8e-39
UNIPROTKB|F1PUT6 590 PXN "Uncharacterized protein" 0.792 0.174 0.663 6.1e-39
UNIPROTKB|E7EMK8 403 PXN "Paxillin" [Homo sapiens ( 0.792 0.255 0.663 6.1e-39
UNIPROTKB|F5GZ78 589 PXN "Paxillin" [Homo sapiens ( 0.792 0.174 0.663 6.1e-39
UNIPROTKB|P49023 591 PXN "Paxillin" [Homo sapiens ( 0.792 0.174 0.663 6.1e-39
UNIPROTKB|F1MFD1 586 PXN "Uncharacterized protein" 0.792 0.175 0.663 6.1e-39
MGI|MGI:108295 591 Pxn "paxillin" [Mus musculus ( 0.8 0.175 0.644 2.1e-38
RGD|1305759 586 Pxn "paxillin" [Rattus norvegi 0.8 0.177 0.644 2.1e-38
FB|FBgn0041789 Pax "Paxillin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 450 (163.5 bits), Expect = 1.5e-42, P = 1.5e-42
 Identities = 77/94 (81%), Positives = 83/94 (88%)

Query:    31 QLDCMLDSLTAEMSRQGVTTTQKGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELG 90
             QLD ML +L A MSRQGV T QKGCC++C+KPIVGQVITALGKTWHPEHF C HC+QELG
Sbjct:   323 QLDSMLGNLQANMSRQGVNTVQKGCCNACEKPIVGQVITALGKTWHPEHFTCNHCSQELG 382

Query:    91 TRNFFERDSRPYCEPDYHNLFSPRCSYCNGPILD 124
             TRNFFERD  PYCEPDYHNLFSPRC+YCNG ILD
Sbjct:   383 TRNFFERDGFPYCEPDYHNLFSPRCAYCNGAILD 416


GO:0007016 "cytoskeletal anchoring at plasma membrane" evidence=ISS
GO:0005925 "focal adhesion" evidence=ISS;NAS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0035218 "leg disc development" evidence=IMP
GO:0032319 "regulation of Rho GTPase activity" evidence=IGI
GO:0035220 "wing disc development" evidence=IMP
GO:0010506 "regulation of autophagy" evidence=IGI
UNIPROTKB|F1NB68 PXN "Paxillin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P49024 PXN "Paxillin" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1PUT6 PXN "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E7EMK8 PXN "Paxillin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F5GZ78 PXN "Paxillin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P49023 PXN "Paxillin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MFD1 PXN "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:108295 Pxn "paxillin" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1305759 Pxn "paxillin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P49023PAXI_HUMANNo assigned EC number0.68040.73070.1607yesN/A
P49024PAXI_CHICKNo assigned EC number0.65090.80.1860yesN/A
Q66H76PAXI_RATNo assigned EC number0.64150.80.1774yesN/A
Q8VI36PAXI_MOUSENo assigned EC number0.56910.93070.2047yesN/A
Q5R7I1PAXI_PONABNo assigned EC number0.68040.73070.1607yesN/A
Q8MML5PAXB_DICDINo assigned EC number0.55220.51530.1177yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
cd0933653 cd09336, LIM1_Paxillin_like, The first LIM domain 1e-32
cd0940655 cd09406, LIM1_Leupaxin, The first LIM domain of Le 1e-27
cd0940554 cd09405, LIM1_Paxillin, The first LIM domain of pa 8e-27
pfam0041258 pfam00412, LIM, LIM domain 1e-19
cd0933752 cd09337, LIM2_Paxillin_like, The second LIM domain 3e-19
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 4e-17
cd0933853 cd09338, LIM3_Paxillin_like, The third LIM domain 6e-17
cd0940852 cd09408, LIM2_Leupaxin, The second LIM domain of L 1e-16
cd0933454 cd09334, LIM4_PINCH, The fourth LIM domain of prot 2e-15
cd0940752 cd09407, LIM2_Paxillin, The second LIM domain of p 5e-15
cd0933952 cd09339, LIM4_Paxillin_like, The fourth LIM domain 1e-13
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 1e-13
cd0941152 cd09411, LIM4_Paxillin, The fourth LIM domain of P 2e-12
cd0941252 cd09412, LIM4_Leupaxin, The fourth LIM domain of L 2e-12
cd0936152 cd09361, LIM1_Enigma_like, The first LIM domain of 2e-12
cd0936252 cd09362, LIM2_Enigma_like, The second LIM domain o 2e-12
cd0941053 cd09410, LIM3_Leupaxin, The third LIM domain of Le 1e-11
cd0940953 cd09409, LIM3_Paxillin, The third LIM domain of pa 2e-11
cd0945352 cd09453, LIM1_ENH, The first LIM domain of the Eni 2e-10
cd0945554 cd09455, LIM1_Enigma_like_1, The first LIM domain 2e-10
cd0945252 cd09452, LIM1_Enigma, The first LIM domain of Enig 3e-10
cd0945752 cd09457, LIM2_ENH, The second LIM domain of the En 4e-10
cd0934156 cd09341, LIM2_Testin_like, The second LIM domain o 6e-10
cd0939253 cd09392, LIM2_Lrg1p_like, The second LIM domain of 6e-10
cd0945652 cd09456, LIM2_Enigma, The second LIM domain of Eni 7e-10
cd0933554 cd09335, LIM5_PINCH, The fifth LIM domain of prote 2e-09
cd0932952 cd09329, LIM3_abLIM, The third LIM domain of actin 4e-09
cd0935360 cd09353, LIM2_Zyxin, The second LIM domain of Zyxi 4e-09
cd0933159 cd09331, LIM1_PINCH, The first LIM domain of prote 4e-09
cd0934652 cd09346, LIM3_FHL, The third LIM domain of Four an 4e-08
cd0945452 cd09454, LIM1_ZASP_Cypher, The first LIM domain of 4e-08
cd0943052 cd09430, LIM5_LIMPETin, The fifth LIM domain of pr 4e-08
cd0933252 cd09332, LIM2_PINCH, The second LIM domain of prot 6e-08
cd0941856 cd09418, LIM2_Prickle, The second LIM domain of Pr 9e-08
cd0942458 cd09424, LIM2_FHL1, The second LIM domain of Four 1e-07
cd0945153 cd09451, LIM_RIL, The LIM domain of RIL 1e-07
cd0932856 cd09328, LIM2_abLIM, The second LIM domain on acti 1e-07
cd0935460 cd09354, LIM2_LPP, The second LIM domain of lipoma 2e-07
cd0934554 cd09345, LIM2_FHL, The second LIM domain of Four a 2e-07
cd0943157 cd09431, LIM3_Fhl2, The third LIM domain of Four a 3e-07
cd0940153 cd09401, LIM_TLP_like, The LIM domains of thymus L 4e-07
cd0939653 cd09396, LIM_DA1, The Lim domain of DA1 4e-07
cd0945053 cd09450, LIM_ALP, This family represents the LIM d 5e-07
cd0936453 cd09364, LIM1_LIMK, The first LIM domain of LIMK ( 6e-07
cd0939157 cd09391, LIM1_Lrg1p_like, The first LIM domain of 6e-07
cd0935553 cd09355, LIM2_Ajuba_like, The second LIM domain of 8e-07
cd0936052 cd09360, LIM_ALP_like, The LIM domain of ALP (acti 1e-06
cd0936354 cd09363, LIM3_Enigma_like, The third LIM domain of 2e-06
cd0945955 cd09459, LIM3_ENH, The third LIM domain of the Eni 2e-06
cd0944063 cd09440, LIM1_SF3, The first Lim domain of pollen 2e-06
cd0935154 cd09351, LIM1_LPP, The first LIM domain of lipoma 4e-06
cd0937253 cd09372, LIM2_FBLP-1, The second LIM domain of the 4e-06
cd0942554 cd09425, LIM4_LIMPETin, The fourth LIM domain of p 7e-06
cd0946055 cd09460, LIM3_ZASP_Cypher, The third LIM domain of 9e-06
cd0946274 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 2e-05
cd0935054 cd09350, LIM1_TRIP6, The first LIM domain of Thyro 2e-05
cd0934987 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin 3e-05
cd0946154 cd09461, LIM3_Enigma_like_1, The third LIM domain 4e-05
cd0942657 cd09426, LIM2_FHL2, The second LIM domain of Four 4e-05
cd0932752 cd09327, LIM1_abLIM, The first LIM domain of actin 4e-05
cd0941756 cd09417, LIM2_LIMPETin_like, The second LIM domain 5e-05
cd0942758 cd09427, LIM2_FHL3, The second LIM domain of Four 7e-05
cd0936752 cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of L 8e-05
cd0935653 cd09356, LIM2_TRIP6, The second LIM domain of Thyr 1e-04
cd0942953 cd09429, LIM3_FHL1, The third LIM domain of Four a 2e-04
cd0933351 cd09333, LIM3_PINCH, The third LIM domain of prote 2e-04
cd0947854 cd09478, LIM_CRIP, The LIM domain of Cysteine-Rich 3e-04
cd0935254 cd09352, LIM1_Ajuba_like, The first LIM domain of 3e-04
cd0934058 cd09340, LIM1_Testin_like, The first LIM domain of 4e-04
cd0945855 cd09458, LIM3_Enigma, The third LIM domain of Enig 5e-04
cd0936954 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of L 5e-04
cd0947654 cd09476, LIM1_TLP, The first LIM domain of thymus 5e-04
cd0934864 cd09348, LIM4_FHL1, The fourth LIM domain of Four 6e-04
cd0946656 cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a 7e-04
cd0944852 cd09448, LIM_CLP36, This family represents the LIM 8e-04
cd0941656 cd09416, LIM2_Testin, The second LIM domain of Tes 0.001
cd0942854 cd09428, LIM2_FHL5, The second LIM domain of Four 0.001
cd0984159 cd09841, LIM1_Prickle_3, The first LIM domain of P 0.002
cd0944753 cd09447, LIM_LASP, The LIM domain of LIM and SH3 P 0.002
cd0937656 cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of 0.002
cd0935953 cd09359, LIM_LASP_like, The LIM domain of LIM and 0.002
cd0946353 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 0.002
cd0939356 cd09393, LIM3_Lrg1p_like, The third LIM domain of 0.002
cd0934756 cd09347, LIM4_FHL, The fourth LIM domain of Four a 0.003
cd0939758 cd09397, LIM1_UF1, LIM domain in proteins of unkno 0.003
cd0933056 cd09330, LIM4_abLIM, The fourth LIM domain of acti 0.003
cd0948459 cd09484, LIM1_Prickle_2, The first LIM domain of P 0.003
>gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family Back     alignment and domain information
 Score =  108 bits (273), Expect = 1e-32
 Identities = 40/53 (75%), Positives = 46/53 (86%)

Query: 56  CSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYH 108
           C++C KPIVGQV+TALGKTWHPEHF+C  C  ELGT+NFFERD +PYCE DYH
Sbjct: 1   CAACKKPIVGQVVTALGKTWHPEHFVCAECKTELGTKNFFERDGQPYCEKDYH 53


The first LIM domain of the paxillin like protein family: This family consists of paxillin, leupaxin, Hic-5 (ARA55), and other related proteins. There are four LIM domains in the C-terminal of the proteins and leucine-rich LD-motifs in the N-terminal region. Members of this family are adaptor proteins to recruit key components of signal-transduction machinery to specific sub-cellular locations. Paxillin is found at the interface between the plasma membrane and the actin cytoskeleton. Paxillin serves as a platform for the recruitment of numerous regulatory and structural proteins that together control the dynamic changes in cell adhesion, cytoskeletal reorganization and gene expression that are necessary for cell migration and survival. Leupaxin is a cytoskeleton adaptor protein, which is preferentially expressed in hematopoietic cells. It associates with focal adhesion kinases PYK2 and pp125FAK and identified to be a component of the osteoclast pososomal signaling complex. Hic-5 controls cell proliferation, migration and senescence by functioning as coactivator for steroid receptors such as androgen receptor, glucocorticoid receptor and progesterone receptor. LIM domains are 50-60 amino acids in size and share two characteristic zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein complexes. Length = 53

>gnl|CDD|188790 cd09406, LIM1_Leupaxin, The first LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188789 cd09405, LIM1_Paxillin, The first LIM domain of paxillin Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|188723 cd09337, LIM2_Paxillin_like, The second LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188792 cd09408, LIM2_Leupaxin, The second LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188720 cd09334, LIM4_PINCH, The fourth LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188791 cd09407, LIM2_Paxillin, The second LIM domain of paxillin Back     alignment and domain information
>gnl|CDD|188725 cd09339, LIM4_Paxillin_like, The fourth LIM domain of the Paxillin-like protein family Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188795 cd09411, LIM4_Paxillin, The fourth LIM domain of Paxillin Back     alignment and domain information
>gnl|CDD|188796 cd09412, LIM4_Leupaxin, The fourth LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188747 cd09361, LIM1_Enigma_like, The first LIM domain of Enigma-like family Back     alignment and domain information
>gnl|CDD|188748 cd09362, LIM2_Enigma_like, The second LIM domain of Enigma-like family Back     alignment and domain information
>gnl|CDD|188794 cd09410, LIM3_Leupaxin, The third LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188793 cd09409, LIM3_Paxillin, The third LIM domain of paxillin Back     alignment and domain information
>gnl|CDD|188837 cd09453, LIM1_ENH, The first LIM domain of the Enigma Homolog (ENH) family Back     alignment and domain information
>gnl|CDD|188839 cd09455, LIM1_Enigma_like_1, The first LIM domain of an Enigma subfamily with unknown function Back     alignment and domain information
>gnl|CDD|188836 cd09452, LIM1_Enigma, The first LIM domain of Enigma Back     alignment and domain information
>gnl|CDD|188841 cd09457, LIM2_ENH, The second LIM domain of the Enigma Homolog (ENH) family Back     alignment and domain information
>gnl|CDD|188727 cd09341, LIM2_Testin_like, The second LIM domain of Testin-like family Back     alignment and domain information
>gnl|CDD|188778 cd09392, LIM2_Lrg1p_like, The second LIM domain of Lrg1p, a LIM and RhoGap domain containing protein Back     alignment and domain information
>gnl|CDD|188840 cd09456, LIM2_Enigma, The second LIM domain of Enigma Back     alignment and domain information
>gnl|CDD|188721 cd09335, LIM5_PINCH, The fifth LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188715 cd09329, LIM3_abLIM, The third LIM domain of actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188739 cd09353, LIM2_Zyxin, The second LIM domain of Zyxin Back     alignment and domain information
>gnl|CDD|188717 cd09331, LIM1_PINCH, The first LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188732 cd09346, LIM3_FHL, The third LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188838 cd09454, LIM1_ZASP_Cypher, The first LIM domain of ZASP/Cypher family Back     alignment and domain information
>gnl|CDD|188814 cd09430, LIM5_LIMPETin, The fifth LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188718 cd09332, LIM2_PINCH, The second LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188802 cd09418, LIM2_Prickle, The second LIM domain of Prickle Back     alignment and domain information
>gnl|CDD|188808 cd09424, LIM2_FHL1, The second LIM domain of Four and a half LIM domains protein 1 (FHL1) Back     alignment and domain information
>gnl|CDD|188835 cd09451, LIM_RIL, The LIM domain of RIL Back     alignment and domain information
>gnl|CDD|188714 cd09328, LIM2_abLIM, The second LIM domain on actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188740 cd09354, LIM2_LPP, The second LIM domain of lipoma preferred partner (LPP) Back     alignment and domain information
>gnl|CDD|188731 cd09345, LIM2_FHL, The second LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188815 cd09431, LIM3_Fhl2, The third LIM domain of Four and a half LIM domains protein 2 (FHL2) Back     alignment and domain information
>gnl|CDD|188785 cd09401, LIM_TLP_like, The LIM domains of thymus LIM protein (TLP) Back     alignment and domain information
>gnl|CDD|188782 cd09396, LIM_DA1, The Lim domain of DA1 Back     alignment and domain information
>gnl|CDD|188834 cd09450, LIM_ALP, This family represents the LIM domain of ALP, actinin-associated LIM protein Back     alignment and domain information
>gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase ) Back     alignment and domain information
>gnl|CDD|188777 cd09391, LIM1_Lrg1p_like, The first LIM domain of Lrg1p, a LIM and RhoGap domain containing protein Back     alignment and domain information
>gnl|CDD|188741 cd09355, LIM2_Ajuba_like, The second LIM domain of Ajuba-like proteins Back     alignment and domain information
>gnl|CDD|188746 cd09360, LIM_ALP_like, The LIM domain of ALP (actinin-associated LIM protein) family Back     alignment and domain information
>gnl|CDD|188749 cd09363, LIM3_Enigma_like, The third LIM domain of Enigma-like family Back     alignment and domain information
>gnl|CDD|188843 cd09459, LIM3_ENH, The third LIM domain of the Enigma Homolog (ENH) family Back     alignment and domain information
>gnl|CDD|188824 cd09440, LIM1_SF3, The first Lim domain of pollen specific protein SF3 Back     alignment and domain information
>gnl|CDD|188737 cd09351, LIM1_LPP, The first LIM domain of lipoma preferred partner (LPP) Back     alignment and domain information
>gnl|CDD|188758 cd09372, LIM2_FBLP-1, The second LIM domain of the filamin-binding LIM protein-1 (FBLP-1) Back     alignment and domain information
>gnl|CDD|188809 cd09425, LIM4_LIMPETin, The fourth LIM domain of protein LIMPETin Back     alignment and domain information
>gnl|CDD|188844 cd09460, LIM3_ZASP_Cypher, The third LIM domain of ZASP/Cypher family Back     alignment and domain information
>gnl|CDD|188846 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 (LIM domain Kinase 1) Back     alignment and domain information
>gnl|CDD|188736 cd09350, LIM1_TRIP6, The first LIM domain of Thyroid receptor-interacting protein 6 (TRIP6) Back     alignment and domain information
>gnl|CDD|188735 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin Back     alignment and domain information
>gnl|CDD|188845 cd09461, LIM3_Enigma_like_1, The third LIM domain of an Enigma subfamily with unknown function Back     alignment and domain information
>gnl|CDD|188810 cd09426, LIM2_FHL2, The second LIM domain of Four and a half LIM domains protein 2 (FHL2) Back     alignment and domain information
>gnl|CDD|188713 cd09327, LIM1_abLIM, The first LIM domain of actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188801 cd09417, LIM2_LIMPETin_like, The second LIM domain of protein LIMPETin and related proteins Back     alignment and domain information
>gnl|CDD|188811 cd09427, LIM2_FHL3, The second LIM domain of Four and a half LIM domains protein 3 (FHL3) Back     alignment and domain information
>gnl|CDD|188753 cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of Lhx1 (also known as Lim1) and Lhx5 Back     alignment and domain information
>gnl|CDD|188742 cd09356, LIM2_TRIP6, The second LIM domain of Thyroid receptor-interacting protein 6 (TRIP6) Back     alignment and domain information
>gnl|CDD|188813 cd09429, LIM3_FHL1, The third LIM domain of Four and a half LIM domains protein 1 (FHL1) Back     alignment and domain information
>gnl|CDD|188719 cd09333, LIM3_PINCH, The third LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188862 cd09478, LIM_CRIP, The LIM domain of Cysteine-Rich Intestinal Protein (CRIP) Back     alignment and domain information
>gnl|CDD|188738 cd09352, LIM1_Ajuba_like, The first LIM domain of Ajuba-like proteins Back     alignment and domain information
>gnl|CDD|188726 cd09340, LIM1_Testin_like, The first LIM domain of Testin-like family Back     alignment and domain information
>gnl|CDD|188842 cd09458, LIM3_Enigma, The third LIM domain of Enigma Back     alignment and domain information
>gnl|CDD|188755 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of Lhx2 and Lhx9 family Back     alignment and domain information
>gnl|CDD|188860 cd09476, LIM1_TLP, The first LIM domain of thymus LIM protein (TLP) Back     alignment and domain information
>gnl|CDD|188734 cd09348, LIM4_FHL1, The fourth LIM domain of Four and a half LIM domains protein 1 (FHL1) Back     alignment and domain information
>gnl|CDD|188850 cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a Back     alignment and domain information
>gnl|CDD|188832 cd09448, LIM_CLP36, This family represents the LIM domain of CLP36 Back     alignment and domain information
>gnl|CDD|188800 cd09416, LIM2_Testin, The second LIM domain of Testin Back     alignment and domain information
>gnl|CDD|188812 cd09428, LIM2_FHL5, The second LIM domain of Four and a half LIM domains protein 5 (FHL5) Back     alignment and domain information
>gnl|CDD|188872 cd09841, LIM1_Prickle_3, The first LIM domain of Prickle 3 Back     alignment and domain information
>gnl|CDD|188831 cd09447, LIM_LASP, The LIM domain of LIM and SH3 Protein (LASP) Back     alignment and domain information
>gnl|CDD|188762 cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of Lhx3-Lhx4 family Back     alignment and domain information
>gnl|CDD|188745 cd09359, LIM_LASP_like, The LIM domain of LIM and SH3 Protein (LASP)-like proteins Back     alignment and domain information
>gnl|CDD|188847 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 (LIM domain Kinase 2) Back     alignment and domain information
>gnl|CDD|188779 cd09393, LIM3_Lrg1p_like, The third LIM domain of Lrg1p, a LIM and RhoGap domain containing protein Back     alignment and domain information
>gnl|CDD|188733 cd09347, LIM4_FHL, The fourth LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188783 cd09397, LIM1_UF1, LIM domain in proteins of unknown function Back     alignment and domain information
>gnl|CDD|188716 cd09330, LIM4_abLIM, The fourth LIM domain of actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188868 cd09484, LIM1_Prickle_2, The first LIM domain of Prickle 2 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 130
KOG1701|consensus468 99.76
KOG2272|consensus332 99.71
KOG1701|consensus 468 99.68
KOG1044|consensus 670 99.64
KOG2272|consensus 332 99.57
KOG1703|consensus479 99.55
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 99.55
KOG4577|consensus 383 99.38
KOG1703|consensus479 99.2
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 98.74
KOG4577|consensus 383 98.73
KOG1044|consensus 670 98.5
KOG1700|consensus 200 97.95
KOG1700|consensus200 97.84
KOG1702|consensus 264 97.67
KOG0490|consensus 235 96.2
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 93.17
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 92.84
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 83.41
PF1023590 Cript: Microtubule-associated protein CRIPT; Inter 82.52
>KOG1701|consensus Back     alignment and domain information
Probab=99.76  E-value=9.2e-21  Score=139.75  Aligned_cols=115  Identities=26%  Similarity=0.530  Sum_probs=93.2

Q ss_pred             CCCCcccCCCCCCCCCCCchhHHHHHHHHHH------HHhhhcCCCCCCCccccccccccccceeeecCcccccCCcccC
Q psy2501          10 VTDSSSVSYSKPNQPVHQKGKQLDCMLDSLT------AEMSRQGVTTTQKGCCSSCDKPIVGQVITALGKTWHPEHFICT   83 (130)
Q Consensus        10 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~~~~~~~~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf~C~   83 (130)
                      .....+.||++.+|..||.+..+...+..-.      +.+++..+. ....+|..|++.|+++++.++|+.||+.||+|.
T Consensus       286 g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq~FY~v~~k~~CE~cyq-~tlekC~~Cg~~I~d~iLrA~GkayHp~CF~Cv  364 (468)
T KOG1701|consen  286 GQGLAVEAMDQLFHVQCFTCRTCRRQLAGQSFYQVDGKPYCEGCYQ-DTLEKCNKCGEPIMDRILRALGKAYHPGCFTCV  364 (468)
T ss_pred             CcchHHHHhhhhhcccceehHhhhhhhccccccccCCcccchHHHH-HHHHHHhhhhhHHHHHHHHhcccccCCCceEEE
Confidence            3456788999999999998777776542211      111222332 122589999999999999999999999999999


Q ss_pred             CCCcccCCCCee-ccCCcccCHHhhhhhcCCCCccCccccccC
Q psy2501          84 HCNQELGTRNFF-ERDSRPYCEPDYHNLFSPRCSYCNGPILDV  125 (130)
Q Consensus        84 ~C~~~l~~~~~~-~~~~~~~C~~~~~~~~~~~C~~C~~~I~~~  125 (130)
                      .|.+.|.+..|. ..++.+||..||.++|+++|+.|++||+++
T Consensus       365 ~C~r~ldgipFtvd~~n~v~Cv~dfh~kfAPrCs~C~~PI~P~  407 (468)
T KOG1701|consen  365 VCARCLDGIPFTVDSQNNVYCVPDFHKKFAPRCSVCGNPILPR  407 (468)
T ss_pred             EeccccCCccccccCCCceeeehhhhhhcCcchhhccCCccCC
Confidence            999999988887 778999999999999999999999999753



>KOG2272|consensus Back     alignment and domain information
>KOG1701|consensus Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>KOG2272|consensus Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF10235 Cript: Microtubule-associated protein CRIPT; InterPro: IPR019367 The CRIPT protein is a cytoskeletal protein involved in microtubule production Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
1nyp_A66 4th Lim Domain Of Pinch Protein Length = 66 1e-10
1x3h_A80 Solution Structure Of The Lim Domain Of Human Leupa 4e-10
2dar_A90 Solution Structure Of First Lim Domain Of Enigma-Li 7e-09
2dj7_A80 Solution Structure Of 3rd Lim Domain Of Actin-Bindi 8e-06
1x64_A89 Solution Structure Of The Lim Domain Of Alpha-Actin 1e-05
2d8z_A70 Solution Structure Of The Third Lim Domain Of Four 2e-05
2dlo_A81 Solution Structure Of The Second Lim Domain Of Huma 2e-05
2d8x_A70 Solution Structure Of The Second Lim Domain Of Part 2e-05
2kbx_B70 Solution Structure Of Ilk-Pinch Complex Length = 70 3e-05
1g47_A77 1st Lim Domain Of Pinch Protein Length = 77 4e-05
1v6g_A81 Solution Structure Of The Lim Domain Of The Human A 5e-05
2cuq_A80 Solution Structure Of Second Lim Domain From Human 6e-05
1iml_A76 Cysteine Rich Intestinal Protein, Nmr, 48 Structure 9e-05
1wyh_A72 Solution Structure Of The Lim Domain From Human Ske 9e-05
2jtn_A182 Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Compl 1e-04
2rgt_A169 Crystal Structure Of Lhx3 Lim Domains 1 And 2 With 2e-04
1x4k_A72 Solution Structure Of Lim Domain In Lim-Protein 3 L 2e-04
3f6q_B72 Crystal Structure Of Integrin-Linked Kinase Ankyrin 3e-04
2cur_A69 Solution Structure Of Skeletal Muscle Lim-Protein 1 4e-04
1ctl_A85 Structure Of The Carboxy-Terminal Lim Domain From T 4e-04
3mmk_A169 The Structural Basis For Partial Redundancy In A Cl 5e-04
1x63_A82 Solution Structure Of The Second Lim Domain Of Skel 5e-04
1b8t_A192 Solution Structure Of The Chicken Crp1 Length = 192 6e-04
1cxx_A113 Mutant R122a Of Quail Cysteine And Glycine-Rich Pro 6e-04
2cu8_A76 Solution Structure Of The Lim Domain Of Human Cyste 7e-04
>pdb|1NYP|A Chain A, 4th Lim Domain Of Pinch Protein Length = 66 Back     alignment and structure

Iteration: 1

Score = 61.6 bits (148), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 24/57 (42%), Positives = 33/57 (57%) Query: 56 CSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFS 112 C +C +PI G+V+ A+GK WH EHF+C C + +ER YCE Y+ LF Sbjct: 8 CGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLAYCETHYNQLFG 64
>pdb|1X3H|A Chain A, Solution Structure Of The Lim Domain Of Human Leupaxin Length = 80 Back     alignment and structure
>pdb|2DAR|A Chain A, Solution Structure Of First Lim Domain Of Enigma-Like Pdz And Lim Domains Protein Length = 90 Back     alignment and structure
>pdb|2DJ7|A Chain A, Solution Structure Of 3rd Lim Domain Of Actin-Binding Lim Protein 3 Length = 80 Back     alignment and structure
>pdb|1X64|A Chain A, Solution Structure Of The Lim Domain Of Alpha-Actinin-2 Associated Lim Protein Length = 89 Back     alignment and structure
>pdb|2D8Z|A Chain A, Solution Structure Of The Third Lim Domain Of Four And A Half Lim Domains Protein 2 (Fhl-2) Length = 70 Back     alignment and structure
>pdb|2DLO|A Chain A, Solution Structure Of The Second Lim Domain Of Human Thyroid Receptor-Interacting Protein 6 Length = 81 Back     alignment and structure
>pdb|2D8X|A Chain A, Solution Structure Of The Second Lim Domain Of Particularly Interesting New Cys-His Protein (Pinch) Length = 70 Back     alignment and structure
>pdb|2KBX|B Chain B, Solution Structure Of Ilk-Pinch Complex Length = 70 Back     alignment and structure
>pdb|1G47|A Chain A, 1st Lim Domain Of Pinch Protein Length = 77 Back     alignment and structure
>pdb|1V6G|A Chain A, Solution Structure Of The Lim Domain Of The Human Actin Binding Lim Protein 2 Length = 81 Back     alignment and structure
>pdb|2CUQ|A Chain A, Solution Structure Of Second Lim Domain From Human Skeletal Muscle Lim-Protein 2 Length = 80 Back     alignment and structure
>pdb|1IML|A Chain A, Cysteine Rich Intestinal Protein, Nmr, 48 Structures Length = 76 Back     alignment and structure
>pdb|1WYH|A Chain A, Solution Structure Of The Lim Domain From Human Skeletal Muscle Lim-Protein 2 Length = 72 Back     alignment and structure
>pdb|2JTN|A Chain A, Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Complex Length = 182 Back     alignment and structure
>pdb|2RGT|A Chain A, Crystal Structure Of Lhx3 Lim Domains 1 And 2 With The Binding Domain Of Isl1 Length = 169 Back     alignment and structure
>pdb|1X4K|A Chain A, Solution Structure Of Lim Domain In Lim-Protein 3 Length = 72 Back     alignment and structure
>pdb|3F6Q|B Chain B, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 72 Back     alignment and structure
>pdb|2CUR|A Chain A, Solution Structure Of Skeletal Muscle Lim-Protein 1 Length = 69 Back     alignment and structure
>pdb|1CTL|A Chain A, Structure Of The Carboxy-Terminal Lim Domain From The Cysteine Rich Protein Crp Length = 85 Back     alignment and structure
>pdb|3MMK|A Chain A, The Structural Basis For Partial Redundancy In A Class Of Transcription Factors, The Lim-Homeodomain Proteins, In Neural Cell Type Specification Length = 169 Back     alignment and structure
>pdb|1X63|A Chain A, Solution Structure Of The Second Lim Domain Of Skeletal Muscle Lim Protein 1 Length = 82 Back     alignment and structure
>pdb|1B8T|A Chain A, Solution Structure Of The Chicken Crp1 Length = 192 Back     alignment and structure
>pdb|1CXX|A Chain A, Mutant R122a Of Quail Cysteine And Glycine-Rich Protein, Nmr, Minimized Structure Length = 113 Back     alignment and structure
>pdb|2CU8|A Chain A, Solution Structure Of The Lim Domain Of Human Cysteine-Rich Protein 2 Length = 76 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query130
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 8e-30
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 2e-04
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 1e-28
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 5e-28
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 1e-27
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 2e-27
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 3e-27
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 2e-06
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 4e-27
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 2e-15
2cuq_A80 Four and A half LIM domains 3; structural genomics 5e-27
2cuq_A80 Four and A half LIM domains 3; structural genomics 1e-06
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 1e-26
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 1e-26
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 3e-26
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 4e-26
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 1e-25
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 3e-25
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 8e-25
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 4e-04
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 4e-24
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 1e-07
3f6q_B72 LIM and senescent cell antigen-like-containing dom 6e-24
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 1e-23
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 3e-23
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 9e-23
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 5e-13
2jtn_A 182 LIM domain-binding protein 1, LIM/homeobox protein 7e-06
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 2e-22
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 8e-19
2cor_A79 Pinch protein; LIM domain, particularly interestin 2e-22
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 1e-21
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 5e-16
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 4e-21
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 5e-21
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 3e-20
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 5e-20
1b8t_A 192 Protein (CRP1); LIM domain, muscle differentiation 4e-19
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 8e-04
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 9e-20
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 1e-19
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 7e-05
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 1e-19
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 1e-04
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 2e-19
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 8e-19
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 5e-18
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 4e-17
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 6e-06
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 6e-17
1rut_X 188 Flinc4, fusion protein of LMO4 protein and LIM dom 7e-17
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 1e-16
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 2e-16
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 4e-16
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 6e-16
2co8_A82 NEDD9 interacting protein with calponin homology a 1e-10
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 3e-09
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 4e-06
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
 Score =  102 bits (255), Expect = 8e-30
 Identities = 24/66 (36%), Positives = 32/66 (48%)

Query: 51  TQKGCCSSCDKPIVGQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNL 110
            +   C+ C++ I G  + ALGK+WHPE F C HC   +    F E     YCE  Y   
Sbjct: 23  KRTPMCAHCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYIGFVEEKGALYCELCYEKF 82

Query: 111 FSPRCS 116
           F+   S
Sbjct: 83  FASGPS 88


>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Length = 65 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 99.85
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.83
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 99.82
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 99.8
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.78
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 99.77
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 99.77
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 99.77
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 99.76
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.76
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 99.76
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.75
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.75
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.75
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 99.75
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 99.74
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.74
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 99.74
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.73
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.73
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 99.73
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.73
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 99.73
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.72
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 99.72
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 99.72
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.72
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.71
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 99.71
1b8t_A 192 Protein (CRP1); LIM domain, muscle differentiation 99.71
2cor_A79 Pinch protein; LIM domain, particularly interestin 99.7
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 99.7
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 99.69
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 99.67
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 99.66
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.65
3f6q_B72 LIM and senescent cell antigen-like-containing dom 99.63
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 99.62
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 99.62
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 99.61
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 99.59
2co8_A82 NEDD9 interacting protein with calponin homology a 99.58
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.58
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.56
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.54
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 99.5
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.41
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.41
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 98.97
2cuq_A80 Four and A half LIM domains 3; structural genomics 98.37
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 98.36
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 98.36
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 98.33
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 98.31
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 98.31
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 98.18
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 98.15
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 98.11
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 98.07
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 97.26
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 94.85
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 94.82
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 94.55
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 94.45
2cor_A79 Pinch protein; LIM domain, particularly interestin 93.16
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 92.87
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 92.56
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 91.78
2co8_A82 NEDD9 interacting protein with calponin homology a 91.07
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 90.28
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 90.16
3f6q_B72 LIM and senescent cell antigen-like-containing dom 90.03
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 89.71
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 89.54
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 89.5
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 89.44
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 89.28
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 89.16
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 89.13
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 88.94
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 88.87
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 87.98
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 87.55
2ysl_A73 Tripartite motif-containing protein 31; ring-type 80.04
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
Probab=99.85  E-value=1.6e-21  Score=120.37  Aligned_cols=80  Identities=25%  Similarity=0.571  Sum_probs=73.5

Q ss_pred             CCCccccccccccc--cceeeecCcccccCCcccCCCCcccCCCCeeccCCcccCHHhhhhhcCCCCccCccccc--cCc
Q psy2501          51 TQKGCCSSCDKPIV--GQVITALGKTWHPEHFICTHCNQELGTRNFFERDSRPYCEPDYHNLFSPRCSYCNGPIL--DVS  126 (130)
Q Consensus        51 ~~~~~C~~C~~~i~--~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~C~~~~~~~~~~~C~~C~~~I~--~~~  126 (130)
                      .+.++|..|+++|.  ++.+.++++.||++||+|..|+++|.+..|+..++++||+.||.++|+++|..|+++|+  +.+
T Consensus         3 ~~~~~C~~C~~~I~~~~~~~~a~~~~~H~~CF~C~~C~~~L~~~~~~~~~g~~yC~~cy~~~~~~~C~~C~~~I~~~~~~   82 (101)
T 2cup_A            3 SGSSGCVECRKPIGADSKEVHYKNRFWHDTCFRCAKCLHPLANETFVAKDNKILCNKCTTREDSPKCKGCFKAIVAGDQN   82 (101)
T ss_dssp             SCCCBCSSSCCBCCSSSCEEEETTEEEETTTCCCSSSCCCTTSSCCEEETTEEECHHHHTTCCCCBCSSSCCBCCSSSCE
T ss_pred             CCCCcCcccCCcccCCceEEEECccChhhcCCcccccCCCCCcCeeECcCCEEEChhHhhhhcCCccccCCCccccCCeE
Confidence            45679999999996  67899999999999999999999998888999999999999999999999999999998  568


Q ss_pred             eeeC
Q psy2501         127 IRNT  130 (130)
Q Consensus       127 ~~~~  130 (130)
                      |+|+
T Consensus        83 ~~a~   86 (101)
T 2cup_A           83 VEYK   86 (101)
T ss_dssp             EESS
T ss_pred             EEeC
Confidence            8874



>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 130
d1g47a235 g.39.1.3 (A:36-70) Pinch (particularly interesting 3e-12
d2dara245 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, En 3e-11
d1u5sb131 g.39.1.3 (B:72-102) Pinch (particularly interestin 2e-10
d1x3ha135 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [ 5e-10
d1x3ha135 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [ 5e-04
d1b8ta449 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) pr 7e-06
d1x3ha232 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) 4e-05
d2d8ya242 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapie 1e-04
d2d8za232 g.39.1.3 (A:33-64) Four and a half LIM domains pro 2e-04
d2cuqa132 g.39.1.3 (A:43-74) Four and a half LIM domains 3, 5e-04
d1x4ka132 g.39.1.3 (A:35-66) Four and a half LIM domains pro 0.001
d2d8xa226 g.39.1.3 (A:8-32) Pinch (particularly interesting 0.001
d1v6ga141 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abL 0.001
d1u5sb235 g.39.1.3 (B:103-137) Pinch (particularly interesti 0.003
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure

class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: LIM domain
domain: Pinch (particularly interesting new Cys-His) protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 54.7 bits (132), Expect = 3e-12
 Identities = 14/34 (41%), Positives = 20/34 (58%)

Query: 80  FICTHCNQELGTRNFFERDSRPYCEPDYHNLFSP 113
           F+C  C Q+     F+E + R YCE D+  LF+P
Sbjct: 1   FVCAQCFQQFPEGLFYEFEGRKYCEHDFQMLFAP 34


>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Length = 45 Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 31 Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 49 Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Length = 32 Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Length = 42 Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Length = 32 Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Length = 32 Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Length = 32 Back     information, alignment and structure
>d2d8xa2 g.39.1.3 (A:8-32) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 26 Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query130
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 99.04
d1g47a235 Pinch (particularly interesting new Cys-His) prote 98.97
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.79
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.71
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.63
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 98.62
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 98.59
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 98.5
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 98.48
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.38
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 98.36
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 98.35
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.35
d2dj7a236 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 98.33
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.33
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 98.32
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 98.3
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 98.3
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.27
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 98.26
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 98.24
d1zfoa_30 LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} 98.23
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 98.17
d2cu8a130 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 98.15
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.12
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 98.1
d1x4la129 Four and a half LIM domains protein 2, FHL2 {Human 98.1
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 98.09
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 98.06
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 98.02
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 98.0
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 97.98
d1x61a232 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.98
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.95
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 97.93
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 97.92
d1x68a129 Four and a half LIM domains protein 5, FHL-5 {Huma 97.9
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 97.89
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.88
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 97.8
d1x62a235 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 97.8
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.79
d2co8a236 Nedd9 interacting protein with calponin homology, 97.79
d1x4ka227 Four and a half LIM domains protein 2, FHL2 {Human 97.75
d1x64a145 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 97.68
d1x6aa134 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 97.67
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 97.64
d1wyha227 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.61
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 97.6
d1x6aa134 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 97.59
d1b8ta135 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.57
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.54
d1a7ia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.42
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.38
d1ibia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.23
d1rutx234 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 97.18
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 97.11
d1wiga132 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 97.09
d1x63a232 Four and a half LIM domains protein 1, FHL-1 {Huma 97.05
d2cupa327 Four and a half LIM domains protein 1, FHL-1 {Huma 96.9
d1x64a231 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 96.77
d1x6aa234 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 96.56
d1x61a127 Thyroid receptor interacting protein 6, TRIP6 {Hum 96.53
d2cora235 Pinch (particularly interesting new Cys-His) prote 96.48
d1x62a131 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 96.15
d1rutx433 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 95.68
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 95.63
d1wiga132 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 95.42
d2cupa231 Four and a half LIM domains protein 1, FHL-1 {Huma 94.7
d2cora131 Pinch (particularly interesting new Cys-His) prote 94.29
d1g47a135 Pinch (particularly interesting new Cys-His) prote 94.12
d1j2oa233 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 94.02
d2d8xa132 Pinch (particularly interesting new Cys-His) prote 93.64
d1x68a234 Four and a half LIM domains protein 5, FHL-5 {Huma 91.79
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 90.92
d1x4la230 Four and a half LIM domains protein 2, FHL2 {Human 90.72
d1wiga241 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 90.25
d2co8a133 Nedd9 interacting protein with calponin homology, 87.4
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Glucocorticoid receptor-like (DNA-binding domain)
superfamily: Glucocorticoid receptor-like (DNA-binding domain)
family: LIM domain
domain: Leupaxin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.04  E-value=7.3e-11  Score=57.12  Aligned_cols=34  Identities=26%  Similarity=0.772  Sum_probs=30.8

Q ss_pred             CCCCCCCccccccccccccceeeecCcccccCCc
Q psy2501          47 GVTTTQKGCCSSCDKPIVGQVITALGKTWHPEHF   80 (130)
Q Consensus        47 ~~~~~~~~~C~~C~~~i~~~~~~~~~~~~H~~Cf   80 (130)
                      ++.....++|..|+++|.++.|+++++.||++||
T Consensus         2 DY~~~fapkC~~C~~~I~g~~v~Al~~~wHpeCF   35 (35)
T d1x3ha1           2 DFLAMFSPKCGGCNRPVLENYLSAMDTVWHPECF   35 (35)
T ss_dssp             CCCCCCSCBCTTTCCBCCSSCEEETTEEECTTTC
T ss_pred             cHHHHhChhhhhcCCcccchheeecCCccCcccC
Confidence            3455678999999999999999999999999998



>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2d8xa2 g.39.1.3 (A:8-32) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j2oa2 g.39.1.3 (A:31-63) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4la2 g.39.1.3 (A:37-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a1 g.39.1.3 (A:44-76) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure