Psyllid ID: psy2654
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 1949 | 2.2.26 [Sep-21-2011] | |||||||
| P39057 | 4466 | Dynein beta chain, ciliar | N/A | N/A | 0.329 | 0.143 | 0.661 | 0.0 | |
| P23098 | 4466 | Dynein beta chain, ciliar | N/A | N/A | 0.328 | 0.143 | 0.661 | 0.0 | |
| Q69Z23 | 4481 | Dynein heavy chain 17, ax | no | N/A | 0.324 | 0.141 | 0.639 | 0.0 | |
| Q9NYC9 | 4486 | Dynein heavy chain 9, axo | no | N/A | 0.329 | 0.143 | 0.632 | 0.0 | |
| Q9UFH2 | 4485 | Dynein heavy chain 17, ax | yes | N/A | 0.324 | 0.140 | 0.636 | 0.0 | |
| Q96DT5 | 4523 | Dynein heavy chain 11, ax | no | N/A | 0.330 | 0.142 | 0.606 | 0.0 | |
| Q39565 | 4568 | Dynein beta chain, flagel | N/A | N/A | 0.323 | 0.138 | 0.459 | 1e-180 | |
| Q39610 | 4499 | Dynein alpha chain, flage | N/A | N/A | 0.319 | 0.138 | 0.431 | 1e-162 | |
| Q9SMH3 | 4625 | Dynein-1-alpha heavy chai | N/A | N/A | 0.335 | 0.141 | 0.400 | 1e-156 | |
| Q9C0G6 | 4158 | Dynein heavy chain 6, axo | no | N/A | 0.332 | 0.155 | 0.397 | 1e-151 |
| >sp|P39057|DYHC_HELCR Dynein beta chain, ciliary OS=Heliocidaris crassispina PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 956 bits (2471), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 475/718 (66%), Positives = 539/718 (75%), Gaps = 76/718 (10%)
Query: 1235 AGSLKNWLNNVTDSMRRTGIHCMSLAVAAYDEKPREQWLFDYPGQTALCGTQIWWTTEVS 1294
G ++ WLN V D+MR T + AV +Y+EKPREQWL+DYP Q AL TQ+WWTTEV+
Sbjct: 1655 TGQVEVWLNRVMDTMRSTVRSQFADAVVSYEEKPREQWLYDYPAQVALATTQVWWTTEVN 1714
Query: 1295 ICFARLEEGYENALKDYNKKQ---------FIIGFAGTGKSCVWKTLYKTYVNAKKKPMY 1345
I FARLEEG+EN++KDYNKKQ +IG G T+ V+A+
Sbjct: 1715 ISFARLEEGHENSMKDYNKKQILQLNTLIGLLIGKLTKGDRQKIMTICTIDVHARDVVAM 1774
Query: 1346 NDLEPKAVTNDELFGIINPSTREWKDGRYSDSGFLSYGSLLGDCFANICDAEFKFDHEYL 1405
L K V + + F ++ W D C+ANICDA+FK+ +EYL
Sbjct: 1775 MVL--KKVDSAQAFQWLSQLRHRWADDD-------------KHCYANICDAQFKYSYEYL 1819
Query: 1406 GCTPRLVITPLTDRCYITLSQSLHLNMGGAPAGPAGTGKTETTKDLGKAIGIMVYVFNCS 1465
G TPRLVITPLTDRCYITL+QSLHL M GAPAGPAGTGKTETTKDLG+A+GIMVYVFNCS
Sbjct: 1820 GNTPRLVITPLTDRCYITLTQSLHLVMSGAPAGPAGTGKTETTKDLGRALGIMVYVFNCS 1879
Query: 1466 EQMDYRSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSVLDSVKMRKSRFNFMG 1525
EQMDY+SCGNIYK
Sbjct: 1880 EQMDYKSCGNIYK----------------------------------------------- 1892
Query: 1526 ESSLAGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSVLDSVKMRKSRFNFMGENIKLVTT 1585
GLAQTGAWGCFDEFNRISVEVLSVVAVQVK V D+++ +K RFNFMGE I L+ +
Sbjct: 1893 -----GLAQTGAWGCFDEFNRISVEVLSVVAVQVKCVQDAIRDKKERFNFMGEEISLIPS 1947
Query: 1586 VGMFITMNPGYAGRAELPENLKALFRPCAMVVPDFALICEIMLVSEGFQEARLLSRKFIT 1645
VG+FITMNPGYAGR ELPENLKALFRPCAMVVPDF LICEIMLV+EGF EARLL+RKFIT
Sbjct: 1948 VGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFLEARLLARKFIT 2007
Query: 1646 LYSLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDRQRPEDQVLMRALRDFNIPKIITE 1705
LY+LCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGD QRPEDQVLMRALRDFN+PKI+++
Sbjct: 2008 LYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPQRPEDQVLMRALRDFNVPKIVSD 2067
Query: 1706 DLQVFMGLIGDLFPALDVPRKRDIDFEKQVRQATIDMKLQPEDSFILKVVQLVELFAVRH 1765
D VFMGLIGDLFPALDVPR+RD+DFEK V+Q+T+D+KLQ EDSF+LKVVQL EL AVRH
Sbjct: 2068 DTPVFMGLIGDLFPALDVPRRRDLDFEKVVKQSTLDLKLQAEDSFVLKVVQLEELLAVRH 2127
Query: 1766 SVFIIGFAGTGKSCVWKTLYKTYVNAKKKPMYNDLEPKAVTNDELFGIINPSTREWKDGL 1825
SVF+IG AGTGKS V K L KTY N K+KP++ DL PKAVTNDELFGIINP+TREWKDGL
Sbjct: 2128 SVFVIGNAGTGKSQVLKVLNKTYSNMKRKPVFIDLNPKAVTNDELFGIINPATREWKDGL 2187
Query: 1826 FSCLIREQAQSTGDGPKWMVMDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPSMRLL 1885
FS ++R+ + T DGPKW+V+DGDIDPMWIESLNTVMDDNKVLTLASNERI LTPSMRLL
Sbjct: 2188 FSVIMRDMSNITHDGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIPLTPSMRLL 2247
Query: 1886 FEISNLRTATPATVSRAGILYINPQDLGWNPYVLSWTDTRESESEKNILMGLFDKLTP 1943
FEIS+L+TATPATVSRAGILYINP DLGWNP V SW DTRE +SE+ L LFDK P
Sbjct: 2248 FEISHLKTATPATVSRAGILYINPSDLGWNPIVTSWIDTREVQSERANLTILFDKYLP 2305
|
Force generating protein of eukaryotic cilia and flagella. Produces force towards the minus ends of microtubules. Dynein has ATPase activity; the force-producing power stroke is thought to occur on release of ADP. Anthocidaris crassispina (taxid: 7629) |
| >sp|P23098|DYHC_TRIGR Dynein beta chain, ciliary OS=Tripneustes gratilla PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q69Z23|DYH17_MOUSE Dynein heavy chain 17, axonemal OS=Mus musculus GN=Dnah17 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|Q9NYC9|DYH9_HUMAN Dynein heavy chain 9, axonemal OS=Homo sapiens GN=DNAH9 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q9UFH2|DYH17_HUMAN Dynein heavy chain 17, axonemal OS=Homo sapiens GN=DNAH17 PE=1 SV=2 | Back alignment and function description |
|---|
| >sp|Q96DT5|DYH11_HUMAN Dynein heavy chain 11, axonemal OS=Homo sapiens GN=DNAH11 PE=1 SV=3 | Back alignment and function description |
|---|
| >sp|Q39565|DYHB_CHLRE Dynein beta chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA4 PE=3 SV=1 | Back alignment and function description |
|---|
| >sp|Q39610|DYHA_CHLRE Dynein alpha chain, flagellar outer arm OS=Chlamydomonas reinhardtii GN=ODA11 PE=3 SV=2 | Back alignment and function description |
|---|
| >sp|Q9SMH3|DYH1A_CHLRE Dynein-1-alpha heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii GN=DHC1 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|Q9C0G6|DYH6_HUMAN Dynein heavy chain 6, axonemal OS=Homo sapiens GN=DNAH6 PE=1 SV=3 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1949 | ||||||
| 170031290 | 4543 | dynein heavy chain [Culex quinquefasciat | 0.334 | 0.143 | 0.671 | 0.0 | |
| 157134856 | 4545 | dynein heavy chain [Aedes aegypti] gi|10 | 0.333 | 0.143 | 0.673 | 0.0 | |
| 270009401 | 4573 | hypothetical protein TcasGA2_TC008640 [T | 0.329 | 0.140 | 0.661 | 0.0 | |
| 347966349 | 4552 | AGAP001672-PA [Anopheles gambiae str. PE | 0.329 | 0.141 | 0.675 | 0.0 | |
| 242012685 | 4549 | ciliary dynein heavy chain, putative [Pe | 0.336 | 0.144 | 0.680 | 0.0 | |
| 312384035 | 3990 | hypothetical protein AND_02671 [Anophele | 0.329 | 0.161 | 0.669 | 0.0 | |
| 405953044 | 4464 | Dynein beta chain, ciliary [Crassostrea | 0.329 | 0.144 | 0.664 | 0.0 | |
| 345493092 | 4479 | PREDICTED: dynein beta chain, ciliary-li | 0.324 | 0.141 | 0.667 | 0.0 | |
| 194744931 | 4496 | GF18527 [Drosophila ananassae] gi|190627 | 0.334 | 0.145 | 0.667 | 0.0 | |
| 195355614 | 4493 | GM15114 [Drosophila sechellia] gi|194129 | 0.334 | 0.145 | 0.666 | 0.0 |
| >gi|170031290|ref|XP_001843519.1| dynein heavy chain [Culex quinquefasciatus] gi|167869546|gb|EDS32929.1| dynein heavy chain [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
Score = 991 bits (2562), Expect = 0.0, Method: Compositional matrix adjust.
Identities = 486/724 (67%), Positives = 556/724 (76%), Gaps = 72/724 (9%)
Query: 1227 AIKSVLVVAGSLKNWLNNVTDSMRRTGIHCMSLAVAAYDEKPREQWLFDYPGQTALCGTQ 1286
A KS +G ++ WLN VTDSMR T +V+AY+EKPR+QW+FD+P Q ALC TQ
Sbjct: 1723 AFKSDCDCSGKVEIWLNRVTDSMRVTLHDLFERSVSAYEEKPRDQWIFDWPAQPALCATQ 1782
Query: 1287 IWWTTEVSICFARLEEGYENALKDYNKKQ------FIIGFAG-TGKSCVWKTLYKTYVNA 1339
IWWTTEV++ FARLEEGYENALKDY KKQ I+ G + K + ++
Sbjct: 1783 IWWTTEVNVAFARLEEGYENALKDYQKKQIIQLNALIVLLCGDMSQGDRQKIMTICTIDV 1842
Query: 1340 KKKPMYNDLEPKAVTNDELFGIINPSTREWKDGRYSDSGFLSYGSLLGDCFANICDAEFK 1399
+ + + + V + F + W + + DCFANICDA+F+
Sbjct: 1843 HSRDVVAKMIQQKVETGQAFQWQSQLRHRWDEQ-------------VRDCFANICDAQFR 1889
Query: 1400 FDHEYLGCTPRLVITPLTDRCYITLSQSLHLNMGGAPAGPAGTGKTETTKDLGKAIGIMV 1459
+D+EYLG TPRLVITPLTDRCYITL+QSLHL MGGAPAGPAGTGKTETTKDLG+A+GIMV
Sbjct: 1890 YDYEYLGNTPRLVITPLTDRCYITLTQSLHLIMGGAPAGPAGTGKTETTKDLGRALGIMV 1949
Query: 1460 YVFNCSEQMDYRSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSVLDSVKMRKS 1519
YVFNCSEQMDY+SCGNIYK
Sbjct: 1950 YVFNCSEQMDYKSCGNIYK----------------------------------------- 1968
Query: 1520 RFNFMGESSLAGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSVLDSVKMRKSRFNFMGEN 1579
GL+QTGAWGCFDEFNRISVEVLSVVAVQVKS+ D++K K +FNFMGE
Sbjct: 1969 -----------GLSQTGAWGCFDEFNRISVEVLSVVAVQVKSIQDAIKGNKEKFNFMGET 2017
Query: 1580 IKLVTTVGMFITMNPGYAGRAELPENLKALFRPCAMVVPDFALICEIMLVSEGFQEARLL 1639
I L+ TVG+FITMNPGYAGR ELPENLKALFRPCAMVVPDF LICEIMLV+EGFQEARLL
Sbjct: 2018 ISLIPTVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFQEARLL 2077
Query: 1640 SRKFITLYSLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDRQRPEDQVLMRALRDFNI 1699
+RKFITLY+LCKELLSKQDHYDWGLRAIKSVLVVAGSLKR DR+RPEDQVLMRALRDFNI
Sbjct: 2078 ARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRSDRERPEDQVLMRALRDFNI 2137
Query: 1700 PKIITEDLQVFMGLIGDLFPALDVPRKRDIDFEKQVRQATIDMKLQPEDSFILKVVQLVE 1759
PKI+T+D+ VFMGLIGDLFPALDVPRKR DFE+ +R++ I++KLQPED+FILKVVQL E
Sbjct: 2138 PKIVTDDVPVFMGLIGDLFPALDVPRKRSPDFERLIRKSAIELKLQPEDNFILKVVQLEE 2197
Query: 1760 LFAVRHSVFIIGFAGTGKSCVWKTLYKTYVNAKKKPMYNDLEPKAVTNDELFGIINPSTR 1819
LFAVRHSVFI+GFAGTGKS VWKTL+KTY N K+KP +NDL+PKAVTNDELFGIINP+TR
Sbjct: 2198 LFAVRHSVFIVGFAGTGKSQVWKTLFKTYQNQKRKPHFNDLDPKAVTNDELFGIINPATR 2257
Query: 1820 EWKDGLFSCLIREQAQSTGDGPKWMVMDGDIDPMWIESLNTVMDDNKVLTLASNERIALT 1879
EWKDGLFS ++R+QA G GPKW+V+DGDIDPMWIESLNTVMDDNKVLTLASNERIALT
Sbjct: 2258 EWKDGLFSVIMRDQANMGGTGPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALT 2317
Query: 1880 PSMRLLFEISNLRTATPATVSRAGILYINPQDLGWNPYVLSWTDTRESESEKNILMGLFD 1939
MRLLFEISNLRTATPATVSRAGILYINPQDLGWNP+V SW D+RE+++EK+IL LFD
Sbjct: 2318 KEMRLLFEISNLRTATPATVSRAGILYINPQDLGWNPFVASWIDSRETQAEKSILSVLFD 2377
Query: 1940 KLTP 1943
K P
Sbjct: 2378 KYIP 2381
|
Source: Culex quinquefasciatus Species: Culex quinquefasciatus Genus: Culex Family: Culicidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|157134856|ref|XP_001656476.1| dynein heavy chain [Aedes aegypti] gi|108881336|gb|EAT45561.1| AAEL003155-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|270009401|gb|EFA05849.1| hypothetical protein TcasGA2_TC008640 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|347966349|ref|XP_321424.5| AGAP001672-PA [Anopheles gambiae str. PEST] gi|333470100|gb|EAA01375.5| AGAP001672-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|242012685|ref|XP_002427058.1| ciliary dynein heavy chain, putative [Pediculus humanus corporis] gi|212511316|gb|EEB14320.1| ciliary dynein heavy chain, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|312384035|gb|EFR28864.1| hypothetical protein AND_02671 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|405953044|gb|EKC20777.1| Dynein beta chain, ciliary [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|345493092|ref|XP_001600478.2| PREDICTED: dynein beta chain, ciliary-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|194744931|ref|XP_001954946.1| GF18527 [Drosophila ananassae] gi|190627983|gb|EDV43507.1| GF18527 [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|195355614|ref|XP_002044286.1| GM15114 [Drosophila sechellia] gi|194129587|gb|EDW51630.1| GM15114 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 1949 | ||||||
| FB|FBgn0013812 | 4486 | Dhc93AB "Dynein heavy chain at | 0.211 | 0.092 | 0.782 | 0.0 | |
| FB|FBgn0001315 | 4559 | kl-5 "male fertility factor kl | 0.211 | 0.090 | 0.767 | 0.0 | |
| UNIPROTKB|F1PDR4 | 4485 | DNAH9 "Uncharacterized protein | 0.211 | 0.092 | 0.748 | 0.0 | |
| UNIPROTKB|F1LRU2 | 4480 | Dnah17 "Protein Dnah17" [Rattu | 0.211 | 0.092 | 0.748 | 0.0 | |
| UNIPROTKB|F1PN88 | 4427 | DNAH17 "Uncharacterized protei | 0.211 | 0.093 | 0.748 | 0.0 | |
| UNIPROTKB|Q9UFH2 | 4485 | DNAH17 "Dynein heavy chain 17, | 0.211 | 0.092 | 0.748 | 0.0 | |
| MGI|MGI:1917176 | 4481 | Dnahc17 "dynein, axonemal, hea | 0.211 | 0.092 | 0.745 | 0.0 | |
| UNIPROTKB|E1BLB4 | 4392 | LOC788092 "Uncharacterized pro | 0.211 | 0.094 | 0.743 | 0.0 | |
| UNIPROTKB|F1NJ57 | 4370 | DNAH9 "Uncharacterized protein | 0.211 | 0.094 | 0.740 | 0.0 | |
| UNIPROTKB|F1NI32 | 4384 | DNAH9 "Uncharacterized protein | 0.211 | 0.094 | 0.740 | 0.0 |
| FB|FBgn0013812 Dhc93AB "Dynein heavy chain at 93AB" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 1689 (599.6 bits), Expect = 0., Sum P(6) = 0.
Identities = 323/413 (78%), Positives = 356/413 (86%)
Query: 1531 GLAQTGAWGCFDEFNRIXXXXXXXXXXXXXXXXXXXKMRKSRFNFMGENIKLVTTVGMFI 1590
GLAQTGAWGCFDEFNRI + +K +FNFMGE I V TVG+FI
Sbjct: 1910 GLAQTGAWGCFDEFNRITVEVLSVVAVQVKSVQDAIRDKKDKFNFMGEMISCVPTVGIFI 1969
Query: 1591 TMNPGYAGRAELPENLKALFRPCAMVVPDFALICEIMLVSEGFQEARLLSRKFITLYSLC 1650
TMNPGYAGR ELPENLKALFRPCAMVVPDF LICEIMLV+EGFQ+AR+L+RKFITLY+LC
Sbjct: 1970 TMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAEGFQDARVLARKFITLYTLC 2029
Query: 1651 KELLSKQDHYDWGLRAIKSVLVVAGSLKRGDRQRPEDQVLMRALRDFNIPKIITEDLQVF 1710
KELLSKQDHYDWGLRAIKSVLVVAGSLKRGD RPE++VLMRALRDFNIPKIIT+D+ VF
Sbjct: 2030 KELLSKQDHYDWGLRAIKSVLVVAGSLKRGDPGRPEEEVLMRALRDFNIPKIITDDMPVF 2089
Query: 1711 MGLIGDLFPALDVPRKRDIDFEKQVRQATIDMKLQPEDSFILKVVQLVELFAVRHSVFII 1770
MGLI DLFPALDVPRKRD DFE+ V+QA D+ LQPED+FILKVVQL EL VRHSVFI+
Sbjct: 2090 MGLISDLFPALDVPRKRDQDFERTVKQAASDLLLQPEDNFILKVVQLEELLEVRHSVFIV 2149
Query: 1771 GFAGTGKSCVWKTLYKTYVNAKKKPMYNDLEPKAVTNDELFGIINPSTREWKDGLFSCLI 1830
G AGTGK+ VWKTL +TY N K+KP++NDL PKAVTNDELFGIINP+TREWKDGLFS L+
Sbjct: 2150 GNAGTGKTQVWKTLLRTYQNIKRKPIFNDLNPKAVTNDELFGIINPATREWKDGLFSVLM 2209
Query: 1831 REQAQSTGDGPKWMVMDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPSMRLLFEISN 1890
R+QA TGD PKW+V+DGDIDPMWIESLNTVMDDNKVLTLASNERIALTPSMRLLFEISN
Sbjct: 2210 RDQANITGDQPKWIVLDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPSMRLLFEISN 2269
Query: 1891 LRTATPATVSRAGILYINPQDLGWNPYVLSWTDTRESESEKNILMGLFDKLTP 1943
LRTATPATVSRAGILYINPQDLGWNPYV SW +TR+ +EK+ L+ LFDK P
Sbjct: 2270 LRTATPATVSRAGILYINPQDLGWNPYVTSWVETRKIPAEKSNLVMLFDKYIP 2322
|
|
| FB|FBgn0001315 kl-5 "male fertility factor kl5" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PDR4 DNAH9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1LRU2 Dnah17 "Protein Dnah17" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PN88 DNAH17 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UFH2 DNAH17 "Dynein heavy chain 17, axonemal" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1917176 Dnahc17 "dynein, axonemal, heavy chain 17" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BLB4 LOC788092 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NJ57 DNAH9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NI32 DNAH9 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 1949 | |||
| pfam12774 | 231 | pfam12774, AAA_6, Hydrolytic ATP binding site of d | 1e-143 | |
| pfam12774 | 231 | pfam12774, AAA_6, Hydrolytic ATP binding site of d | 1e-137 | |
| pfam08393 | 408 | pfam08393, DHC_N2, Dynein heavy chain, N-terminal | 6e-71 | |
| pfam08393 | 408 | pfam08393, DHC_N2, Dynein heavy chain, N-terminal | 4e-47 | |
| COG5245 | 3164 | COG5245, DYN1, Dynein, heavy chain [Cytoskeleton] | 9e-12 | |
| COG5245 | 3164 | COG5245, DYN1, Dynein, heavy chain [Cytoskeleton] | 4e-11 | |
| COG5245 | 3164 | COG5245, DYN1, Dynein, heavy chain [Cytoskeleton] | 3e-10 | |
| pfam07728 | 135 | pfam07728, AAA_5, AAA domain (dynein-related subfa | 4e-08 |
| >gnl|CDD|193250 pfam12774, AAA_6, Hydrolytic ATP binding site of dynein motor region D1 | Back alignment and domain information |
|---|
Score = 442 bits (1137), Expect = e-143
Identities = 195/227 (85%), Positives = 212/227 (93%)
Query: 1013 FDHEYLGCTPRLVITPLTDRCYITLSQSLHLNMGGAPAGPAGTGKTETTKDLGKAIGIMV 1072
+ +EYLG TPRLVITPLTDRCYITL+QSLHL M GAPAGPAGTGKTETTKDLG+A+GIMV
Sbjct: 1 YSYEYLGNTPRLVITPLTDRCYITLTQSLHLTMSGAPAGPAGTGKTETTKDLGRALGIMV 60
Query: 1073 YVFNCSEQMDYRSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSVLDSVKMRKS 1132
YVFNCSEQMDY+SCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVK V D+++ +K
Sbjct: 61 YVFNCSEQMDYKSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKCVQDAIRDKKQ 120
Query: 1133 RFNFMGENIKLVTTVGMFITMNPGYAGRAELPENLKALFRPCAMVVPDFALICEIMLVSE 1192
FNF+GE I L+ +VG+FITMNPGYAGR ELPENLKALFRPCAMVVPDF LICEIMLV+E
Sbjct: 121 WFNFLGEEISLIPSVGIFITMNPGYAGRTELPENLKALFRPCAMVVPDFELICEIMLVAE 180
Query: 1193 GFQEARLLSRKFITLYSLCKELLSKQDHYDWGLRAIKSVLVVAGSLK 1239
GF EARLL+RKFITLY+LCKELLSKQDHYDWGLRAIKSVLVVAGSLK
Sbjct: 181 GFLEARLLARKFITLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLK 227
|
the 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases. The core of the 380 kDa motor unit contains a concatenated chain of six AAA modules, of which four correspond to the ATP binding sites with P-loop signatures described previously, and two are modules in which the P loop has been lost in evolution. This particular family is the D1 unit of the motor and contains the hydrolytic ATP binding site. Length = 231 |
| >gnl|CDD|193250 pfam12774, AAA_6, Hydrolytic ATP binding site of dynein motor region D1 | Back alignment and domain information |
|---|
| >gnl|CDD|219818 pfam08393, DHC_N2, Dynein heavy chain, N-terminal region 2 | Back alignment and domain information |
|---|
| >gnl|CDD|219818 pfam08393, DHC_N2, Dynein heavy chain, N-terminal region 2 | Back alignment and domain information |
|---|
| >gnl|CDD|227570 COG5245, DYN1, Dynein, heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|227570 COG5245, DYN1, Dynein, heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|227570 COG5245, DYN1, Dynein, heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >gnl|CDD|219538 pfam07728, AAA_5, AAA domain (dynein-related subfamily) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1949 | |||
| PF12774 | 231 | AAA_6: Hydrolytic ATP binding site of dynein motor | 100.0 | |
| PF12774 | 231 | AAA_6: Hydrolytic ATP binding site of dynein motor | 100.0 | |
| COG5271 | 4600 | MDN1 AAA ATPase containing von Willebrand factor t | 100.0 | |
| COG5271 | 4600 | MDN1 AAA ATPase containing von Willebrand factor t | 100.0 | |
| PF08393 | 408 | DHC_N2: Dynein heavy chain, N-terminal region 2; I | 100.0 | |
| COG5245 | 3164 | DYN1 Dynein, heavy chain [Cytoskeleton] | 100.0 | |
| PF08393 | 408 | DHC_N2: Dynein heavy chain, N-terminal region 2; I | 100.0 | |
| KOG1808|consensus | 1856 | 99.96 | ||
| KOG1808|consensus | 1856 | 99.95 | ||
| COG5245 | 3164 | DYN1 Dynein, heavy chain [Cytoskeleton] | 99.94 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 99.79 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 99.78 | |
| PHA02244 | 383 | ATPase-like protein | 99.54 | |
| KOG0733|consensus | 802 | 99.54 | ||
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 99.45 | |
| KOG0730|consensus | 693 | 99.43 | ||
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 99.37 | |
| KOG0736|consensus | 953 | 99.37 | ||
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 99.35 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 99.35 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 99.34 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 99.29 | |
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 99.25 | |
| PHA02244 | 383 | ATPase-like protein | 99.25 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 99.2 | |
| TIGR01650 | 327 | PD_CobS cobaltochelatase, CobS subunit. This model | 99.17 | |
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 99.17 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 99.13 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 99.11 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 99.04 | |
| TIGR02639 | 731 | ClpA ATP-dependent Clp protease ATP-binding subuni | 99.03 | |
| PRK11034 | 758 | clpA ATP-dependent Clp protease ATP-binding subuni | 99.03 | |
| KOG0735|consensus | 952 | 98.95 | ||
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 98.94 | |
| KOG0736|consensus | 953 | 98.87 | ||
| KOG0730|consensus | 693 | 98.86 | ||
| TIGR01243 | 733 | CDC48 AAA family ATPase, CDC48 subfamily. This sub | 98.74 | |
| CHL00095 | 821 | clpC Clp protease ATP binding subunit | 98.68 | |
| TIGR03346 | 852 | chaperone_ClpB ATP-dependent chaperone ClpB. Membe | 98.61 | |
| TIGR03345 | 852 | VI_ClpV1 type VI secretion ATPase, ClpV1 family. M | 98.6 | |
| KOG0741|consensus | 744 | 98.59 | ||
| KOG0733|consensus | 802 | 98.55 | ||
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 98.53 | |
| PRK10865 | 857 | protein disaggregation chaperone; Provisional | 98.52 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 98.52 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 98.51 | |
| PF07726 | 131 | AAA_3: ATPase family associated with various cellu | 98.39 | |
| KOG0735|consensus | 952 | 98.28 | ||
| COG0714 | 329 | MoxR-like ATPases [General function prediction onl | 98.26 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 98.19 | |
| CHL00195 | 489 | ycf46 Ycf46; Provisional | 98.12 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 98.07 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 98.06 | |
| KOG3595|consensus | 1395 | 98.05 | ||
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 98.02 | |
| TIGR02974 | 329 | phageshock_pspF psp operon transcriptional activat | 98.0 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 97.99 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 97.98 | |
| PRK11608 | 326 | pspF phage shock protein operon transcriptional ac | 97.97 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.97 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 97.96 | |
| COG0542 | 786 | clpA ATP-binding subunits of Clp protease and DnaK | 97.9 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 97.9 | |
| smart00350 | 509 | MCM minichromosome maintenance proteins. | 97.9 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 97.88 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 97.86 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 97.85 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 97.79 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 97.78 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 97.76 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 97.76 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 97.75 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 97.74 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 97.73 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 97.72 | |
| COG1239 | 423 | ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis | 97.7 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 97.7 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 97.69 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 97.68 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 97.64 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 97.64 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 97.61 | |
| PRK15424 | 538 | propionate catabolism operon regulatory protein Pr | 97.59 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 97.58 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 97.57 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 97.57 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 97.56 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 97.56 | |
| KOG0744|consensus | 423 | 97.56 | ||
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 97.54 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 97.54 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 97.52 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 97.52 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 97.52 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 97.51 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 97.51 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 97.51 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 97.49 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 97.48 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 97.47 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 97.45 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 97.45 | |
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 97.44 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 97.43 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 97.42 | |
| PRK05022 | 509 | anaerobic nitric oxide reductase transcription reg | 97.41 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 97.41 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.41 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 97.4 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 97.4 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 97.4 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 97.39 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 97.39 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 97.38 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 97.37 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 97.37 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 97.37 | |
| TIGR02442 | 633 | Cob-chelat-sub cobaltochelatase subunit. A number | 97.37 | |
| TIGR02031 | 589 | BchD-ChlD magnesium chelatase ATPase subunit D. Th | 97.36 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 97.36 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 97.36 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 97.36 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 97.35 | |
| KOG0727|consensus | 408 | 97.35 | ||
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 97.35 | |
| PF14532 | 138 | Sigma54_activ_2: Sigma-54 interaction domain; PDB: | 97.35 | |
| PRK13407 | 334 | bchI magnesium chelatase subunit I; Provisional | 97.34 | |
| KOG0734|consensus | 752 | 97.33 | ||
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 97.32 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 97.32 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 97.31 | |
| PF12780 | 268 | AAA_8: P-loop containing dynein motor region D4; I | 97.31 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 97.31 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 97.3 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 97.3 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 97.29 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 97.29 | |
| TIGR02329 | 526 | propionate_PrpR propionate catabolism operon regul | 97.28 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 97.27 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 97.27 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 97.26 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 97.26 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 97.25 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 97.25 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 97.24 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 97.24 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 97.24 | |
| PRK10733 | 644 | hflB ATP-dependent metalloprotease; Reviewed | 97.23 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 97.23 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 97.22 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 97.21 | |
| TIGR02030 | 337 | BchI-ChlI magnesium chelatase ATPase subunit I. Th | 97.21 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 97.21 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 97.21 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 97.18 | |
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 97.17 | |
| PLN00020 | 413 | ribulose bisphosphate carboxylase/oxygenase activa | 97.17 | |
| PTZ00111 | 915 | DNA replication licensing factor MCM4; Provisional | 97.16 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 97.16 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 97.15 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 97.15 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 97.14 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 97.13 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 97.12 | |
| TIGR02902 | 531 | spore_lonB ATP-dependent protease LonB. Members of | 97.12 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 97.12 | |
| PRK06620 | 214 | hypothetical protein; Validated | 97.11 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 97.11 | |
| PRK10923 | 469 | glnG nitrogen regulation protein NR(I); Provisiona | 97.11 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 97.1 | |
| TIGR00368 | 499 | Mg chelatase-related protein. The N-terminal end m | 97.1 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 97.1 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 97.1 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 97.1 | |
| CHL00206 | 2281 | ycf2 Ycf2; Provisional | 97.09 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.09 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 97.07 | |
| PRK10787 | 784 | DNA-binding ATP-dependent protease La; Provisional | 97.07 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 97.06 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 97.06 | |
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 97.06 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 97.06 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 97.05 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 97.05 | |
| KOG0478|consensus | 804 | 97.04 | ||
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 97.04 | |
| TIGR02915 | 445 | PEP_resp_reg putative PEP-CTERM system response re | 97.04 | |
| KOG0989|consensus | 346 | 97.03 | ||
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 97.01 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 96.98 | |
| PF13173 | 128 | AAA_14: AAA domain | 96.98 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 96.97 | |
| PRK07133 | 725 | DNA polymerase III subunits gamma and tau; Validat | 96.96 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 96.96 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 96.96 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 96.95 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 96.95 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 96.95 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 96.94 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 96.92 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 96.92 | |
| KOG0744|consensus | 423 | 96.92 | ||
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 96.9 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 96.9 | |
| COG1223 | 368 | Predicted ATPase (AAA+ superfamily) [General funct | 96.9 | |
| KOG0989|consensus | 346 | 96.89 | ||
| PRK07940 | 394 | DNA polymerase III subunit delta'; Validated | 96.89 | |
| PF01078 | 206 | Mg_chelatase: Magnesium chelatase, subunit ChlI; I | 96.89 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 96.88 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 96.86 | |
| KOG2004|consensus | 906 | 96.86 | ||
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 96.86 | |
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 96.85 | |
| CHL00081 | 350 | chlI Mg-protoporyphyrin IX chelatase | 96.85 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 96.84 | |
| PRK08727 | 233 | hypothetical protein; Validated | 96.84 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 96.83 | |
| COG0464 | 494 | SpoVK ATPases of the AAA+ class [Posttranslational | 96.82 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 96.82 | |
| PRK11361 | 457 | acetoacetate metabolism regulatory protein AtoC; P | 96.81 | |
| KOG0729|consensus | 435 | 96.81 | ||
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 96.81 | |
| KOG0728|consensus | 404 | 96.81 | ||
| TIGR02903 | 615 | spore_lon_C ATP-dependent protease, Lon family. Me | 96.8 | |
| PRK09518 | 712 | bifunctional cytidylate kinase/GTPase Der; Reviewe | 96.8 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 96.8 | |
| TIGR02031 | 589 | BchD-ChlD magnesium chelatase ATPase subunit D. Th | 96.78 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 96.78 | |
| COG1221 | 403 | PspF Transcriptional regulators containing an AAA- | 96.76 | |
| PRK15115 | 444 | response regulator GlrR; Provisional | 96.75 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 96.74 | |
| TIGR00368 | 499 | Mg chelatase-related protein. The N-terminal end m | 96.73 | |
| PRK13531 | 498 | regulatory ATPase RavA; Provisional | 96.73 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 96.72 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 96.71 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 96.71 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 96.7 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 96.69 | |
| PRK09862 | 506 | putative ATP-dependent protease; Provisional | 96.69 | |
| PF07724 | 171 | AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR | 96.69 | |
| KOG0738|consensus | 491 | 96.68 | ||
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 96.67 | |
| PRK07399 | 314 | DNA polymerase III subunit delta'; Validated | 96.67 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 96.66 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 96.64 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 96.62 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 96.62 | |
| TIGR00382 | 413 | clpX endopeptidase Clp ATP-binding regulatory subu | 96.62 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 96.62 | |
| PRK14970 | 367 | DNA polymerase III subunits gamma and tau; Provisi | 96.61 | |
| PRK09087 | 226 | hypothetical protein; Validated | 96.6 | |
| TIGR01818 | 463 | ntrC nitrogen regulation protein NR(I). This model | 96.59 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 96.57 | |
| KOG0651|consensus | 388 | 96.56 | ||
| PRK13808 | 333 | adenylate kinase; Provisional | 96.56 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 96.55 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 96.55 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 96.53 | |
| TIGR02442 | 633 | Cob-chelat-sub cobaltochelatase subunit. A number | 96.53 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 96.52 | |
| PRK06851 | 367 | hypothetical protein; Provisional | 96.52 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 96.51 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 96.5 | |
| PRK04132 | 846 | replication factor C small subunit; Provisional | 96.48 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 96.45 | |
| PRK03992 | 389 | proteasome-activating nucleotidase; Provisional | 96.41 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 96.4 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 96.4 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 96.39 | |
| TIGR03689 | 512 | pup_AAA proteasome ATPase. In the Actinobacteria, | 96.38 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 96.37 | |
| PRK15424 | 538 | propionate catabolism operon regulatory protein Pr | 96.35 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 96.35 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 96.34 | |
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 96.32 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 96.32 | |
| KOG0741|consensus | 744 | 96.32 | ||
| KOG0743|consensus | 457 | 96.3 | ||
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 96.3 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 96.28 | |
| PRK09862 | 506 | putative ATP-dependent protease; Provisional | 96.26 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 96.26 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 96.26 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 96.26 | |
| KOG0737|consensus | 386 | 96.25 | ||
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 96.24 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 96.24 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 96.23 | |
| PRK14529 | 223 | adenylate kinase; Provisional | 96.23 | |
| smart00350 | 509 | MCM minichromosome maintenance proteins. | 96.22 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 96.22 | |
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 96.19 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 96.19 | |
| KOG0726|consensus | 440 | 96.18 | ||
| PRK07261 | 171 | topology modulation protein; Provisional | 96.17 | |
| PTZ00454 | 398 | 26S protease regulatory subunit 6B-like protein; P | 96.15 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 96.15 | |
| PRK05342 | 412 | clpX ATP-dependent protease ATP-binding subunit Cl | 96.14 | |
| PRK10365 | 441 | transcriptional regulatory protein ZraR; Provision | 96.12 | |
| PRK14526 | 211 | adenylate kinase; Provisional | 96.12 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 96.12 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 96.07 | |
| KOG2028|consensus | 554 | 96.05 | ||
| TIGR01242 | 364 | 26Sp45 26S proteasome subunit P45 family. Many pro | 96.05 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 96.04 | |
| KOG0727|consensus | 408 | 96.03 | ||
| PLN02674 | 244 | adenylate kinase | 96.02 | |
| PF03028 | 707 | Dynein_heavy: Dynein heavy chain and region D6 of | 96.02 | |
| KOG1969|consensus | 877 | 96.01 | ||
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 96.01 | |
| TIGR02974 | 329 | phageshock_pspF psp operon transcriptional activat | 95.99 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 95.98 | |
| TIGR02329 | 526 | propionate_PrpR propionate catabolism operon regul | 95.98 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 95.98 | |
| PLN02842 | 505 | nucleotide kinase | 95.97 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 95.95 | |
| COG2204 | 464 | AtoC Response regulator containing CheY-like recei | 95.93 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 95.88 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 95.88 | |
| PRK06217 | 183 | hypothetical protein; Validated | 95.88 | |
| PRK13406 | 584 | bchD magnesium chelatase subunit D; Provisional | 95.86 | |
| PF13173 | 128 | AAA_14: AAA domain | 95.84 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 95.8 | |
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 95.8 | |
| TIGR01241 | 495 | FtsH_fam ATP-dependent metalloprotease FtsH. HflB( | 95.8 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 95.76 | |
| PRK11388 | 638 | DNA-binding transcriptional regulator DhaR; Provis | 95.75 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 95.74 | |
| KOG0745|consensus | 564 | 95.73 | ||
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 95.72 | |
| PLN02459 | 261 | probable adenylate kinase | 95.7 | |
| TIGR00764 | 608 | lon_rel lon-related putative ATP-dependent proteas | 95.7 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 95.68 | |
| PRK02496 | 184 | adk adenylate kinase; Provisional | 95.67 | |
| KOG0652|consensus | 424 | 95.67 | ||
| COG1221 | 403 | PspF Transcriptional regulators containing an AAA- | 95.66 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 95.65 | |
| PRK00279 | 215 | adk adenylate kinase; Reviewed | 95.64 | |
| TIGR01351 | 210 | adk adenylate kinases. Adenylate kinase (EC 2.7.4. | 95.63 | |
| KOG0482|consensus | 721 | 95.62 | ||
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 95.6 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 95.56 | |
| PTZ00361 | 438 | 26 proteosome regulatory subunit 4-like protein; P | 95.55 | |
| PRK05917 | 290 | DNA polymerase III subunit delta'; Validated | 95.55 | |
| KOG0743|consensus | 457 | 95.53 | ||
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 95.52 | |
| PRK06526 | 254 | transposase; Provisional | 95.5 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 95.5 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 95.47 | |
| COG4088 | 261 | Predicted nucleotide kinase [Nucleotide transport | 95.47 | |
| PRK14528 | 186 | adenylate kinase; Provisional | 95.44 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 95.42 | |
| PF00406 | 151 | ADK: Adenylate kinase; InterPro: IPR000850 Adenyla | 95.41 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 95.38 | |
| PRK14527 | 191 | adenylate kinase; Provisional | 95.34 | |
| PRK11608 | 326 | pspF phage shock protein operon transcriptional ac | 95.32 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 95.32 | |
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 95.32 | |
| COG0606 | 490 | Predicted ATPase with chaperone activity [Posttran | 95.31 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 95.28 | |
| PRK08116 | 268 | hypothetical protein; Validated | 95.26 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 95.25 | |
| cd01428 | 194 | ADK Adenylate kinase (ADK) catalyzes the reversibl | 95.25 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 95.23 | |
| PRK08181 | 269 | transposase; Validated | 95.14 | |
| PRK07132 | 299 | DNA polymerase III subunit delta'; Validated | 95.14 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 95.09 | |
| COG1239 | 423 | ChlI Mg-chelatase subunit ChlI [Coenzyme metabolis | 95.08 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 95.07 | |
| PRK08233 | 182 | hypothetical protein; Provisional | 95.05 | |
| PF06414 | 199 | Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e | 95.03 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 95.02 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 95.01 | |
| PRK05201 | 443 | hslU ATP-dependent protease ATP-binding subunit Hs | 95.01 | |
| PLN02200 | 234 | adenylate kinase family protein | 95.0 | |
| KOG0742|consensus | 630 | 95.0 | ||
| PRK08116 | 268 | hypothetical protein; Validated | 94.98 | |
| PF12780 | 268 | AAA_8: P-loop containing dynein motor region D4; I | 94.96 | |
| PRK10820 | 520 | DNA-binding transcriptional regulator TyrR; Provis | 94.96 | |
| KOG3595|consensus | 1395 | 94.93 | ||
| KOG0731|consensus | 774 | 94.91 | ||
| smart00763 | 361 | AAA_PrkA PrkA AAA domain. This is a family of PrkA | 94.9 | |
| PF00493 | 331 | MCM: MCM2/3/5 family This family extends the MCM d | 94.87 | |
| COG3829 | 560 | RocR Transcriptional regulator containing PAS, AAA | 94.87 | |
| COG0563 | 178 | Adk Adenylate kinase and related kinases [Nucleoti | 94.86 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 94.83 | |
| PRK08118 | 167 | topology modulation protein; Reviewed | 94.83 | |
| KOG0739|consensus | 439 | 94.82 | ||
| PF07931 | 174 | CPT: Chloramphenicol phosphotransferase-like prote | 94.82 | |
| KOG0738|consensus | 491 | 94.81 | ||
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 94.79 | |
| PRK05022 | 509 | anaerobic nitric oxide reductase transcription reg | 94.78 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 94.75 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 94.73 | |
| PRK06762 | 166 | hypothetical protein; Provisional | 94.72 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 94.66 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 94.61 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 94.57 | |
| PRK08727 | 233 | hypothetical protein; Validated | 94.56 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 94.53 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 94.52 | |
| TIGR01817 | 534 | nifA Nif-specific regulatory protein. This model r | 94.51 | |
| PRK13949 | 169 | shikimate kinase; Provisional | 94.51 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.48 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 94.48 | |
| KOG0728|consensus | 404 | 94.47 | ||
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 94.46 | |
| KOG1533|consensus | 290 | 94.46 | ||
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 94.45 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 94.39 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 94.38 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 94.36 | |
| PRK05818 | 261 | DNA polymerase III subunit delta'; Validated | 94.36 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 94.35 | |
| COG1855 | 604 | ATPase (PilT family) [General function prediction | 94.33 | |
| PRK12377 | 248 | putative replication protein; Provisional | 94.3 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 94.29 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 94.29 | |
| KOG2004|consensus | 906 | 94.24 | ||
| KOG0480|consensus | 764 | 94.23 | ||
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 94.23 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 94.2 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 94.19 | |
| PF10662 | 143 | PduV-EutP: Ethanolamine utilisation - propanediol | 94.19 | |
| PRK13765 | 637 | ATP-dependent protease Lon; Provisional | 94.18 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 94.17 | |
| KOG2028|consensus | 554 | 94.17 | ||
| PF13245 | 76 | AAA_19: Part of AAA domain | 94.15 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 94.13 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 94.13 | |
| PF05673 | 249 | DUF815: Protein of unknown function (DUF815); Inte | 94.12 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 94.07 | |
| KOG0745|consensus | 564 | 94.06 | ||
| PRK05564 | 313 | DNA polymerase III subunit delta'; Validated | 94.04 | |
| PRK15429 | 686 | formate hydrogenlyase transcriptional activator Fh | 94.04 | |
| COG4987 | 573 | CydC ABC-type transport system involved in cytochr | 93.97 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 93.92 | |
| PHA02624 | 647 | large T antigen; Provisional | 93.92 | |
| KOG0731|consensus | 774 | 93.91 | ||
| cd03228 | 171 | ABCC_MRP_Like The MRP (Mutidrug Resistance Protein | 93.86 | |
| KOG1532|consensus | 366 | 93.86 | ||
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 93.85 | |
| PRK06620 | 214 | hypothetical protein; Validated | 93.85 | |
| COG1116 | 248 | TauB ABC-type nitrate/sulfonate/bicarbonate transp | 93.83 | |
| PRK08181 | 269 | transposase; Validated | 93.82 | |
| PHA02774 | 613 | E1; Provisional | 93.81 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 93.8 | |
| KOG1534|consensus | 273 | 93.77 | ||
| KOG1970|consensus | 634 | 93.76 | ||
| KOG0991|consensus | 333 | 93.73 | ||
| KOG0991|consensus | 333 | 93.73 | ||
| PRK13406 | 584 | bchD magnesium chelatase subunit D; Provisional | 93.73 | |
| PF00910 | 107 | RNA_helicase: RNA helicase; InterPro: IPR000605 He | 93.73 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 93.72 | |
| cd00820 | 107 | PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC | 93.71 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 93.71 | |
| COG3839 | 338 | MalK ABC-type sugar transport systems, ATPase comp | 93.69 | |
| COG3829 | 560 | RocR Transcriptional regulator containing PAS, AAA | 93.68 | |
| PRK13695 | 174 | putative NTPase; Provisional | 93.63 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 93.62 | |
| PF03215 | 519 | Rad17: Rad17 cell cycle checkpoint protein | 93.61 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 93.55 | |
| PF00435 | 105 | Spectrin: Spectrin repeat; InterPro: IPR002017 Spe | 93.53 | |
| COG1241 | 682 | MCM2 Predicted ATPase involved in replication cont | 93.53 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 93.52 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 93.51 | |
| PF00931 | 287 | NB-ARC: NB-ARC domain; InterPro: IPR002182 This is | 93.49 | |
| KOG0054|consensus | 1381 | 93.48 | ||
| TIGR00390 | 441 | hslU ATP-dependent protease HslVU, ATPase subunit. | 93.45 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 93.44 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 93.42 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 93.4 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 93.39 | |
| PRK03839 | 180 | putative kinase; Provisional | 93.38 | |
| COG4525 | 259 | TauB ABC-type taurine transport system, ATPase com | 93.37 | |
| PF03193 | 161 | DUF258: Protein of unknown function, DUF258; Inter | 93.35 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 93.34 | |
| COG1224 | 450 | TIP49 DNA helicase TIP49, TBP-interacting protein | 93.34 | |
| cd02027 | 149 | APSK Adenosine 5'-phosphosulfate kinase (APSK) cat | 93.32 | |
| KOG3079|consensus | 195 | 93.32 | ||
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 93.32 | |
| PTZ00111 | 915 | DNA replication licensing factor MCM4; Provisional | 93.28 | |
| TIGR00150 | 133 | HI0065_YjeE ATPase, YjeE family. Members of this f | 93.27 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 93.27 | |
| PRK00131 | 175 | aroK shikimate kinase; Reviewed | 93.24 | |
| KOG1533|consensus | 290 | 93.24 | ||
| PF06068 | 398 | TIP49: TIP49 C-terminus; InterPro: IPR010339 This | 93.24 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 93.2 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 93.19 | |
| PRK07261 | 171 | topology modulation protein; Provisional | 93.15 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 93.11 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 93.09 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 93.09 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 93.07 | |
| KOG0737|consensus | 386 | 93.04 | ||
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 93.02 | |
| PRK14531 | 183 | adenylate kinase; Provisional | 93.02 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 93.02 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 93.02 | |
| COG0465 | 596 | HflB ATP-dependent Zn proteases [Posttranslational | 93.0 |
| >PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.6e-58 Score=516.43 Aligned_cols=231 Identities=65% Similarity=1.112 Sum_probs=187.0
Q ss_pred cccccccCCCCccccccchHHHHHHHHHHHhccCCCCCCCCCCChhHHHHHHHHHhcceEEEEeCCCCCCHhhhhhhccc
Q psy2654 1400 FDHEYLGCTPRLVITPLTDRCYITLSQSLHLNMGGAPAGPAGTGKTETTKDLGKAIGIMVYVFNCSEQMDYRSCGNIYKG 1479 (1949)
Q Consensus 1400 y~~ey~g~~~~~v~t~~t~r~~~~l~~al~~~~~~~l~G~~g~GKt~~v~~la~~lg~~~~~~n~~~~~~~~~l~~~~~g 1479 (1949)
|||||+|+.+++|+||+|+|||.+|++|++.+.|+++.||+||||||++|+||++||+++++|||++++|++.++|++.|
T Consensus 1 YgyEY~G~~~rlv~Tplt~r~~~~l~~al~~~~~~~~~GpagtGKtetik~La~~lG~~~~vfnc~~~~~~~~l~ril~G 80 (231)
T PF12774_consen 1 YGYEYLGNSPRLVITPLTDRCFLTLTQALSLNLGGALSGPAGTGKTETIKDLARALGRFVVVFNCSEQMDYQSLSRILKG 80 (231)
T ss_dssp -------S-------HHHHHHHHHHHHHHCTTTEEEEESSTTSSHHHHHHHHHHCTT--EEEEETTSSS-HHHHHHHHHH
T ss_pred CCccccCCCCCceechHHHHHHHHHHHHhccCCCCCCcCCCCCCchhHHHHHHHHhCCeEEEecccccccHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred ccccCccccccccccccchhhHHHHHHHHHHHHHHHhhhccccccccchhhhhcccCCCcccccccccchhhHHHHHHHH
Q psy2654 1480 LAQTGAWGCFDEFNRISVEVLSVVAVQVKSVLDSVKMRKSRFNFMGESSLAGLAQTGAWGCFDEFNRISVEVLSVVAVQV 1559 (1949)
Q Consensus 1480 ~~~~g~w~~~de~~~l~~~~ls~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~g~w~~~de~n~~~~~~l~~~~~~~ 1559 (1949)
++++|+|+||||||+++.++||++++++..|+++++
T Consensus 81 ~~~~GaW~cfdefnrl~~~vLS~i~~~i~~i~~al~-------------------------------------------- 116 (231)
T PF12774_consen 81 LAQSGAWLCFDEFNRLSEEVLSVISQQIQSIQDALR-------------------------------------------- 116 (231)
T ss_dssp HHHHT-EEEEETCCCSSHHHHHHHHHHHHHHHHHHH--------------------------------------------
T ss_pred HhhcCchhhhhhhhhhhHHHHHHHHHHHHHHHHhhc--------------------------------------------
Confidence 999999999999999999999999999888876554
Q ss_pred HhHhhhhhhccccceeccceEEEecCeeEEEEeCCCCCCCCCChhhHhhcccccccccCCHHHHHHHHHhhhchhhHHHH
Q psy2654 1560 KSVLDSVKMRKSRFNFMGENIKLVTTVGMFITMNPGYAGRAELPENLKALFRPCAMVVPDFALICEIMLVSEGFQEARLL 1639 (1949)
Q Consensus 1560 ~~~~~~l~~~~~~~~~~~~~i~~~~~~~~f~tmnp~~~g~~~LP~~lk~~fr~v~~~~pD~~~i~e~~L~~~gf~~~~~l 1639 (1949)
.+...+.+.|.+|.++|++++|+||||+|.||++||+|||++||||+|+.||...|+|++|.+.||.+++.|
T Consensus 117 --------~~~~~~~~~g~~i~l~~~~~iFiT~np~y~gr~~LP~nLk~lFRpvam~~PD~~~I~ei~L~s~GF~~a~~L 188 (231)
T PF12774_consen 117 --------AKQKSFTLEGQEIKLNPNCGIFITMNPGYAGRSELPENLKALFRPVAMMVPDLSLIAEILLLSQGFKDAKSL 188 (231)
T ss_dssp --------CTSSEEEETTCEEE--TT-EEEEEE-B-CCCC--S-HHHCTTEEEEE--S--HHHHHHHHHHCCCTSSHHHH
T ss_pred --------ccccccccCCCEEEEccceeEEEeeccccCCcccCCHhHHHHhheeEEeCCCHHHHHHHHHHHcCchhHHHH
Confidence 344567777899999999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHhcCCCCCCCchhhHHHHHHhhcccccCCC
Q psy2654 1640 SRKFITLYSLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDR 1682 (1949)
Q Consensus 1640 a~k~~~~~~~~~~~~s~~~~~~~~lr~l~~vl~~a~~~~~~~~ 1682 (1949)
|+|++.||+++++++|+|.|||||||++|+||..|+.++|+.|
T Consensus 189 a~kl~~l~~l~~~~lS~q~hydfgLRalk~vl~~a~~~kr~~p 231 (231)
T PF12774_consen 189 AKKLVSLFQLCKEQLSKQDHYDFGLRALKSVLRMAGSLKRGDP 231 (231)
T ss_dssp HHHHHHHHHHHHHCS-SSTT---SHHHHHHHHHHHHHHHT---
T ss_pred HHHHHHHHHHHHHhhccCccccccHHHHHHHHHHHHHHhcccC
Confidence 9999999999999999999999999999999999999999865
|
|
| >PF12774 AAA_6: Hydrolytic ATP binding site of dynein motor region D1; PDB: 3VKH_A 3VKG_A 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A | Back alignment and domain information |
|---|
| >COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >COG5271 MDN1 AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF08393 DHC_N2: Dynein heavy chain, N-terminal region 2; InterPro: IPR013602 Dyneins are described as motor proteins of eukaryotic cells, as they can convert energy derived from the hydrolysis of ATP to force and movement along cytoskeletal polymers, such as microtubules | Back alignment and domain information |
|---|
| >COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >PF08393 DHC_N2: Dynein heavy chain, N-terminal region 2; InterPro: IPR013602 Dyneins are described as motor proteins of eukaryotic cells, as they can convert energy derived from the hydrolysis of ATP to force and movement along cytoskeletal polymers, such as microtubules | Back alignment and domain information |
|---|
| >KOG1808|consensus | Back alignment and domain information |
|---|
| >KOG1808|consensus | Back alignment and domain information |
|---|
| >COG5245 DYN1 Dynein, heavy chain [Cytoskeleton] | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >KOG0733|consensus | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >KOG0730|consensus | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >KOG0736|consensus | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >PHA02244 ATPase-like protein | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >TIGR01650 PD_CobS cobaltochelatase, CobS subunit | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA | Back alignment and domain information |
|---|
| >PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0735|consensus | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >KOG0736|consensus | Back alignment and domain information |
|---|
| >KOG0730|consensus | Back alignment and domain information |
|---|
| >TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily | Back alignment and domain information |
|---|
| >CHL00095 clpC Clp protease ATP binding subunit | Back alignment and domain information |
|---|
| >TIGR03346 chaperone_ClpB ATP-dependent chaperone ClpB | Back alignment and domain information |
|---|
| >TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family | Back alignment and domain information |
|---|
| >KOG0741|consensus | Back alignment and domain information |
|---|
| >KOG0733|consensus | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >PRK10865 protein disaggregation chaperone; Provisional | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07726 AAA_3: ATPase family associated with various cellular activities (AAA); InterPro: IPR011703 This entry includes some of the AAA proteins not detected by the IPR003959 from INTERPRO model | Back alignment and domain information |
|---|
| >KOG0735|consensus | Back alignment and domain information |
|---|
| >COG0714 MoxR-like ATPases [General function prediction only] | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >CHL00195 ycf46 Ycf46; Provisional | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >KOG3595|consensus | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >TIGR02974 phageshock_pspF psp operon transcriptional activator PspF | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PRK11608 pspF phage shock protein operon transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >smart00350 MCM minichromosome maintenance proteins | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >KOG0744|consensus | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02442 Cob-chelat-sub cobaltochelatase subunit | Back alignment and domain information |
|---|
| >TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >KOG0727|consensus | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H | Back alignment and domain information |
|---|
| >PRK13407 bchI magnesium chelatase subunit I; Provisional | Back alignment and domain information |
|---|
| >KOG0734|consensus | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK10733 hflB ATP-dependent metalloprotease; Reviewed | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >TIGR02030 BchI-ChlI magnesium chelatase ATPase subunit I | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional | Back alignment and domain information |
|---|
| >PTZ00111 DNA replication licensing factor MCM4; Provisional | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02902 spore_lonB ATP-dependent protease LonB | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK10923 glnG nitrogen regulation protein NR(I); Provisional | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR00368 Mg chelatase-related protein | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >CHL00206 ycf2 Ycf2; Provisional | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK10787 DNA-binding ATP-dependent protease La; Provisional | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >KOG0478|consensus | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator | Back alignment and domain information |
|---|
| >KOG0989|consensus | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK07133 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0744|consensus | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0989|consensus | Back alignment and domain information |
|---|
| >PRK07940 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF01078 Mg_chelatase: Magnesium chelatase, subunit ChlI; InterPro: IPR000523 Magnesium-chelatase is a three-component enzyme that catalyses the insertion of Mg2+ into protoporphyrin IX | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >KOG2004|consensus | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >CHL00081 chlI Mg-protoporyphyrin IX chelatase | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional | Back alignment and domain information |
|---|
| >KOG0729|consensus | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >KOG0728|consensus | Back alignment and domain information |
|---|
| >TIGR02903 spore_lon_C ATP-dependent protease, Lon family | Back alignment and domain information |
|---|
| >PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02031 BchD-ChlD magnesium chelatase ATPase subunit D | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15115 response regulator GlrR; Provisional | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR00368 Mg chelatase-related protein | Back alignment and domain information |
|---|
| >PRK13531 regulatory ATPase RavA; Provisional | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09862 putative ATP-dependent protease; Provisional | Back alignment and domain information |
|---|
| >PF07724 AAA_2: AAA domain (Cdc48 subfamily); InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >KOG0738|consensus | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK07399 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00382 clpX endopeptidase Clp ATP-binding regulatory subunit (clpX) | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >PRK14970 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01818 ntrC nitrogen regulation protein NR(I) | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0651|consensus | Back alignment and domain information |
|---|
| >PRK13808 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >TIGR02442 Cob-chelat-sub cobaltochelatase subunit | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK06851 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PRK04132 replication factor C small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK03992 proteasome-activating nucleotidase; Provisional | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR03689 pup_AAA proteasome ATPase | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK15424 propionate catabolism operon regulatory protein PrpR; Provisional | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0741|consensus | Back alignment and domain information |
|---|
| >KOG0743|consensus | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK09862 putative ATP-dependent protease; Provisional | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >KOG0737|consensus | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK14529 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >smart00350 MCM minichromosome maintenance proteins | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >KOG0726|consensus | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK05342 clpX ATP-dependent protease ATP-binding subunit ClpX; Provisional | Back alignment and domain information |
|---|
| >PRK10365 transcriptional regulatory protein ZraR; Provisional | Back alignment and domain information |
|---|
| >PRK14526 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG2028|consensus | Back alignment and domain information |
|---|
| >TIGR01242 26Sp45 26S proteasome subunit P45 family | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0727|consensus | Back alignment and domain information |
|---|
| >PLN02674 adenylate kinase | Back alignment and domain information |
|---|
| >PF03028 Dynein_heavy: Dynein heavy chain and region D6 of dynein motor; InterPro: IPR004273 Dynein is a multisubunit microtubule-dependent motor enzyme that acts as the force generating protein of eukaryotic cilia and flagella | Back alignment and domain information |
|---|
| >KOG1969|consensus | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR02974 phageshock_pspF psp operon transcriptional activator PspF | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PLN02842 nucleotide kinase | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK13406 bchD magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11388 DNA-binding transcriptional regulator DhaR; Provisional | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >KOG0745|consensus | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PLN02459 probable adenylate kinase | Back alignment and domain information |
|---|
| >TIGR00764 lon_rel lon-related putative ATP-dependent protease | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PRK02496 adk adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0652|consensus | Back alignment and domain information |
|---|
| >COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK00279 adk adenylate kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01351 adk adenylate kinases | Back alignment and domain information |
|---|
| >KOG0482|consensus | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK05917 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0743|consensus | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK14528 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00406 ADK: Adenylate kinase; InterPro: IPR000850 Adenylate kinases (ADK) are phosphotransferases that catalyse the reversible reaction |
Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK14527 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11608 pspF phage shock protein operon transcriptional activator; Provisional | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PRK07132 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK08233 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PRK05201 hslU ATP-dependent protease ATP-binding subunit HslU; Provisional | Back alignment and domain information |
|---|
| >PLN02200 adenylate kinase family protein | Back alignment and domain information |
|---|
| >KOG0742|consensus | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF12780 AAA_8: P-loop containing dynein motor region D4; InterPro: IPR024317 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases | Back alignment and domain information |
|---|
| >PRK10820 DNA-binding transcriptional regulator TyrR; Provisional | Back alignment and domain information |
|---|
| >KOG3595|consensus | Back alignment and domain information |
|---|
| >KOG0731|consensus | Back alignment and domain information |
|---|
| >smart00763 AAA_PrkA PrkA AAA domain | Back alignment and domain information |
|---|
| >PF00493 MCM: MCM2/3/5 family This family extends the MCM domain of Prosite | Back alignment and domain information |
|---|
| >COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PRK08118 topology modulation protein; Reviewed | Back alignment and domain information |
|---|
| >KOG0739|consensus | Back alignment and domain information |
|---|
| >PF07931 CPT: Chloramphenicol phosphotransferase-like protein; InterPro: IPR012853 The members of this family are all similar to chloramphenicol 3-O phosphotransferase (CPT, Q56148 from SWISSPROT) expressed by Streptomyces venezuelae | Back alignment and domain information |
|---|
| >KOG0738|consensus | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06762 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >TIGR01817 nifA Nif-specific regulatory protein | Back alignment and domain information |
|---|
| >PRK13949 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >KOG0728|consensus | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >KOG1533|consensus | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK05818 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >COG1855 ATPase (PilT family) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >KOG2004|consensus | Back alignment and domain information |
|---|
| >KOG0480|consensus | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PF10662 PduV-EutP: Ethanolamine utilisation - propanediol utilisation; InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways | Back alignment and domain information |
|---|
| >PRK13765 ATP-dependent protease Lon; Provisional | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >KOG2028|consensus | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG0745|consensus | Back alignment and domain information |
|---|
| >PRK05564 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK15429 formate hydrogenlyase transcriptional activator FhlA; Provisional | Back alignment and domain information |
|---|
| >COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PHA02624 large T antigen; Provisional | Back alignment and domain information |
|---|
| >KOG0731|consensus | Back alignment and domain information |
|---|
| >cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export | Back alignment and domain information |
|---|
| >KOG1532|consensus | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PHA02774 E1; Provisional | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >KOG1534|consensus | Back alignment and domain information |
|---|
| >KOG1970|consensus | Back alignment and domain information |
|---|
| >KOG0991|consensus | Back alignment and domain information |
|---|
| >KOG0991|consensus | Back alignment and domain information |
|---|
| >PRK13406 bchD magnesium chelatase subunit D; Provisional | Back alignment and domain information |
|---|
| >PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF03215 Rad17: Rad17 cell cycle checkpoint protein | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF00435 Spectrin: Spectrin repeat; InterPro: IPR002017 Spectrin repeats [] are found in several proteins involved in cytoskeletal structure | Back alignment and domain information |
|---|
| >COG1241 MCM2 Predicted ATPase involved in replication control, Cdc46/Mcm family [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] | Back alignment and domain information |
|---|
| >KOG0054|consensus | Back alignment and domain information |
|---|
| >TIGR00390 hslU ATP-dependent protease HslVU, ATPase subunit | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription] | Back alignment and domain information |
|---|
| >cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) | Back alignment and domain information |
|---|
| >KOG3079|consensus | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PTZ00111 DNA replication licensing factor MCM4; Provisional | Back alignment and domain information |
|---|
| >TIGR00150 HI0065_YjeE ATPase, YjeE family | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK00131 aroK shikimate kinase; Reviewed | Back alignment and domain information |
|---|
| >KOG1533|consensus | Back alignment and domain information |
|---|
| >PF06068 TIP49: TIP49 C-terminus; InterPro: IPR010339 This family consists of the C-terminal region of several eukaryotic and archaeal RuvB-like 1 (Pontin or TIP49a) and RuvB-like 2 (Reptin or TIP49b) proteins | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK07261 topology modulation protein; Provisional | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0737|consensus | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14531 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >COG0465 HflB ATP-dependent Zn proteases [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 1949 | ||||
| 3vkg_A | 3245 | X-Ray Structure Of An Mtbd Truncation Mutant Of Dyn | 5e-91 | ||
| 3vkh_A | 3367 | X-Ray Structure Of A Functional Full-Length Dynein | 6e-91 | ||
| 3qmz_A | 2486 | Crystal Structure Of The Cytoplasmic Dynein Heavy C | 1e-59 | ||
| 4ai6_A | 2695 | Dynein Motor Domain - Adp Complex Length = 2695 | 2e-59 |
| >pdb|3VKG|A Chain A, X-Ray Structure Of An Mtbd Truncation Mutant Of Dynein Motor Domain Length = 3245 | Back alignment and structure |
|
| >pdb|3VKH|A Chain A, X-Ray Structure Of A Functional Full-Length Dynein Motor Domain Length = 3367 | Back alignment and structure |
| >pdb|3QMZ|A Chain A, Crystal Structure Of The Cytoplasmic Dynein Heavy Chain Motor Domain Length = 2486 | Back alignment and structure |
| >pdb|4AI6|A Chain A, Dynein Motor Domain - Adp Complex Length = 2695 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Length = 2695 | Back alignment and structure |
|---|
Score = 860 bits (2223), Expect = 0.0
Identities = 185/726 (25%), Positives = 305/726 (42%), Gaps = 96/726 (13%)
Query: 1235 AGSLKNWLNNVTDSMRRTGIHCMSLAVAAYDEKPR-EQWLFDYPGQTALCGTQIWWTTEV 1293
+ + WLN + ++ + + + E + Y Q L Q+ WT V
Sbjct: 457 SIQAQEWLNILDTEIKLSVFTQFRDCLGQIKDGTDIEVVVSKYIFQAILLSAQVMWTELV 516
Query: 1294 SICFARLEEGYENALKDYNKK--QFIIGFAGTGKSCVWKTLYKTYVN-----AKKKPMYN 1346
C N Y K+ I G + K +
Sbjct: 517 EKCLQ------TNQFSKYWKEVDMKIKGLLDKLNKSS-DNVKKKIEALLVEYLHFNNVIG 569
Query: 1347 DLEPKAVTNDELFGIINPSTREW-KDGRYSDSGFLSY-----GSLLGDCFANICDAEFKF 1400
L+ + + W K ++ Y L F + ++
Sbjct: 570 QLKNCSTKEEARL--------LWAKVQKF-------YQKNDTLDDLNSVFISQSGYLLQY 614
Query: 1401 DHEYLGCTPRLVITPLTDRCYITLSQSLHLNMGGAPAGPAGTGKTETTKDLGKAIGIMVY 1460
EY+G RL+ TPL + TL+ SLH GG GPAGTGKTET K G+ +G +V
Sbjct: 615 KFEYIGIPERLIYTPLLLIGFATLTDSLHQKYGGCFFGPAGTGKTETVKAFGQNLGRVVV 674
Query: 1461 VFNCSEQMDYRSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSVLDSVKMRKSR 1520
VFNC + DY+ + G+ Q GAWGCF
Sbjct: 675 VFNCDDSFDYQVLSRLLVGITQIGAWGCF------------------------------- 703
Query: 1521 FNFMGESSLAGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSVLDSVKMRKSRFNFMGENI 1580
DEFNR+ +VLS V+ ++ + + +++ KS + E
Sbjct: 704 ---------------------DEFNRLDEKVLSAVSANIQQIQNGLQVGKSHITLLEEET 742
Query: 1581 KLVTTVGMFITMNPGYAGRAELPENLKALFRPCAMVVPDFALICEIMLVSEGFQEARLLS 1640
L +FIT+NPGY GR+ELPENLK FR +M P I E++L GF++++ L+
Sbjct: 743 PLSPHTAVFITLNPGYNGRSELPENLKKSFREFSMKSPQSGTIAEMILQIMGFEDSKSLA 802
Query: 1641 RKFITLYSLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGDRQRPEDQVLMRALRDFNIP 1700
K + L S +HY +GLR +K VL L ++ ++ +L+ +P
Sbjct: 803 SKIVHFLELLSSKCSSMNHYHFGLRTLKGVLRNCSPLIS--EFGEGEKTVVESLKRVILP 860
Query: 1701 KIITEDLQVFMGLIGDLFPALDVPRKRDIDFEKQVRQATIDMKLQPEDSFILKVVQLVEL 1760
+ D VF + +F + P + ++ A + F+ K +Q +
Sbjct: 861 SLGDTDELVFKDELSKIFDSAGTPLNSK-AIVQCLKDAGQRSGFSMSEEFLKKCMQFYYM 919
Query: 1761 FAVRHSVFIIGFAGTGKSCVWKTLYKTYVNAKKKP-MYNDLEPKAVTNDELFGIINPSTR 1819
+ ++ ++G AG GK+ WKT+ + ++ K +T + L+G + +T
Sbjct: 920 QKTQQALILVGKAGCGKTATWKTVIDAMAIFDGHANVVYVIDTKVLTKESLYGSMLKATL 979
Query: 1820 EWKDGLFSCLIREQAQST----GDGPKWMVMDGDIDPMWIESLNTVMDDNKVLTLASNER 1875
EW+DGLF+ ++R + W+V D D+DP ++E++N+V+DDNK+LTL + ER
Sbjct: 980 EWRDGLFTSILRRVNDDITGTFKNSRIWVVFDSDLDPEYVEAMNSVLDDNKILTLPNGER 1039
Query: 1876 IALTPSMRLLFEISNLRTATPATVSRAGILYINPQDLGWNPYVLSWTDTRESESEKNILM 1935
+ + P+ R+LFE NL TPAT++R G+L+ + + + + + + M
Sbjct: 1040 LPIPPNFRILFETDNLDHTTPATITRCGLLWFSTDVCSISSKIDHLLNKSYEALDNKLSM 1099
Query: 1936 GLFDKL 1941
DKL
Sbjct: 1100 FELDKL 1105
|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Length = 2695 | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Length = 2695 | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Length = 2695 | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Length = 2695 | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Length = 2695 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1949 | |||
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 100.0 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 100.0 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 100.0 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 100.0 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 99.47 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 99.35 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 99.29 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 99.27 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 99.2 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 99.16 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 99.12 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 98.94 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 98.93 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 98.89 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 98.62 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 98.33 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 98.32 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 98.3 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 98.29 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 98.28 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 98.24 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 98.24 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 98.19 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 98.17 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 98.15 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 98.14 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 98.13 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 98.12 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 98.08 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 98.07 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 98.07 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 98.05 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 98.05 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 98.03 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 98.03 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 98.02 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 98.01 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 98.01 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 98.0 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 97.99 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 97.97 | |
| 3f8t_A | 506 | Predicted ATPase involved in replication control, | 97.95 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 97.95 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 97.95 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 97.95 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 97.95 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 97.94 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 97.93 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 97.91 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 97.89 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 97.88 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 97.87 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 97.86 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 97.86 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 97.85 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 97.82 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 97.82 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 97.79 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 97.79 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 97.79 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 97.77 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 97.76 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 97.75 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 97.75 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 97.75 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 97.72 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 97.71 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 97.69 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 97.64 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 97.64 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 97.64 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 97.61 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 97.59 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 97.59 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 97.59 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 97.58 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 97.56 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 97.54 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 97.53 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 97.52 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 97.51 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 97.51 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 97.48 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 97.47 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 97.47 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 97.46 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 97.45 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 97.44 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 97.42 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 97.41 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 97.37 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 97.36 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 97.35 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 97.34 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 97.34 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 97.33 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 97.33 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 97.31 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 97.3 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 97.29 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 97.29 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 97.28 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 97.26 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 97.24 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 97.23 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 97.22 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 97.22 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 97.18 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 97.14 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 97.14 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 97.13 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 97.12 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 97.11 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 97.09 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 97.09 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 97.09 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 97.05 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 96.99 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 96.98 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 96.97 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 96.95 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 96.95 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 96.94 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 96.93 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 96.92 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 96.9 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 96.89 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 96.89 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 96.86 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 96.86 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 96.84 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 96.82 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 96.79 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 96.79 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 96.79 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 96.77 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 96.68 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 96.66 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 96.64 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 96.63 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 96.6 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 96.58 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 96.57 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 96.56 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 96.53 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 96.53 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 96.42 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 96.41 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 96.41 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 96.37 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 96.37 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 96.33 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 96.3 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 96.29 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 96.26 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 96.22 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 96.09 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 96.01 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 95.8 | |
| 2dhr_A | 499 | FTSH; AAA+ protein, hexameric Zn metalloprotease, | 95.78 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 95.51 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 95.49 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 95.46 | |
| 3dzd_A | 368 | Transcriptional regulator (NTRC family); sigma43 a | 95.41 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 95.4 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 95.17 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 95.17 | |
| 1ny5_A | 387 | Transcriptional regulator (NTRC family); AAA+ ATPa | 95.03 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 95.01 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 94.88 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 94.85 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 94.76 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 94.57 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 94.44 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 94.36 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 94.3 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 94.25 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 94.24 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 94.06 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 94.06 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 93.98 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 93.95 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 93.93 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 93.93 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 93.82 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 93.77 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 93.73 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 93.68 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 93.62 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 93.56 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 93.53 | |
| 3f8t_A | 506 | Predicted ATPase involved in replication control, | 93.46 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 93.34 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 93.28 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 93.27 | |
| 3gmt_A | 230 | Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucle | 93.26 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 93.23 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 93.22 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 93.21 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 93.13 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 93.02 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 92.96 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 92.92 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 92.89 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 92.88 | |
| 1ltq_A | 301 | Polynucleotide kinase; phosphatase, alpha/beta, P- | 92.86 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 92.84 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 92.77 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 92.76 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 92.76 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 92.76 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 92.74 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 92.72 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 92.69 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 92.65 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 92.63 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 92.61 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 92.61 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 92.52 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 92.46 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 92.45 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 92.4 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 92.39 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 92.35 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 92.31 | |
| 4hlc_A | 205 | DTMP kinase, thymidylate kinase; TMK, MRSA, pipiri | 92.3 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 92.25 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 92.2 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 92.18 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 92.13 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 92.1 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 92.04 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 91.93 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 91.92 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 91.89 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 91.87 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 91.84 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 91.81 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 91.81 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 91.76 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 91.74 | |
| 3sop_A | 270 | Neuronal-specific septin-3; hydrolase; HET: GDP; 2 | 91.73 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 91.73 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 91.71 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 91.7 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 91.65 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 91.64 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 91.63 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 91.63 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 91.62 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 91.61 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 91.57 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 91.53 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 91.51 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 91.43 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 91.4 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 91.31 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 91.3 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 91.3 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 91.26 | |
| 2qm8_A | 337 | GTPase/ATPase; G protein, G3E, metallochaperone, c | 91.25 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 91.25 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 91.25 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 91.24 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 91.23 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 91.23 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 91.22 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 91.2 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 91.19 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 91.14 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 91.1 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 91.04 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 91.01 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 90.92 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 90.91 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 90.87 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 90.87 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 90.86 | |
| 1u5p_A | 216 | Spectrin alpha chain, brain; alpha spectrin, two r | 90.84 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 90.8 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 90.76 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 90.74 | |
| 2j37_W | 504 | Signal recognition particle 54 kDa protein (SRP54) | 90.74 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 90.73 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 90.7 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 90.66 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 90.64 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 90.5 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 90.5 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 90.47 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 90.43 | |
| 3uul_A | 118 | Utrophin; spectrin repeat, structural protein, cyt | 90.39 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 90.33 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 90.16 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 90.14 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 90.12 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 90.07 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 90.06 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 89.97 | |
| 3r20_A | 233 | Cytidylate kinase; structural genomics, seattle st | 89.96 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 89.95 | |
| 2f1r_A | 171 | Molybdopterin-guanine dinucleotide biosynthesis pr | 89.93 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 89.92 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 89.92 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 89.84 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 89.74 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 89.68 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 89.66 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 89.63 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 89.49 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 89.41 | |
| 2onk_A | 240 | Molybdate/tungstate ABC transporter, ATP-binding p | 89.4 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 89.39 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 89.37 | |
| 2ga8_A | 359 | Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn | 89.33 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 89.33 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 89.29 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 89.28 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 89.25 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 89.24 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 89.2 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 89.14 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 89.08 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 89.05 | |
| 3aez_A | 312 | Pantothenate kinase; transferase, homodimer, COA b | 89.01 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 88.97 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 88.94 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 88.92 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 88.85 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 88.85 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 88.81 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 88.79 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 88.67 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 88.66 | |
| 1oix_A | 191 | RAS-related protein RAB-11A; small G protein, intr | 88.66 | |
| 2p67_A | 341 | LAO/AO transport system kinase; ARGK, structural G | 88.63 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 88.59 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 88.58 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 88.49 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 88.44 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 88.44 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 88.42 | |
| 2www_A | 349 | Methylmalonic aciduria type A protein, mitochondri | 88.4 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 88.35 | |
| 1tq4_A | 413 | IIGP1, interferon-inducible GTPase; interferon gam | 88.34 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 88.31 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 88.29 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 88.29 | |
| 2olj_A | 263 | Amino acid ABC transporter; ABC domain, ATPase, hy | 88.28 | |
| 3fvq_A | 359 | Fe(3+) IONS import ATP-binding protein FBPC; nucle | 88.28 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 88.24 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 88.23 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 88.22 | |
| 2jeo_A | 245 | Uridine-cytidine kinase 1; UCK, transferase, ATP-b | 88.22 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 88.21 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 88.18 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 88.17 | |
| 2f9l_A | 199 | RAB11B, member RAS oncogene family; RAB11B GTPase, | 88.05 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 88.05 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 88.03 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 87.99 | |
| 2ixe_A | 271 | Antigen peptide transporter 1; ABC ATPase, hydrola | 87.9 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 87.89 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 87.84 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 87.77 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 87.74 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 87.65 | |
| 2yv5_A | 302 | YJEQ protein; hydrolase, GTPase, permutation, stru | 87.58 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 87.52 | |
| 1odf_A | 290 | YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser | 87.52 | |
| 1z47_A | 355 | CYSA, putative ABC-transporter ATP-binding protein | 87.47 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 87.46 | |
| 2ihy_A | 279 | ABC transporter, ATP-binding protein; ATPase, ABC | 87.45 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 87.42 | |
| 3rlf_A | 381 | Maltose/maltodextrin import ATP-binding protein M; | 87.4 | |
| 2nq2_C | 253 | Hypothetical ABC transporter ATP-binding protein H | 87.4 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 87.33 | |
| 2yz2_A | 266 | Putative ABC transporter ATP-binding protein TM_0; | 87.3 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 87.27 | |
| 2it1_A | 362 | 362AA long hypothetical maltose/maltodextrin trans | 87.23 | |
| 2yyz_A | 359 | Sugar ABC transporter, ATP-binding protein; sugar | 87.22 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 87.2 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 87.19 | |
| 2wji_A | 165 | Ferrous iron transport protein B homolog; membrane | 87.11 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 87.09 | |
| 1s35_A | 214 | Beta-I spectrin, spectrin beta chain, erythrocyte; | 87.0 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 86.95 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 86.92 | |
| 1z2a_A | 168 | RAS-related protein RAB-23; RAB GTPase, vesicular | 86.86 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 86.85 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 86.85 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 86.85 | |
| 1v43_A | 372 | Sugar-binding transport ATP-binding protein; ATPas | 86.81 | |
| 2dyk_A | 161 | GTP-binding protein; GTPase, ribosome-binding prot | 86.79 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 86.79 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 86.73 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 86.7 | |
| 1sq5_A | 308 | Pantothenate kinase; P-loop, transferase; HET: PAU | 86.68 | |
| 3ake_A | 208 | Cytidylate kinase; CMP kinase, CMP complex, open c | 86.67 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 86.67 | |
| 2ce2_X | 166 | GTPase HRAS; signaling protein, guanine nucleotide | 86.65 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 86.63 | |
| 1g29_1 | 372 | MALK, maltose transport protein MALK; ATPase, acti | 86.61 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 86.56 | |
| 2zej_A | 184 | Dardarin, leucine-rich repeat kinase 2; parkinson' | 86.56 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 86.38 | |
| 1kao_A | 167 | RAP2A; GTP-binding protein, small G protein, GDP, | 86.35 | |
| 2qag_B | 427 | Septin-6, protein NEDD5; cell cycle, cell division | 86.3 | |
| 3gd7_A | 390 | Fusion complex of cystic fibrosis transmembrane co | 86.29 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 86.27 | |
| 1uj2_A | 252 | Uridine-cytidine kinase 2; alpha/beta mononucleoti | 86.23 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 86.23 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 86.21 | |
| 3uun_A | 119 | Dystrophin; triple helical, cell structure and sta | 86.21 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 86.19 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 86.15 | |
| 1u4q_A | 322 | Spectrin alpha chain, brain; alpha spectrin, three | 86.12 | |
| 2qen_A | 350 | Walker-type ATPase; unknown function; HET: ADP; 2. | 85.96 | |
| 1g16_A | 170 | RAS-related protein SEC4; G protein RAB, signaling | 85.96 | |
| 3d31_A | 348 | Sulfate/molybdate ABC transporter, ATP-binding pro | 85.95 | |
| 2gj8_A | 172 | MNME, tRNA modification GTPase TRME; G-domain dime | 85.93 | |
| 2ged_A | 193 | SR-beta, signal recognition particle receptor beta | 85.92 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 85.92 | |
| 2bbs_A | 290 | Cystic fibrosis transmembrane conductance regulato | 85.91 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 85.91 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 85.88 | |
| 3nh6_A | 306 | ATP-binding cassette SUB-family B member 6, mitoc; | 85.83 | |
| 3ice_A | 422 | Transcription termination factor RHO; transcriptio | 85.79 | |
| 1wms_A | 177 | RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p | 85.76 | |
| 1ek0_A | 170 | Protein (GTP-binding protein YPT51); vesicular tra | 85.73 | |
| 1u8z_A | 168 | RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH | 85.71 | |
| 1z0j_A | 170 | RAB-22, RAS-related protein RAB-22A; RAB GTPase, R | 85.68 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 85.55 | |
| 1z08_A | 170 | RAS-related protein RAB-21; RAB GTPase, vesicular | 85.55 | |
| 1c1y_A | 167 | RAS-related protein RAP-1A; GTP-binding proteins, | 85.51 | |
| 1zj6_A | 187 | ADP-ribosylation factor-like protein 5; ARL, GTP-b | 85.48 | |
| 2nzj_A | 175 | GTP-binding protein REM 1; GDP/GTP binding, GTP hy | 85.47 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 85.43 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 85.43 | |
| 3tui_C | 366 | Methionine import ATP-binding protein METN; ABC-tr | 85.38 | |
| 2erx_A | 172 | GTP-binding protein DI-RAS2; GTP hydrolysis, trans | 85.34 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 85.34 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 85.29 | |
| 3q72_A | 166 | GTP-binding protein RAD; G-domain, CAV2 beta, sign | 85.29 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 85.24 | |
| 2npi_A | 460 | Protein CLP1; CLP1-PCF11 complex, ATP binding, ter | 85.16 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 85.15 | |
| 1ky3_A | 182 | GTP-binding protein YPT7P; vesicular traffic, GTP | 85.13 | |
| 1lw7_A | 365 | Transcriptional regulator NADR; NMN, NMN adenylyl | 85.12 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 85.05 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 85.05 | |
| 3q85_A | 169 | GTP-binding protein REM 2; G-domain, CAV2 beta, si | 85.03 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 85.02 | |
| 2wjg_A | 188 | FEOB, ferrous iron transport protein B homolog; me | 85.01 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 85.0 | |
| 2fn4_A | 181 | P23, RAS-related protein R-RAS; GDP/GTP binding, G | 84.95 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 84.91 | |
| 2qnr_A | 301 | Septin-2, protein NEDD5; structural genomics conso | 84.89 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 84.87 | |
| 2rcn_A | 358 | Probable GTPase ENGC; YJEQ, circularly permuted, G | 84.82 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 84.8 | |
| 1r2q_A | 170 | RAS-related protein RAB-5A; GTPase, GNP, atomic re | 84.76 | |
| 2f6r_A | 281 | COA synthase, bifunctional coenzyme A synthase; 18 | 84.75 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 84.67 | |
| 1nrj_B | 218 | SR-beta, signal recognition particle receptor beta | 84.63 | |
| 3p32_A | 355 | Probable GTPase RV1496/MT1543; structural genomics | 84.61 | |
| 3cr8_A | 552 | Sulfate adenylyltranferase, adenylylsulfate kinase | 84.6 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 84.59 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 84.53 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 84.48 | |
| 2y8e_A | 179 | RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti | 84.47 | |
| 1oxx_K | 353 | GLCV, glucose, ABC transporter, ATP binding protei | 84.47 | |
| 1svi_A | 195 | GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro | 84.4 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 84.38 | |
| 1m2o_B | 190 | GTP-binding protein SAR1, GTP binding protein; zin | 84.36 | |
| 1r8s_A | 164 | ADP-ribosylation factor 1; protein transport/excha | 84.35 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 84.31 | |
| 1q3t_A | 236 | Cytidylate kinase; nucleotide monophosphate kinase | 84.28 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 84.25 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 84.25 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 84.25 | |
| 4dsu_A | 189 | GTPase KRAS, isoform 2B; small G-protein, signalin | 84.19 | |
| 1upt_A | 171 | ARL1, ADP-ribosylation factor-like protein 1; hydr | 84.19 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 84.11 | |
| 1m7b_A | 184 | RND3/RHOE small GTP-binding protein; small GTPase, | 84.11 | |
| 3bc1_A | 195 | RAS-related protein RAB-27A; RAB27, GTPase, RAB, s | 84.09 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 84.07 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 84.05 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 83.99 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 83.97 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 83.96 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 83.95 | |
| 2oil_A | 193 | CATX-8, RAS-related protein RAB-25; G-protein, GDP | 83.94 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 83.94 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 83.93 | |
| 1pui_A | 210 | ENGB, probable GTP-binding protein ENGB; structura | 83.91 | |
| 2cxx_A | 190 | Probable GTP-binding protein ENGB; structural geno | 83.84 | |
| 2hxs_A | 178 | RAB-26, RAS-related protein RAB-28; GTPase, signal | 83.83 | |
| 2lkc_A | 178 | Translation initiation factor IF-2; NMR {Geobacill | 83.83 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 83.8 |
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=6.2e-168 Score=1795.41 Aligned_cols=1012 Identities=31% Similarity=0.528 Sum_probs=845.3
Q ss_pred hhhHHHHHHHHhhhhcCCccccccccCCCCcccccccccccccccchhHHHhhcCCCCCCCcchhhhhhHhhhhccccCC
Q psy2654 293 ENMEEEQTMVEEKESVAPTAEQEEDDGGDNFDRDESVDLDMDKKSDEDDERKKLLKPPSDEPIDMDVYGAASEMGSEAAP 372 (1949)
Q Consensus 293 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~ 372 (1949)
..+..+.+.+..+..+|..+...+. .-+.|+...|.+++.+.++...+...+..+.+......+++
T Consensus 22 ~~l~~~~~el~~l~~~w~~~~~~~~-~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~------------- 87 (3245)
T 3vkg_A 22 GGKVPVEEEIQDLKAVWVELSNTWQ-EIDSLKETAWSAIIPRKVRKSLEDTLQKLKNLPNRIRQYSA------------- 87 (3245)
T ss_dssp --------------------------CHHHHHHCCTTTCCC-------------------------C-------------
T ss_pred ccHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHhCChhhcCHHHHHHHHHHHHHHHHhCcchhhhhHH-------------
Confidence 4445555555566666655533332 22224445555666666554444333333333333333333
Q ss_pred CchhhhchhhhhhhhchhhhhhhcCCCChhhhhhhhHHHHHHHHhHhHHHhhccccccCCCCCCCcEEEEEEecCCCeee
Q psy2654 373 LPDILEHTEVADIGENEDDALSAVPGMPDEFDQESSSQNLKLTSRVHLVYITDEMCHTDFSNKAPLFRVSFSLEEPDLVF 452 (1949)
Q Consensus 373 l~~~~~~~~~~~~~~~~~~~l~~i~~l~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~l~~~~~~~ 452 (1949)
+..+...++.+...++.+..|.++.++.|||..++...+.. +
T Consensus 88 ------~~~l~~~i~~f~~~lpll~~L~n~~~~~RHW~~l~~~~g~~--------------------------------~ 129 (3245)
T 3vkg_A 88 ------FDHAQNLIKIYLKGNAIITDLHSEAIKDRHWKILKKRLNTN--------------------------------W 129 (3245)
T ss_dssp ------HHHHHHHHHHHHHHTHHHHHTTSTTCCHHHHHHHHHHTTCC--------------------------------C
T ss_pred ------HHHHHHHHHHHHHHhHHHHHhCCccccHHHHHHHHHHhCCC--------------------------------C
Confidence 34455666777777788888888888888888887553320 1
Q ss_pred ccCCCCCchhhHhhHHHHHHHHHHHHHHHhhhhhhhhhhhHHHHhhccceeeEeeeccccCccccccHHHHHHHHHHHHH
Q psy2654 453 TPTLNFNDEAEEESLCSQLKEIIEDITDMGVKIKRVAKRTENTYKVWSTLEFEYDIHARTKTPLLRCSEELIEMLEENQV 532 (1949)
Q Consensus 453 ~~~~~~~~~~~~~~~~~~~~~~i~~i~~~A~~e~~ie~~l~~~~~~w~~~~f~~~~~~~~~~~~l~~~~ei~~~led~~~ 532 (1949)
.+. +++++.+++..+..+.+.|++|+..|++|..||+.|++|.+.|+.++|++.+|+ ++..+++++|+|++.|+||++
T Consensus 130 ~~~-~~tL~~ll~~~l~~~~~~i~~I~~~A~~E~~iE~~L~~i~~~W~~~~f~~~~~~-~~~~ll~~~dei~~~led~~~ 207 (3245)
T 3vkg_A 130 IIT-ELTLGSIWDSDLARNENIYREVITAAQGEIALEEFLKGVREFWTTLELDLVNYQ-RKCKLVRGWDDLFNKLAEHLN 207 (3245)
T ss_dssp CTT-SCCHHHHHHSCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCBCEEEEET-TTEEEEECHHHHHHHHHHHHH
T ss_pred Ccc-CCCHHHHHhccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhceEEEEEecc-CCeeEeCCHHHHHHHHHHHHH
Confidence 122 588999999999999999999999999999999999999999999999999996 467889999999999999999
Q ss_pred HHHhhhcCcchhhHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHhhhhhcCcHHHHHhhhhhhhhhhhhhHHHHHHHHHH
Q psy2654 533 QLQNMASSKFVGYFQKEVNEWQIKLSNADAVISIWIEVQRTWQHLESIFIGSDDIRQQLPEDSRRFDATDKAFRALAQDM 612 (1949)
Q Consensus 533 ~l~~m~~s~~~~~f~~~v~~w~~~L~~~~~il~~w~~vQ~~W~~Le~iF~~s~di~~~Lp~e~~~F~~vd~~~~~i~~~~ 612 (1949)
.+++|++|+|+++|+++|..|+++|..+.++++.|.+||++|+|||+||.+++||++|||.|+++|+.||+.|+.+|+++
T Consensus 208 ~l~sm~~S~~~~~f~~~v~~We~~L~~~~~il~~W~~vQ~~W~yLe~IF~~s~DI~~qLP~E~~rF~~vd~~~~~im~~~ 287 (3245)
T 3vkg_A 208 SISAMKMSPYYKVFEEEANHWDDRLNKVRSLLDVWIDVQRRWVYLEGIFSGSGDINQLLPAESTRFKSINSEFIAILKKV 287 (3245)
T ss_dssp HHHHTTSSTTTTGGGGHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-----CTTTSHHHHHHHHHHHHHHHHHHHHH
T ss_pred HHHHHhcCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcCcHHHHHHhHHHHHHHHHHHHHHHHHHHHH
Confidence 99999999999999999999999999999999999999999999999998889999999999999999999999999999
Q ss_pred hcCCceeEeccCcchHHHHHHHHHHHHHHHHHHHHHHHhhccccCccccCChhhHHHHHhcCCCCCccCCCCCCchh---
Q psy2654 613 HKTPNVVIGTNKPGLYEKLETIQKDLTKCEKALAQYLETKKLTYPRFYFVSSSDLLDILANGNNPEAFRPGKDGKIN--- 689 (1949)
Q Consensus 613 ~~~p~v~~~~~~~~~~~~L~~~~~~L~~~~k~L~~yLe~kR~~FPRfyFlS~~dlL~ils~~~~p~~~~~~~~~~~~--- 689 (1949)
.++|+|+.+|+.+++++.|+++++.|+.|||+|++|||+||..|||||||||+|||+|||+++||..+|+|...++.
T Consensus 288 ~~~~~v~~~~~~~~~~~~L~~~~~~Le~iqk~L~~yLE~KR~~FPRFyFlSd~eLLeILs~~~dp~~vq~hl~K~F~~I~ 367 (3245)
T 3vkg_A 288 SGAPLILEVLAIERIQQTMERLSDLLGKVQKALGEYLERQRSAFARFYFVGDEDLLEIIGNSKDIIKIQKHFRKMFAGLA 367 (3245)
T ss_dssp HHSCBHHHHTTSTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHTSGGGGGSCHHHHHHHHHGGGCGGGTGGGGGGTCSSCC
T ss_pred hcCCceEeecCcccHHHHHHHHHHHHHHHHHHHHHHHHHHHhhCchhhccCcHHHHHHHHcCCChHHHHHHHHHHHhhhh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999754332
Q ss_pred -------HHHHHhHhhhcCCccccCCCCCc--cchhhHHHHHHHH-HHHHHHHHHHHHhhhcCCCCChHHHHHHHHHHHH
Q psy2654 690 -------VKIAQGMYAKDGEYVEFNGDCDC--SGQANKASTEMIE-MEDVLNKLMEQAALFEINKPDFKALANARKDLKM 759 (1949)
Q Consensus 690 -------~~~~~~~~s~~ge~v~~~~~~~~--~~~~~~~~~~~~~-~~~~~~~l~~~~~l~~~~~~~~~~l~~~~~el~~ 759 (1949)
...+.||+|.+||.|+|..|+.+ .+.++.|+..+.. |...++.+.+.+.
T Consensus 368 ~l~f~~~~~~i~~m~S~eGE~v~~~~~v~~~~~~~ve~WL~~le~~m~~tl~~~~~~~~--------------------- 426 (3245)
T 3vkg_A 368 NLTLDDEKTTIIGMSSAEGETVTFKKPISIANGPKIHEWLTMVESEMKSTLATLLSESL--------------------- 426 (3245)
T ss_dssp EEEECTTSCEEEEEECTTSCEEEEEEEEESSSSCCHHHHHHHHHHHHHHHHHHHHHHHH---------------------
T ss_pred eEEecCCCCEEEEEEcCCCCEEEeCCccccCCCCCHHHHHHHHHHHHHHHHHHHHHHHH---------------------
Confidence 12356999999999999999843 5789998877643 4444433221110
Q ss_pred HHHHHHHHHHHHHHHHHHhhhhhcccCHHHHHHHHHHHHHHHhhhhcccchhHHHHHHHHHHHHHHHHhHHHHhhcChhh
Q psy2654 760 AKLIWDYILVIQGWMLDWKETLWKKIDSEAMDMELKKFTKELRTLDKDLRNWDIFLQLESEIKNMIAALKAVTELQNPAI 839 (1949)
Q Consensus 760 ~~~lw~~~~~~~~~~~~w~~~~w~~id~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~~~~lp~i~~l~~~~~ 839 (1949)
..+. .+. ..+..
T Consensus 427 ---------------~~~~------------------------~~~-----------------------------~~~~~ 438 (3245)
T 3vkg_A 427 ---------------QHFN------------------------QVD-----------------------------VNDHS 438 (3245)
T ss_dssp ---------------HHHT------------------------SCC-----------------------------TTCHH
T ss_pred ---------------HHHh------------------------hcc-----------------------------ccCcc
Confidence 0000 000 00000
Q ss_pred hhhHHHHHHHhhceeeecCCcccHHHHHhhhhhhhHHHHHHHHHHHHHhHHHHHHHHHHHHhhcceEEEEEeeccccccc
Q psy2654 840 RDRHWEELMSVTKVKFSIDDSTTLKDLLDLELYKFEEEVKTIVDKSVKEQQMEKVLKDFDKVWSTLEFEYDIHARTKTPL 919 (1949)
Q Consensus 840 r~rhW~~l~~~~~~~~~~~~~~tl~~ll~l~l~~~~~~i~~i~~~a~~E~~ie~~L~~~~~~W~~~~f~~~~~~~~~~~l 919 (1949)
....| +..|+.++..++.+..+...+|.++.+... .
T Consensus 439 ~~~~w--------------------------~~~~p~Qv~l~~~qi~wT~~ve~al~~~~~----------------~-- 474 (3245)
T 3vkg_A 439 KYSEW--------------------------VDNYPTQLVLLTSQIVWSTQVDQALGGGTL----------------Q-- 474 (3245)
T ss_dssp HHHHH--------------------------HHTSCHHHHHHHHHHHHHHHHHHHHTTSCS----------------C--
T ss_pred cHHHH--------------------------HHHCcHHHHHHHHHheeHHHHHHHHHhccc----------------c--
Confidence 11122 456788888889999999999998853210 0
Q ss_pred ccChHHHHHHHHHHHHHHHHHHHHHHhcccchHHHHHHHHHHHHHHHHHHHHHHHHH-hhcccchhhHHHhhhhhccccc
Q psy2654 920 LRCSEELIEMLEENQINQLNALIVLLLGELTVGDRQKIMTICTIDVHSRDVVAKLIL-QKIESSGAFMWQSQLRHRWDKE 998 (1949)
Q Consensus 920 l~~~~~~~~~l~~~~~~~l~~l~~~~~~~l~~~~~~k~~~li~~~~~~rd~~~~l~~-~~i~~~~~f~W~~qlr~~~~~~ 998 (1949)
-.+....++.+.+.+..+++.++..+++++++..|.++.++|+++||+||+++.|+. .+|.+..+|+|++||||||+++
T Consensus 475 ~~~~~~~l~~~~~~~~~~l~~l~~~v~~~l~~~~R~kl~~Lit~~VH~RDvv~~L~~~~~v~~~~dF~W~~qlRyy~~~~ 554 (3245)
T 3vkg_A 475 QSKIQEQLQSIEQTTQMILNNLADSVLQDLSAQKRKKFEHLITELVHQRDVVRQLQKCKNLTGNKDFDWLYHMRYYYDAT 554 (3245)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHTTSCCCHHHHHHHHHHHHHHHHHHHHHHHHHTCCSCCSTTCHHHHTSEEEEECSS
T ss_pred ccchHHHHHHHHHHHHHHHHHHHHHHhcCCCHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCCCcchhHHHhhhheeeccc
Confidence 001234567778888899999999999999999999999999999999999999999 9999999999999999999754
Q ss_pred cccchhccchhhhcccccccccCCcceecCchhhHHHHHHHHHHHhcCCCCCCCCCCCcchhHHHHHHhhcceEEEeeCC
Q psy2654 999 VGDCFANICDAEFKFDHEYLGCTPRLVITPLTDRCYITLSQSLHLNMGGAPAGPAGTGKTETTKDLGKAIGIMVYVFNCS 1078 (1949)
Q Consensus 999 ~~~~~i~~~~~~~~y~~Ey~g~~~rlv~tp~~~r~~~~l~~al~~~~~~~~~gp~gtGKt~~~~~la~~lg~~~~~~~~~ 1078 (1949)
..++
T Consensus 555 ~~~~---------------------------------------------------------------------------- 558 (3245)
T 3vkg_A 555 QENV---------------------------------------------------------------------------- 558 (3245)
T ss_dssp SSSS----------------------------------------------------------------------------
T ss_pred cCCc----------------------------------------------------------------------------
Confidence 2100
Q ss_pred ccchhhhccccchhhcccCccccccccccchhhHHHHHHHHHHHHHHHHhhhccccccccCccccccccceeeecCCCCC
Q psy2654 1079 EQMDYRSCGNIYKGLAQTGAWGCFDEFNRISVEVLSVVAVQVKSVLDSVKMRKSRFNFMGENIKLVTTVGMFITMNPGYA 1158 (1949)
Q Consensus 1079 ~~~~~~~~~~~~~g~~~~g~w~~fde~~~l~~~~Ls~i~~~l~~~~~~~r~~~~rf~f~~~~i~l~~~~~~f~t~n~~~~ 1158 (1949)
T Consensus 559 -------------------------------------------------------------------------------- 558 (3245)
T 3vkg_A 559 -------------------------------------------------------------------------------- 558 (3245)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred CCCCCchhHhhhccccccccCchhHHHHHhhhccchhhhhhhhhhHHHHhhhhhhhcccccccccccchhhheeeecccc
Q psy2654 1159 GRAELPENLKALFRPCAMVVPDFALICEIMLVSEGFQEARLLSRKFITLYSLCKELLSKQDHYDWGLRAIKSVLVVAGSL 1238 (1949)
Q Consensus 1159 ~~~~lp~~l~~~fr~i~~~~pd~~~i~~~~l~~~g~~~~~~l~~kl~~~~~~~~~~~s~~~~~~~glr~~~~v~~~~g~v 1238 (1949)
T Consensus 559 -------------------------------------------------------------------------------- 558 (3245)
T 3vkg_A 559 -------------------------------------------------------------------------------- 558 (3245)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred cccchhhHHHHHHhHHHHHHHHHHhhcCCCchhhhhcCCcchhhhcchhhhhhHHHHHHHHHHHHHHHHHHHhccceEEE
Q psy2654 1239 KNWLNNVTDSMRRTGIHCMSLAVAAYDEKPREQWLFDYPGQTALCGTQIWWTTEVSICFARLEEGYENALKDYNKKQFII 1318 (1949)
Q Consensus 1239 ~~wl~~l~~~m~~tl~~~~~~~~~~~~~~~~~~w~~~~p~Qv~l~~~qi~wt~~i~~~~~~~~~~~~~~l~~~~~~~~lv 1318 (1949)
T Consensus 559 -------------------------------------------------------------------------------- 558 (3245)
T 3vkg_A 559 -------------------------------------------------------------------------------- 558 (3245)
T ss_dssp --------------------------------------------------------------------------------
T ss_pred --------------------------------------------------------------------------------
Confidence
Q ss_pred eccCCCchHHHHHHHHHHHhccCCCcccccccccccccchhcccccccceeecCccccCCccccccccCcceEeecccee
Q psy2654 1319 GFAGTGKSCVWKTLYKTYVNAKKKPMYNDLEPKAVTNDELFGIINPSTREWKDGRYSDSGFLSYGSLLGDCFANICDAEF 1398 (1949)
Q Consensus 1319 ~~~~~gk~~~~~~l~~~~~~~~~~~~~~~l~~~~~~~~~l~~~~~~~~~~w~d~~~~~~~~~~~~~~~~~~~v~~~~~~~ 1398 (1949)
.+.|.|+|++++|
T Consensus 559 -------------------------------------------------------------------~~~~~v~~~~~~f 571 (3245)
T 3vkg_A 559 -------------------------------------------------------------------LHKLVIHMANATF 571 (3245)
T ss_dssp -------------------------------------------------------------------GGGEEEEETTEEE
T ss_pred -------------------------------------------------------------------CceEEEEEcCcee
Confidence 1247899999999
Q ss_pred ccccccccCCCCccccccchHHHHHHHHHHHhccCCCCCCCCCCChhHHHHHHHHHhcceEEEEeCCCCCCHhhhhhhcc
Q psy2654 1399 KFDHEYLGCTPRLVITPLTDRCYITLSQSLHLNMGGAPAGPAGTGKTETTKDLGKAIGIMVYVFNCSEQMDYRSCGNIYK 1478 (1949)
Q Consensus 1399 ~y~~ey~g~~~~~v~t~~t~r~~~~l~~al~~~~~~~l~G~~g~GKt~~v~~la~~lg~~~~~~n~~~~~~~~~l~~~~~ 1478 (1949)
+|||||+|+++|+|+||+|||||.++++|++.+.||++.||+|||||+++++||+++|++|++|||++++|++.|+++|.
T Consensus 572 ~YgyEYlG~~~rLViTPLTdrcy~tl~~Al~~~~gg~~~GPaGtGKTet~k~La~~lgr~~~vfnC~~~~d~~~~g~i~~ 651 (3245)
T 3vkg_A 572 YYGFEYLGIGERLVQTPLTDRCYLTLTQALESRMGGNPFGPAGTGKTETVKALGSQLGRFVLVFCCDEGFDLQAMSRIFV 651 (3245)
T ss_dssp ECCCCCCCSCCCCCCCHHHHHHHHHHHHHHHTTCEEEEECSTTSSHHHHHHHHHHHTTCCEEEEECSSCCCHHHHHHHHH
T ss_pred cCccccCCCCCCCcCChHHHHHHHHHHHHHHhcCCCCCCCCCCCCHHHHHHHHHHHhCCeEEEEeCCCCCCHHHHHHHHh
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred cccccCccccccccccccchhhHHHHHHHHHHHHHHHhhhccccccccchhhhhcccCCCcccccccccchhhHHHHHHH
Q psy2654 1479 GLAQTGAWGCFDEFNRISVEVLSVVAVQVKSVLDSVKMRKSRFNFMGESSLAGLAQTGAWGCFDEFNRISVEVLSVVAVQ 1558 (1949)
Q Consensus 1479 g~~~~g~w~~~de~~~l~~~~ls~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~g~w~~~de~n~~~~~~l~~~~~~ 1558 (1949)
|++++|+|+|||||||++.++||++++++..|+.+++.
T Consensus 652 G~~~~GaW~cfDEfNrl~~~vLSvv~~qi~~I~~a~~~------------------------------------------ 689 (3245)
T 3vkg_A 652 GLCQCGAWGCFDEFNRLEERILSAVSQQIQTIQVALKE------------------------------------------ 689 (3245)
T ss_dssp HHHHHTCEEEEETTTSSCHHHHHHHHHHHHHHHHHHHH------------------------------------------
T ss_pred hHhhcCcEEEehhhhcCCHHHHHHHHHHHHHHHHHHHc------------------------------------------
Confidence 99999999999999999999999999998888776553
Q ss_pred HHhHhhhhhhccccceec-cceEEEecCeeEEEEeCCCCCCCCCChhhHhhcccccccccCCHHHHHHHHHhhhchhhHH
Q psy2654 1559 VKSVLDSVKMRKSRFNFM-GENIKLVTTVGMFITMNPGYAGRAELPENLKALFRPCAMVVPDFALICEIMLVSEGFQEAR 1637 (1949)
Q Consensus 1559 ~~~~~~~l~~~~~~~~~~-~~~i~~~~~~~~f~tmnp~~~g~~~LP~~lk~~fr~v~~~~pD~~~i~e~~L~~~gf~~~~ 1637 (1949)
...++.|. |.+|+++|+|++|+||||||+||++||+|||++||||+|+.||...|+|++|++.||.+++
T Consensus 690 ----------~~~~~~~~~G~~i~l~~~~~vfiTmNpgY~gr~eLP~nLk~lFr~v~m~~Pd~~~i~ei~L~s~Gf~~a~ 759 (3245)
T 3vkg_A 690 ----------NSKEVELLGGKNISLHQDMGIFVTMNPGYAGRSNLPDNLKKLFRSMAMIKPDREMIAQVMLYSQGFKTAE 759 (3245)
T ss_dssp ----------TCSEECCC---CEECCTTCEEEECBCCCGGGCCCSCHHHHTTEEEEECCSCCHHHHHHHHHHTTTCSCHH
T ss_pred ----------CCCeEEecCCCEEeecCCeEEEEEeCCCccCcccChHHHHhhcEEEEEeCCCHHHHHHHHHHHcccchHH
Confidence 34556666 8899999999999999999999999999999999999999999999999999999999999
Q ss_pred HHHHHHHHHHHHHHHHhcCCCCCCCchhhHHHHHHhhcccccCC--------CC------------CcHHHHHHHHHhhh
Q psy2654 1638 LLSRKFITLYSLCKELLSKQDHYDWGLRAIKSVLVVAGSLKRGD--------RQ------------RPEDQVLMRALRDF 1697 (1949)
Q Consensus 1638 ~la~k~~~~~~~~~~~~s~~~~~~~~lr~l~~vl~~a~~~~~~~--------~~------------~~e~~~l~~a~~~~ 1697 (1949)
.||+|++.+|++|++++|+|.|||||||++|+||+.||.++|.. ++ .+|+.++++|++++
T Consensus 760 ~La~k~~~~~~l~~e~LS~Q~HYDfGLRalKsVL~~AG~lkr~~~~~~~~~~~~~~~~~~~~~~~~~~E~~illralrd~ 839 (3245)
T 3vkg_A 760 VLAGKIVPLFKLCQEQLSAQSHYDFGLRALKSVLVSAGGIKRKCQPPQLPPITDAESKTKADQIYCQYEIGVLLNSINDT 839 (3245)
T ss_dssp HHHHHHHHHHHHHHHSSCCCTTCCCSHHHHHHHHHHHHHHHHSCCCC------CHHHHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred HHHHHHHHHHHHHHHHhCCCCCCCCChHHHHHHHHHHHHHHHhhhhhcccccccccccccccccccccHHHHHHHHHHHh
Confidence 99999999999999999999999999999999999999999987 44 46889999999999
Q ss_pred cCCCCCcccHHHHHHhHhccCCCCCCCCCCchhHHHHHHHHHHhcCCCcChHHHHHHHHHHHHHhcCcEEEEEecCCCCh
Q psy2654 1698 NIPKIITEDLQVFMGLIGDLFPALDVPRKRDIDFEKQVRQATIDMKLQPEDSFILKVVQLVELFAVRHSVFIIGFAGTGK 1777 (1949)
Q Consensus 1698 ~~~~l~~~d~~~~~~l~~~~fp~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~k~~~l~~~l~~~~~vll~G~~gsGK 1777 (1949)
++|+|+.+|.++|.+|+.|+||++..|..++..+.+++.++|.+.+|++++.|+.|++|||+++.+||||||||||||||
T Consensus 840 nlpKl~~~D~plF~~li~DlFPgv~~~~~~~~~l~~ai~~~~~~~~L~~~~~~v~KviQLye~~~vRhGvmlVGp~gsGK 919 (3245)
T 3vkg_A 840 MIPKLVADDIPLIQSLLLDVFPGSQLQPIQMDQLRKKIQEIAKQRHLVTKQEWVEKILQLHQILNINHGVMMVGPSGGGK 919 (3245)
T ss_dssp TTTTSCGGGHHHHHHHHHHHSTTCCCCCCCCHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHHHTTCSEEEEECSSSSSH
T ss_pred ccCCCchhhHHHHHHHHHHhCCCCCCCCCchHHHHHHHHHHHHHcCCccCHHHHHHHHHHHHHHHheeeEEEECCCCCCH
Confidence 99999999999999999999999999999999999999999999999999999999999999999999999999999999
Q ss_pred hHHHHHHHHHHHhccC-CCcccccCCCccCcccccccccCCCCCcccChHHHHHHHHhhcC---CCCCcEEEEcCCCCcc
Q psy2654 1778 SCVWKTLYKTYVNAKK-KPMYNDLEPKAVTNDELFGIINPSTREWKDGLFSCLIREQAQST---GDGPKWMVMDGDIDPM 1853 (1949)
Q Consensus 1778 Tt~~~~La~~~~~~~~-~~~~~~i~p~~~~~~el~G~~~~~~~~w~dG~l~~~~r~~~~~~---~~~~~Wiv~Dg~~d~~ 1853 (1949)
||+|++|++|+++..+ ....+++||||+|.++|||.+|+.|+||+||+|++++|+.+... ...++|||||||+||.
T Consensus 920 Tt~~~~L~~al~~l~~~~~~~~~iNPKait~~eLyG~~d~~T~EW~DGvls~i~R~~~~~~~~~~~~~~WIvfDGpVDa~ 999 (3245)
T 3vkg_A 920 TTSWEVYLEAIEQVDNIKSEAHVMDPKAITKDQLFGSLDLTTREWTDGLFTATLRRIIDNVRGESTKRHWIIFDGDVDPE 999 (3245)
T ss_dssp HHHHHHHHHHHTTTTTCEEEEEEECTTTSCHHHHHEEECTTTCCEEECHHHHHHHHHHTTSSSGGGEEEEEEEESCCCHH
T ss_pred HHHHHHHHHHHHHhhCCCceEEEECCCCCchhhhceeecCCCCeeeccHHHHHHHHHHhcccCCCCCceEEEECCCCCHH
Confidence 9999999999987643 45677899999999999999999999999999999999987532 3456899999999999
Q ss_pred chhhHHhhhcCCcceeccCCceeecCCCceEEEEeCCCCCCChhhhccceEEEecCCCCCchhhHHhhhccCC
Q psy2654 1854 WIESLNTVMDDNKVLTLASNERIALTPSMRLLFEISNLRTATPATVSRAGILYINPQDLGWNPYVLSWTDTRE 1926 (1949)
Q Consensus 1854 w~e~ln~~lddn~~l~l~~ge~i~~~~~~~~ifE~~~l~~asPa~vsr~~~v~~~~~~~~w~~~~~~w~~~~~ 1926 (1949)
|||+|||||||||.|||||||||++||+||+||||+||++||||||||||||||+++++||+|++.||+++++
T Consensus 1000 WIEnlNsVLDDNK~LtL~nGErI~l~~~~~liFEv~dL~~ASPATVSRcGmVy~~~~~l~~~~~~~swl~~~~ 1072 (3245)
T 3vkg_A 1000 WVENLNSLLDDNKLLTLPNGERLALPNNVRVMFEVQDLKYATLATISRCGMVWFSEEILTTQMIFQNYLDTLS 1072 (3245)
T ss_dssp HHTTTHHHHSSSCEECCTTSCCEECCTTEEEEEEESCCTTCCHHHHHTSEEEECCTTSSCHHHHHHHHHHHHT
T ss_pred HHHHHHHHhcCCCeeecCCCCeeecCCCCEEEEEeccccccChhhheeeeEEEEcccccCchHHHHHHHHhCc
Confidence 9999999999999999999999999999999999999999999999999999999999999999999998643
|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, DIM transcription; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 3m0e_A* 1zy2_A* | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3f8t_A Predicted ATPase involved in replication control, CDC46/MCM family; helicase, MCM homolog, DNA replication, ATP-binding, DNA-binding; 1.90A {Methanopyrus kandleri AV19} | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >3gmt_A Adenylate kinase; ssgcid, ATP-BIN cytoplasm, nucleotide biosynthesis, nucleotide-BIND transferase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >4hlc_A DTMP kinase, thymidylate kinase; TMK, MRSA, pipiridine, transfera transferase inhibitor complex; HET: T05; 1.55A {Staphylococcus aureus subsp} PDB: 2cck_A 4gfd_A* 4gsy_A* 4hdc_A* 4hej_A* 2ccj_A* 4hld_A* 2ccg_A* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >1u5p_A Spectrin alpha chain, brain; alpha spectrin, two repeats of spectrin, alpha-helical linker region, 3-helix coiled coil, structural protein; 2.00A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >3uul_A Utrophin; spectrin repeat, structural protein, cytoskeletal, helical bundle; 1.95A {Rattus norvegicus} PDB: 3uum_A | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* | Back alignment and structure |
|---|
| >2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* | Back alignment and structure |
|---|
| >3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A | Back alignment and structure |
|---|
| >2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >1s35_A Beta-I spectrin, spectrin beta chain, erythrocyte; two repeats of spectrin, alpha helical linker region, 3- helix coiled-coils, beta spectrin; 2.40A {Homo sapiens} SCOP: a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* | Back alignment and structure |
|---|
| >2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* | Back alignment and structure |
|---|
| >3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* | Back alignment and structure |
|---|
| >2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >3uun_A Dystrophin; triple helical, cell structure and stability, cytoskeletal, structural protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >1u4q_A Spectrin alpha chain, brain; alpha spectrin, three repeats of spectrin, alpha-helical linker region, 3-helix coiled-coil, structural protein; 2.50A {Gallus gallus} SCOP: a.7.1.1 a.7.1.1 a.7.1.1 | Back alignment and structure |
|---|
| >2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} | Back alignment and structure |
|---|
| >1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A | Back alignment and structure |
|---|
| >3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 | Back alignment and structure |
|---|
| >2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A | Back alignment and structure |
|---|
| >2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* | Back alignment and structure |
|---|
| >3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A | Back alignment and structure |
|---|
| >1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* | Back alignment and structure |
|---|
| >1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* | Back alignment and structure |
|---|
| >1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* | Back alignment and structure |
|---|
| >1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* | Back alignment and structure |
|---|
| >1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C | Back alignment and structure |
|---|
| >2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* | Back alignment and structure |
|---|
| >1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* | Back alignment and structure |
|---|
| >2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* | Back alignment and structure |
|---|
| >3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* | Back alignment and structure |
|---|
| >1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* | Back alignment and structure |
|---|
| >1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* | Back alignment and structure |
|---|
| >1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* | Back alignment and structure |
|---|
| >1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* | Back alignment and structure |
|---|
| >3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 | Back alignment and structure |
|---|
| >2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* | Back alignment and structure |
|---|
| >2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 1949 | |||
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 98.69 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 98.31 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 98.27 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 98.22 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 98.13 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 98.09 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 98.02 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 98.02 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 98.0 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 97.97 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 97.96 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 97.92 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 97.85 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 97.84 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 97.81 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 97.8 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 97.77 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 97.77 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 97.76 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 97.71 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 97.7 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 97.65 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 97.6 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 97.53 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.53 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 97.51 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 97.49 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 97.49 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 97.42 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 97.41 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 97.31 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 97.29 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.28 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 97.21 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 97.15 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 97.12 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 97.12 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 97.12 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 97.07 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 97.0 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 96.84 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 96.75 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 96.69 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 96.69 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.63 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 96.54 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 96.48 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 96.45 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 96.39 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 96.38 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 96.36 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 96.35 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 96.25 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 96.13 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 96.12 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 96.11 | |
| d1qvra2 | 387 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 95.91 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 95.9 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 95.74 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 95.74 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 95.7 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 95.65 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 95.54 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 95.4 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 95.38 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 95.37 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 95.36 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 95.36 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 95.35 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 95.24 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 95.1 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 95.08 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 95.08 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 95.08 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 94.95 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 94.95 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 94.83 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 94.8 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 94.74 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 94.69 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 94.69 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 94.67 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 94.63 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 94.54 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 94.53 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 94.52 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 94.46 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 94.41 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 94.34 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 94.33 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 94.33 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 94.32 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 94.31 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 94.28 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 94.27 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 94.19 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 94.13 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 94.1 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 94.07 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 93.85 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 93.82 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 93.77 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 93.74 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 93.73 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 93.68 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 93.65 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 93.65 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 93.63 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 93.51 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 93.47 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 93.45 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 93.3 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 93.23 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 93.21 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 93.04 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 92.99 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 92.85 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 92.71 | |
| d1u5pa1 | 110 | Spectrin alpha chain {Chicken (Gallus gallus) [Tax | 92.69 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 92.68 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 92.63 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 92.44 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 92.37 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 92.34 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 92.32 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 92.16 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 92.01 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 91.68 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 91.45 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 91.45 | |
| d1u5pa2 | 101 | Spectrin alpha chain {Chicken (Gallus gallus) [Tax | 91.43 | |
| d1r8sa_ | 160 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 91.2 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 91.17 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 91.13 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 91.05 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 90.83 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 90.81 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 90.73 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 90.66 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 90.66 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 90.64 | |
| d1f6ba_ | 186 | SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: | 90.59 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 90.56 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 90.47 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 90.45 | |
| d1s35a2 | 105 | Spectrin beta chain {Human (Homo sapiens) [TaxId: | 90.42 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 90.36 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 90.35 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 90.3 | |
| d2onka1 | 240 | Molybdate/tungstate import ATP-binding protein Wtp | 90.27 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 90.23 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 90.12 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 90.11 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 90.07 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 90.02 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 89.99 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 89.94 | |
| d1cuna2 | 104 | Spectrin alpha chain {Chicken (Gallus gallus) [Tax | 89.85 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 89.79 | |
| d1hcia4 | 114 | alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | 89.58 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 89.46 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 89.4 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 89.37 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 89.32 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 89.29 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 89.26 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 89.24 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 89.2 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 89.16 | |
| d1upta_ | 169 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 89.16 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 88.98 | |
| d1ksha_ | 165 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 88.74 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 88.71 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 88.5 | |
| d2cxxa1 | 184 | GTP-binding protein engB {Pyrococcus horikoshii [T | 88.47 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 88.44 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 88.34 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 88.24 | |
| d1nrjb_ | 209 | Signal recognition particle receptor beta-subunit | 88.18 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 88.15 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 88.13 | |
| d1u0la2 | 225 | Probable GTPase EngC (YjeQ), C-terminal domain {Th | 88.09 | |
| d2qtvb1 | 166 | SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 88.01 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 88.0 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 87.99 | |
| d2fh5b1 | 207 | Signal recognition particle receptor beta-subunit | 87.89 | |
| d1oxxk2 | 242 | Glucose transport protein GlcV, N-terminal domain | 87.85 | |
| d3raba_ | 169 | Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | 87.73 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 87.7 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 87.7 | |
| d1zj6a1 | 177 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 87.59 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 87.55 | |
| d2a5ja1 | 173 | Rab2b {Human (Homo sapiens) [TaxId: 9606]} | 87.4 | |
| d2gj8a1 | 161 | Probable tRNA modification GTPase TrmE (MnmE), G d | 87.4 | |
| d1z2aa1 | 164 | Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | 87.31 | |
| d1svia_ | 195 | Probable GTPase EngB {Bacillus subtilis [TaxId: 14 | 87.3 | |
| d1htwa_ | 158 | Hypothetical protein HI0065 {Haemophilus influenza | 87.25 | |
| d1mkya1 | 171 | Probable GTPase Der, N-terminal and middle domains | 87.24 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 86.86 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 86.75 | |
| d2f7sa1 | 186 | Rab27b {Human (Homo sapiens) [TaxId: 9606]} | 86.74 | |
| d1g16a_ | 166 | Rab-related protein Sec4 {Baker's yeast (Saccharom | 86.71 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 86.68 | |
| d2ew1a1 | 171 | Rab30 {Human (Homo sapiens) [TaxId: 9606]} | 86.64 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 86.56 | |
| d2erya1 | 171 | r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 86.55 | |
| d1kaoa_ | 167 | Rap2a {Human (Homo sapiens) [TaxId: 9606]} | 86.37 | |
| d2f9la1 | 175 | Rab11b {Human (Homo sapiens) [TaxId: 9606]} | 86.25 | |
| d1s35a1 | 106 | Spectrin beta chain {Human (Homo sapiens) [TaxId: | 86.12 | |
| d1zd9a1 | 164 | ADP-ribosylation factor {Human (Homo sapiens), ARL | 86.05 | |
| d2atva1 | 168 | Ras-like estrogen-regulated growth inhibitor, RERG | 86.0 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 85.98 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 85.98 | |
| d1ctqa_ | 166 | cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 | 85.95 | |
| d1z0fa1 | 166 | Rab14 {Human (Homo sapiens) [TaxId: 9606]} | 85.93 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 85.88 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 85.84 | |
| d1b0ua_ | 258 | ATP-binding subunit of the histidine permease {Sal | 85.84 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 85.76 | |
| d2fn4a1 | 173 | r-Ras {Human (Homo sapiens) [TaxId: 9606]} | 85.62 | |
| d1ky3a_ | 175 | Rab-related protein ypt7p {Baker's yeast (Saccharo | 85.6 | |
| d1xtqa1 | 167 | GTP-binding protein RheB {Human (Homo sapiens) [Ta | 85.42 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 85.37 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 85.35 | |
| d1z08a1 | 167 | Rab21 {Human (Homo sapiens) [TaxId: 9606]} | 85.33 | |
| d1fzqa_ | 176 | ADP-ribosylation factor {Mouse (Mus musculus), ARL | 85.28 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 85.21 | |
| d1r2qa_ | 170 | Rab5a {Human (Homo sapiens) [TaxId: 9606]} | 85.12 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 85.06 | |
| d1z06a1 | 165 | Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | 85.05 | |
| d1ji0a_ | 240 | Branched chain aminoacid ABC transporter {Thermoto | 85.0 | |
| d2erxa1 | 171 | di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | 84.98 | |
| d1wf3a1 | 178 | GTPase Era, N-terminal domain {Thermus thermophilu | 84.97 | |
| d1l7vc_ | 231 | ABC transporter involved in vitamin B12 uptake, Bt | 84.94 | |
| d1wmsa_ | 174 | Rab9a {Human (Homo sapiens) [TaxId: 9606]} | 84.69 | |
| d1kmqa_ | 177 | RhoA {Human (Homo sapiens) [TaxId: 9606]} | 84.68 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 84.67 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 84.59 | |
| d1vg8a_ | 184 | Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | 84.53 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 84.51 | |
| d2bmea1 | 174 | Rab4a {Human (Homo sapiens) [TaxId: 9606]} | 84.31 | |
| d1yzqa1 | 164 | Rab6 {Human (Homo sapiens) [TaxId: 9606]} | 84.26 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 84.2 | |
| d1u0ja_ | 267 | Rep 40 protein helicase domain {Adeno-associated v | 84.14 | |
| d1quua1 | 124 | alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | 84.1 | |
| d2bcgy1 | 194 | GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi | 84.06 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 83.95 | |
| d2gjsa1 | 168 | Rad {Human (Homo sapiens) [TaxId: 9606]} | 83.91 | |
| d1h65a_ | 257 | Chloroplast protein translocon GTPase Toc34 {Garde | 83.9 | |
| d1x3sa1 | 177 | Rab18 {Human (Homo sapiens) [TaxId: 9606]} | 83.83 | |
| d1e0sa_ | 173 | ADP-ribosylation factor {Human (Homo sapiens), ARF | 83.77 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 83.67 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 83.67 | |
| d1moza_ | 182 | ADP-ribosylation factor {Baker's yeast (Saccharomy | 83.59 | |
| d1mh1a_ | 183 | Rac {Human (Homo sapiens) [TaxId: 9606]} | 83.42 | |
| d1u8za_ | 168 | Ras-related protein RalA {Cotton-top tamarin (Sagu | 83.41 | |
| d1egaa1 | 179 | GTPase Era, N-terminal domain {Escherichia coli [T | 83.25 | |
| d2g6ba1 | 170 | Rab26 {Human (Homo sapiens) [TaxId: 9606]} | 83.09 | |
| d1vpla_ | 238 | Putative ABC transporter TM0544 {Thermotoga mariti | 83.07 | |
| d2fu5c1 | 173 | Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | 83.05 | |
| d1c1ya_ | 167 | Rap1A {Human (Homo sapiens) [TaxId: 9606]} | 83.04 | |
| d2g3ya1 | 172 | GTP-binding protein GEM {Human (Homo sapiens) [Tax | 82.97 | |
| d1z0ja1 | 167 | Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | 82.96 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 82.91 | |
| d2atxa1 | 185 | RhoQ {Human (Homo sapiens) [TaxId: 9606]} | 82.74 | |
| d1ek0a_ | 170 | Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T | 82.66 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 82.64 | |
| d1m7ba_ | 179 | RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | 82.41 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 82.35 | |
| d1g6ha_ | 254 | MJ1267 {Archaeon Methanococcus jannaschii [TaxId: | 82.34 | |
| d1x1ra1 | 169 | Ras-related protein M-Ras (XRas) {Mouse (Mus muscu | 82.27 | |
| d1xzpa2 | 160 | TrmE GTPase domain {Thermotoga maritima [TaxId: 23 | 82.03 | |
| d1i2ma_ | 170 | Ran {Human (Homo sapiens) [TaxId: 9606]} | 82.03 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 81.87 | |
| d1quua2 | 124 | alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | 81.69 | |
| d2ngra_ | 191 | CDC42 {Human (Homo sapiens) [TaxId: 9606]} | 81.6 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 81.4 | |
| d1mkya2 | 186 | Probable GTPase Der, N-terminal and middle domains | 81.16 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 81.13 | |
| d1lnza2 | 185 | Obg GTP-binding protein middle domain {Bacillus su | 81.09 | |
| d1t9ha2 | 231 | Probable GTPase EngC (YjeQ), C-terminal domain {Ba | 80.85 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 80.78 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 80.6 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 80.58 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 80.49 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 80.43 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 80.26 | |
| d1puia_ | 188 | Probable GTPase EngB {Escherichia coli [TaxId: 562 | 80.26 |
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Extended AAA-ATPase domain domain: delta prime subunit of DNA polymerase III, N-domain species: Escherichia coli [TaxId: 562]
Probab=98.69 E-value=1.7e-08 Score=110.12 Aligned_cols=162 Identities=14% Similarity=0.146 Sum_probs=100.2
Q ss_pred HHHHHHHHHHHHHhcCcEEEEEecCCCChhHHHHHHHHHHHhccCCC---cccccCCCccCcccccccccCCCCCcccCh
Q psy2654 1749 SFILKVVQLVELFAVRHSVFIIGFAGTGKSCVWKTLYKTYVNAKKKP---MYNDLEPKAVTNDELFGIINPSTREWKDGL 1825 (1949)
Q Consensus 1749 ~~~~k~~~l~~~l~~~~~vll~G~~gsGKTt~~~~La~~~~~~~~~~---~~~~i~p~~~~~~el~G~~~~~~~~w~dG~ 1825 (1949)
....++.+.+..-...|+++++||+|+||||+++.+|+.+....... .-...+...+......+.+.....++...+
T Consensus 9 ~~~~~l~~~~~~~~l~h~lLl~Gp~G~GKtt~a~~~a~~l~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~i 88 (207)
T d1a5ta2 9 PDFEKLVASYQAGRGHHALLIQALPGMGDDALIYALSRYLLCQQPQGHKSCGHCRGCQLMQAGTHPDYYTLAPEKGKNTL 88 (207)
T ss_dssp HHHHHHHHHHHTTCCCSEEEEECCTTSCHHHHHHHHHHHHTCSSCBTTBCCSCSHHHHHHHHTCCTTEEEECCCTTCSSB
T ss_pred HHHHHHHHHHHcCCcCeEEEEECCCCCcHHHHHHHHHHhcccccccccccccccchhhhhhhccccccchhhhhhccccc
Confidence 44555556666656678999999999999999999999874221110 000000001111111111222222344445
Q ss_pred HHHHHHHHhhc-----CCCCCcEEEEcCCCCccchhhHHhhhcCCcceeccCCceeecCCCceEEEEeCCCCCCChhhhc
Q psy2654 1826 FSCLIREQAQS-----TGDGPKWMVMDGDIDPMWIESLNTVMDDNKVLTLASNERIALTPSMRLLFEISNLRTATPATVS 1900 (1949)
Q Consensus 1826 l~~~~r~~~~~-----~~~~~~Wiv~Dg~~d~~w~e~ln~~lddn~~l~l~~ge~i~~~~~~~~ifE~~~l~~asPa~vs 1900 (1949)
-...+|+.... .....++||+| ++|....++.|++|. .+- ..|+++++||.|++++.+-|+..|
T Consensus 89 ~~~~ir~l~~~~~~~~~~~~~kviIid-e~d~l~~~a~n~Llk---~lE-------ep~~~~~fIl~t~~~~~ll~tI~S 157 (207)
T d1a5ta2 89 GVDAVREVTEKLNEHARLGGAKVVWVT-DAALLTDAAANALLK---TLE-------EPPAETWFFLATREPERLLATLRS 157 (207)
T ss_dssp CHHHHHHHHHHTTSCCTTSSCEEEEES-CGGGBCHHHHHHHHH---HHT-------SCCTTEEEEEEESCGGGSCHHHHT
T ss_pred ccchhhHHhhhhhhccccCccceEEec-hhhhhhhhhhHHHHH---HHH-------hhcccceeeeeecChhhhhhhhcc
Confidence 45555554332 12345799999 567777778887761 110 136789999999999999999999
Q ss_pred cceEEEecCCCCCchhhHHhhhcc
Q psy2654 1901 RAGILYINPQDLGWNPYVLSWTDT 1924 (1949)
Q Consensus 1901 r~~~v~~~~~~~~w~~~~~~w~~~ 1924 (1949)
||-.|.+.+-. ...+..||..
T Consensus 158 Rc~~i~~~~~~---~~~~~~~L~~ 178 (207)
T d1a5ta2 158 RCRLHYLAPPP---EQYAVTWLSR 178 (207)
T ss_dssp TSEEEECCCCC---HHHHHHHHHH
T ss_pred eeEEEecCCCC---HHHHHHHHHH
Confidence 99999998544 3566677754
|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1u5pa1 a.7.1.1 (A:1662-1771) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1u5pa2 a.7.1.1 (A:1772-1872) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1s35a2 a.7.1.1 (A:1169-1273) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1cuna2 a.7.1.1 (A:116-219) Spectrin alpha chain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1hcia4 a.7.1.1 (A:633-746) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s35a1 a.7.1.1 (A:1063-1168) Spectrin beta chain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} | Back information, alignment and structure |
|---|
| >d1quua1 a.7.1.1 (A:1-124) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} | Back information, alignment and structure |
|---|
| >d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} | Back information, alignment and structure |
|---|
| >d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1quua2 a.7.1.1 (A:125-248) alpha-actinin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|