Psyllid ID: psy2669

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160------
MCMLTNDIYDYYNVSQGKITIPGMDDGEEFQLTDQAFDILGFTKEEKENVYKITASVMHMGGMKFKQRGREEQAEPDGTEEGDRVSKLLGVDSQQLYTNLVKPRIKVGNEFVTQGRNVNQQAFDILGFTKEEKENVYKITASVMHMGGMKFKQRGREEQAEPDGTE
ccccccccccccccccccccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccEEEEEEcccccccccccHHHHHHHHHHcccHHHHHHHHcccEEEEccEEEEEccccHHHHHHHHHccHHHHHHHHHHHHHHHHccccccccccccccccccccc
cEEEEcccccccEEcccEEEEcccccHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccEcccccHHHccccccHHHHHHHHHHcccHHHHHHHHccccEEEcccEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHcccccccc
MCMLTNDIYDYYNvsqgkitipgmddgeefqltDQAFDILGFTKEEKENVYKITASVMhmggmkfkqrgreeqaepdgteegdrvskllgvdsqqlytnlvkprikvgneFVTQGRNVNQQAFDILGFTKEEKENVYKITASVMhmggmkfkqrgreeqaepdgte
MCMLTNDIYDYYNVSQGKITIPGMDDGEEFQLTDQAFDILGFTKEEKENVYKITASVMHMGGMKFKqrgreeqaepdgteegdrvskllgvdsqqlytnlVKPRIKVGNefvtqgrnvNQQAFDILGFTKEEKENVYKITASVMHMGGMkfkqrgreeqaepdgte
MCMLTNDIYDYYNVSQGKITIPGMDDGEEFQLTDQAFDILGFTKEEKENVYKITASVMHMGGMKFKQRGREEQAEPDGTEEGDRVSKLLGVDSQQLYTNLVKPRIKVGNEFVTQGRNVNQQAFDILGFTKEEKENVYKITASVMHMGGMKFKQRGREEQAEPDGTE
**MLTNDIYDYYNVSQGKITIPGMDDGEEFQLTDQAFDILGFTKEEKENVYKITASVMHM***************************LLGVDSQQLYTNLVKPRIKVGNEFVTQGRNVNQQAFDILGFTKEEKENVYKITASVMHM********************
MCMLTNDIYDYYNVSQGKITIPGMDDGEEFQLTDQAFDILGFTKEEKENVYKITASVMHMGGMKFK**************EGDRVSKLLGVDSQQLYTNLVKPRIKVGNEFVTQGRNVNQQAFDILGFTKEEKENVYKITASVMHM********************
MCMLTNDIYDYYNVSQGKITIPGMDDGEEFQLTDQAFDILGFTKEEKENVYKITASVMHMGGMKF******************RVSKLLGVDSQQLYTNLVKPRIKVGNEFVTQGRNVNQQAFDILGFTKEEKENVYKITASVMHMGGMKF***************
MCMLTNDIYDYYNVSQGKITIPGMDDGEEFQLTDQAFDILGFTKEEKENVYKITASVMHMGGMKFKQR*********GTEEGDRVSKLLGVDSQQLYTNLVKPRIKVGNEFVTQGRNVNQQAFDILGFTKEEKENVYKITASVMHMGGMKFKQ**REEQ*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCMLTNDIYDYYNVSQGKITIPGMDDGEEFQLTDQAFDILGFTKEEKENVYKITASVMHMGGMKFKQRGREEQAEPDGTEEGDRVSKLLGVDSQQLYTNLVKPRIKVGNEFVTQGRNVNQQAFDILGFTKEEKENVYKITASVMHMGGMKFKQRGREEQAEPDGTE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query166 2.2.26 [Sep-21-2011]
P05661 1962 Myosin heavy chain, muscl yes N/A 0.783 0.066 0.723 1e-52
Q91Z83 1935 Myosin-7 OS=Mus musculus yes N/A 0.825 0.070 0.518 8e-39
Q8MJU9 1935 Myosin-7 OS=Equus caballu yes N/A 0.740 0.063 0.560 2e-38
P02564 1935 Myosin-7 OS=Rattus norveg yes N/A 0.825 0.070 0.525 2e-38
P49824 1935 Myosin-7 OS=Canis familia yes N/A 0.740 0.063 0.560 2e-38
P13533 1939 Myosin-6 OS=Homo sapiens yes N/A 0.783 0.067 0.530 2e-37
P02563 1938 Myosin-6 OS=Rattus norveg no N/A 0.825 0.070 0.510 3e-37
P13539 1939 Myosin-6 OS=Mesocricetus N/A N/A 0.753 0.064 0.544 5e-37
P79293 1935 Myosin-7 OS=Sus scrofa GN yes N/A 0.722 0.062 0.558 6e-37
P12883 1935 Myosin-7 OS=Homo sapiens no N/A 0.722 0.062 0.558 6e-37
>sp|P05661|MYSA_DROME Myosin heavy chain, muscle OS=Drosophila melanogaster GN=Mhc PE=1 SV=4 Back     alignment and function desciption
 Score =  204 bits (520), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 109/130 (83%)

Query: 1   MCMLTNDIYDYYNVSQGKITIPGMDDGEEFQLTDQAFDILGFTKEEKENVYKITASVMHM 60
           +C+LT++IYDY+ VSQGK+T+  +DD EEF LTDQAFDILGFTK+EKE+VY+ITA+VMHM
Sbjct: 299 ICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTDQAFDILGFTKQEKEDVYRITAAVMHM 358

Query: 61  GGMKFKQRGREEQAEPDGTEEGDRVSKLLGVDSQQLYTNLVKPRIKVGNEFVTQGRNVNQ 120
           GGMKFKQRGREEQAE DG EEG RVSKL G D+ +LY NL+KPRIKVGNEFVTQGRNV Q
Sbjct: 359 GGMKFKQRGREEQAEQDGEEEGGRVSKLFGCDTAELYKNLLKPRIKVGNEFVTQGRNVQQ 418

Query: 121 QAFDILGFTK 130
               I    K
Sbjct: 419 VTNSIGALCK 428
Muscle contraction.
Drosophila melanogaster (taxid: 7227)
>sp|Q91Z83|MYH7_MOUSE Myosin-7 OS=Mus musculus GN=Myh7 PE=1 SV=1 Back     alignment and function description
>sp|Q8MJU9|MYH7_HORSE Myosin-7 OS=Equus caballus GN=MYH7 PE=2 SV=1 Back     alignment and function description
>sp|P02564|MYH7_RAT Myosin-7 OS=Rattus norvegicus GN=Myh7 PE=2 SV=2 Back     alignment and function description
>sp|P49824|MYH7_CANFA Myosin-7 OS=Canis familiaris GN=MYH7 PE=1 SV=3 Back     alignment and function description
>sp|P13533|MYH6_HUMAN Myosin-6 OS=Homo sapiens GN=MYH6 PE=1 SV=5 Back     alignment and function description
>sp|P02563|MYH6_RAT Myosin-6 OS=Rattus norvegicus GN=Myh6 PE=2 SV=2 Back     alignment and function description
>sp|P13539|MYH6_MESAU Myosin-6 OS=Mesocricetus auratus GN=MYH6 PE=2 SV=2 Back     alignment and function description
>sp|P79293|MYH7_PIG Myosin-7 OS=Sus scrofa GN=MYH7 PE=2 SV=2 Back     alignment and function description
>sp|P12883|MYH7_HUMAN Myosin-7 OS=Homo sapiens GN=MYH7 PE=1 SV=5 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query166
383861537 1968 PREDICTED: myosin heavy chain, muscle-li 0.783 0.066 0.761 7e-55
383861535 1968 PREDICTED: myosin heavy chain, muscle-li 0.783 0.066 0.761 7e-55
383861541 1968 PREDICTED: myosin heavy chain, muscle-li 0.783 0.066 0.761 7e-55
383861539 1967 PREDICTED: myosin heavy chain, muscle-li 0.783 0.066 0.761 7e-55
281365099 1949 myosin heavy chain, isoform P [Drosophil 0.753 0.064 0.761 2e-54
24584712 1936 myosin heavy chain, isoform K [Drosophil 0.753 0.064 0.761 2e-54
24584714 1936 myosin heavy chain, isoform L [Drosophil 0.753 0.064 0.761 2e-54
24584716 1936 myosin heavy chain, isoform M [Drosophil 0.753 0.064 0.761 2e-54
157891 1962 myosin heavy chain [Drosophila melanogas 0.753 0.063 0.761 2e-54
24584710 1962 myosin heavy chain, isoform B [Drosophil 0.753 0.063 0.761 2e-54
>gi|383861537|ref|XP_003706242.1| PREDICTED: myosin heavy chain, muscle-like isoform 3 [Megachile rotundata] Back     alignment and taxonomy information
 Score =  218 bits (555), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 114/130 (87%)

Query: 1   MCMLTNDIYDYYNVSQGKITIPGMDDGEEFQLTDQAFDILGFTKEEKENVYKITASVMHM 60
           MCML+N+IYDY NVSQGKITIP +DDGEE QLTDQAFD+LGFT+EEK ++YKITA+VMHM
Sbjct: 301 MCMLSNNIYDYVNVSQGKITIPNVDDGEECQLTDQAFDVLGFTQEEKNDIYKITAAVMHM 360

Query: 61  GGMKFKQRGREEQAEPDGTEEGDRVSKLLGVDSQQLYTNLVKPRIKVGNEFVTQGRNVNQ 120
           GGMKFKQRGREEQAE DGTEEG+RV+KLLG D   LY NL+KPRIKVGNEFVTQGRN +Q
Sbjct: 361 GGMKFKQRGREEQAEADGTEEGERVAKLLGCDCADLYKNLLKPRIKVGNEFVTQGRNKDQ 420

Query: 121 QAFDILGFTK 130
            A+ +   +K
Sbjct: 421 VAYSVGAMSK 430

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383861535|ref|XP_003706241.1| PREDICTED: myosin heavy chain, muscle-like isoform 2 [Megachile rotundata] Back     alignment and taxonomy information
>gi|383861541|ref|XP_003706244.1| PREDICTED: myosin heavy chain, muscle-like isoform 5 [Megachile rotundata] Back     alignment and taxonomy information
>gi|383861539|ref|XP_003706243.1| PREDICTED: myosin heavy chain, muscle-like isoform 4 [Megachile rotundata] Back     alignment and taxonomy information
>gi|281365099|ref|NP_001162992.1| myosin heavy chain, isoform P [Drosophila melanogaster] gi|272407070|gb|ACZ94278.1| myosin heavy chain, isoform P [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|24584712|ref|NP_724008.1| myosin heavy chain, isoform K [Drosophila melanogaster] gi|22946669|gb|AAN10968.1| myosin heavy chain, isoform K [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|24584714|ref|NP_724009.1| myosin heavy chain, isoform L [Drosophila melanogaster] gi|22946670|gb|AAN10969.1| myosin heavy chain, isoform L [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|24584716|ref|NP_724010.1| myosin heavy chain, isoform M [Drosophila melanogaster] gi|22946671|gb|AAN10970.1| myosin heavy chain, isoform M [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|157891|gb|AAA28686.1| myosin heavy chain [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|24584710|ref|NP_724007.1| myosin heavy chain, isoform B [Drosophila melanogaster] gi|22946668|gb|AAN10967.1| myosin heavy chain, isoform B [Drosophila melanogaster] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query166
FB|FBgn0264695 1962 Mhc "Myosin heavy chain" [Dros 0.831 0.070 0.688 2.9e-46
UNIPROTKB|G3V8B0 1935 Myh7 "Myosin-7" [Rattus norveg 0.825 0.070 0.525 5.5e-35
MGI|MGI:2155600 1935 Myh7 "myosin, heavy polypeptid 0.825 0.070 0.518 1.1e-34
UNIPROTKB|F1N2G0 1940 MYH6 "Uncharacterized protein" 0.825 0.070 0.525 1.5e-34
RGD|62030 1935 Myh7 "myosin, heavy chain 7, c 0.825 0.070 0.525 1.9e-34
UNIPROTKB|P49824 1935 MYH7 "Myosin-7" [Canis lupus f 0.825 0.070 0.518 3.1e-34
UNIPROTKB|F1P1D5 1872 LOC429272 "Uncharacterized pro 0.825 0.073 0.518 6.1e-34
ZFIN|ZDB-GENE-991123-5 1938 vmhc "ventricular myosin heavy 0.825 0.070 0.510 6.4e-34
UNIPROTKB|F1NPB7 1942 LOC429272 "Uncharacterized pro 0.825 0.070 0.518 6.4e-34
ZFIN|ZDB-GENE-031112-1 1936 myh6 "myosin, heavy polypeptid 0.825 0.070 0.503 1.3e-33
FB|FBgn0264695 Mhc "Myosin heavy chain" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 497 (180.0 bits), Expect = 2.9e-46, Sum P(2) = 2.9e-46
 Identities = 95/138 (68%), Positives = 113/138 (81%)

Query:     1 MCMLTNDIYDYYNVSQGKITIPGMDDGEEFQLTDQAFDILGFTKEEKENVYKITASVMHM 60
             +C+LT++IYDY+ VSQGK+T+  +DD EEF LTDQAFDILGFTK+EKE+VY+ITA+VMHM
Sbjct:   299 ICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTDQAFDILGFTKQEKEDVYRITAAVMHM 358

Query:    61 GGMKFKQRGREEQAEPDGTEEGDRVSKLLGVDSQQLYTNLVKPRIKVGNEFVTQGRNVNQ 120
             GGMKFKQRGREEQAE DG EEG RVSKL G D+ +LY NL+KPRIKVGNEFVTQGRNV Q
Sbjct:   359 GGMKFKQRGREEQAEQDGEEEGGRVSKLFGCDTAELYKNLLKPRIKVGNEFVTQGRNVQQ 418

Query:   121 QAFDILGFTKEEKENVYK 138
                 I    K   + ++K
Sbjct:   419 VTNSIGALCKGVFDRLFK 436
GO:0006941 "striated muscle contraction" evidence=TAS
GO:0005863 "striated muscle myosin thick filament" evidence=IDA
GO:0008307 "structural constituent of muscle" evidence=IMP;TAS
GO:0005859 "muscle myosin complex" evidence=ISS;IDA
GO:0030017 "sarcomere" evidence=IDA
GO:0042803 "protein homodimerization activity" evidence=IDA
GO:0006936 "muscle contraction" evidence=IMP
GO:0040011 "locomotion" evidence=IMP
GO:0000146 "microfilament motor activity" evidence=ISS
GO:0005703 "polytene chromosome puff" evidence=IDA
GO:0007517 "muscle organ development" evidence=IMP
GO:0042623 "ATPase activity, coupled" evidence=ISS
GO:0016459 "myosin complex" evidence=ISS
GO:0030241 "skeletal muscle myosin thick filament assembly" evidence=IMP
GO:0005524 "ATP binding" evidence=IEA
GO:0030239 "myofibril assembly" evidence=IMP
GO:0007527 "adult somatic muscle development" evidence=IMP
GO:0030898 "actin-dependent ATPase activity" evidence=IDA
GO:0042692 "muscle cell differentiation" evidence=IMP
GO:0007298 "border follicle cell migration" evidence=IMP
GO:0060361 "flight" evidence=IMP
GO:0007427 "epithelial cell migration, open tracheal system" evidence=IMP
GO:0031672 "A band" evidence=IDA
GO:0050821 "protein stabilization" evidence=IMP
GO:0045214 "sarcomere organization" evidence=IMP
GO:0031033 "myosin filament organization" evidence=IMP
UNIPROTKB|G3V8B0 Myh7 "Myosin-7" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2155600 Myh7 "myosin, heavy polypeptide 7, cardiac muscle, beta" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1N2G0 MYH6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|62030 Myh7 "myosin, heavy chain 7, cardiac muscle, beta" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P49824 MYH7 "Myosin-7" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1D5 LOC429272 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-991123-5 vmhc "ventricular myosin heavy chain" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NPB7 LOC429272 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031112-1 myh6 "myosin, heavy polypeptide 6, cardiac muscle, alpha" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8MJU9MYH7_HORSENo assigned EC number0.56090.74090.0635yesN/A
P79293MYH7_PIGNo assigned EC number0.55830.72280.0620yesN/A
Q91Z83MYH7_MOUSENo assigned EC number0.51820.82530.0708yesN/A
P05661MYSA_DROMENo assigned EC number0.72300.78310.0662yesN/A
P13533MYH6_HUMANNo assigned EC number0.53070.78310.0670yesN/A
P49824MYH7_CANFANo assigned EC number0.56090.74090.0635yesN/A
P02564MYH7_RATNo assigned EC number0.52550.82530.0708yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
cd01377 693 cd01377, MYSc_type_II, Myosin motor domain, type I 4e-60
pfam00063 679 pfam00063, Myosin_head, Myosin head (motor domain) 3e-35
smart00242 677 smart00242, MYSc, Myosin 2e-34
cd00124 679 cd00124, MYSc, Myosin motor domain 8e-24
COG5022 1463 COG5022, COG5022, Myosin heavy chain [Cytoskeleton 9e-21
cd01377 693 cd01377, MYSc_type_II, Myosin motor domain, type I 5e-20
cd01380 691 cd01380, MYSc_type_V, Myosin motor domain, type V 6e-15
cd01383 677 cd01383, MYSc_type_VIII, Myosin motor domain, plan 9e-15
cd01378 674 cd01378, MYSc_type_I, Myosin motor domain, type I 1e-14
cd01381 671 cd01381, MYSc_type_VII, Myosin motor domain, type 1e-13
pfam00063 679 pfam00063, Myosin_head, Myosin head (motor domain) 6e-13
cd01384 674 cd01384, MYSc_type_XI, Myosin motor domain, plant- 5e-12
smart00242 677 smart00242, MYSc, Myosin 7e-11
cd00124 679 cd00124, MYSc, Myosin motor domain 4e-08
cd01387 677 cd01387, MYSc_type_XV, Myosin motor domain, type X 1e-07
cd01385 692 cd01385, MYSc_type_IX, Myosin motor domain, type I 2e-07
PTZ00014 821 PTZ00014, PTZ00014, myosin-A; Provisional 4e-07
cd01379 653 cd01379, MYSc_type_III, Myosin motor domain, type 7e-07
cd01382 717 cd01382, MYSc_type_VI, Myosin motor domain, type V 1e-05
cd01387 677 cd01387, MYSc_type_XV, Myosin motor domain, type X 4e-05
cd01378 674 cd01378, MYSc_type_I, Myosin motor domain, type I 6e-04
cd01379 653 cd01379, MYSc_type_III, Myosin motor domain, type 8e-04
cd01381 671 cd01381, MYSc_type_VII, Myosin motor domain, type 0.002
cd01383 677 cd01383, MYSc_type_VIII, Myosin motor domain, plan 0.003
>gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins Back     alignment and domain information 
 Score =  197 bits (502), Expect = 4e-60
 Identities = 74/130 (56%), Positives = 100/130 (76%)

Query: 1   MCMLTNDIYDYYNVSQGKITIPGMDDGEEFQLTDQAFDILGFTKEEKENVYKITASVMHM 60
           M +LT +  DY  +SQG++TIPG+DD EEF+LTD+AFDILGF+ EEK +++KI A+++H+
Sbjct: 219 MLLLTGNPNDYRYLSQGELTIPGVDDAEEFKLTDEAFDILGFSDEEKNSIFKIVAAILHL 278

Query: 61  GGMKFKQRGREEQAEPDGTEEGDRVSKLLGVDSQQLYTNLVKPRIKVGNEFVTQGRNVNQ 120
           G +KFKQR REEQAE DGTEE D+ + LLGV+S  L   L+ PRIKVG E+VT+G+NV Q
Sbjct: 279 GNIKFKQRQREEQAELDGTEEADKAAHLLGVNSADLLKALLHPRIKVGREWVTKGQNVEQ 338

Query: 121 QAFDILGFTK 130
            +F +    K
Sbjct: 339 VSFSVGALAK 348

Myosin II mediates cortical contraction in cell motility, and is the motor in smooth and skeletal muscle. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 693
>gnl|CDD|215687 pfam00063, Myosin_head, Myosin head (motor domain) Back     alignment and domain information
>gnl|CDD|214580 smart00242, MYSc, Myosin Back     alignment and domain information
>gnl|CDD|238071 cd00124, MYSc, Myosin motor domain Back     alignment and domain information
>gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins Back     alignment and domain information
>gnl|CDD|238676 cd01380, MYSc_type_V, Myosin motor domain, type V myosins Back     alignment and domain information
>gnl|CDD|238679 cd01383, MYSc_type_VIII, Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information
>gnl|CDD|238674 cd01378, MYSc_type_I, Myosin motor domain, type I myosins Back     alignment and domain information
>gnl|CDD|238677 cd01381, MYSc_type_VII, Myosin motor domain, type VII myosins Back     alignment and domain information
>gnl|CDD|215687 pfam00063, Myosin_head, Myosin head (motor domain) Back     alignment and domain information
>gnl|CDD|238680 cd01384, MYSc_type_XI, Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>gnl|CDD|214580 smart00242, MYSc, Myosin Back     alignment and domain information
>gnl|CDD|238071 cd00124, MYSc, Myosin motor domain Back     alignment and domain information
>gnl|CDD|238683 cd01387, MYSc_type_XV, Myosin motor domain, type XV myosins Back     alignment and domain information
>gnl|CDD|238681 cd01385, MYSc_type_IX, Myosin motor domain, type IX myosins Back     alignment and domain information
>gnl|CDD|240229 PTZ00014, PTZ00014, myosin-A; Provisional Back     alignment and domain information
>gnl|CDD|238675 cd01379, MYSc_type_III, Myosin motor domain, type III myosins Back     alignment and domain information
>gnl|CDD|238678 cd01382, MYSc_type_VI, Myosin motor domain, type VI myosins Back     alignment and domain information
>gnl|CDD|238683 cd01387, MYSc_type_XV, Myosin motor domain, type XV myosins Back     alignment and domain information
>gnl|CDD|238674 cd01378, MYSc_type_I, Myosin motor domain, type I myosins Back     alignment and domain information
>gnl|CDD|238675 cd01379, MYSc_type_III, Myosin motor domain, type III myosins Back     alignment and domain information
>gnl|CDD|238677 cd01381, MYSc_type_VII, Myosin motor domain, type VII myosins Back     alignment and domain information
>gnl|CDD|238679 cd01383, MYSc_type_VIII, Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 166
COG5022 1463 Myosin heavy chain [Cytoskeleton] 100.0
cd01377 693 MYSc_type_II Myosin motor domain, type II myosins. 100.0
PTZ00014 821 myosin-A; Provisional 100.0
cd01383 677 MYSc_type_VIII Myosin motor domain, plant-specific 100.0
KOG0164|consensus 1001 100.0
cd01381 671 MYSc_type_VII Myosin motor domain, type VII myosin 100.0
cd01380 691 MYSc_type_V Myosin motor domain, type V myosins. M 100.0
cd01384 674 MYSc_type_XI Myosin motor domain, plant-specific t 100.0
cd01378 674 MYSc_type_I Myosin motor domain, type I myosins. M 100.0
cd01387 677 MYSc_type_XV Myosin motor domain, type XV myosins. 100.0
cd01385 692 MYSc_type_IX Myosin motor domain, type IX myosins. 100.0
cd00124 679 MYSc Myosin motor domain. This catalytic (head) do 100.0
PF00063 689 Myosin_head: Myosin head (motor domain); InterPro: 100.0
cd01379 653 MYSc_type_III Myosin motor domain, type III myosin 100.0
smart00242 677 MYSc Myosin. Large ATPases. ATPase; molecular moto 100.0
KOG0162|consensus 1106 100.0
cd01382 717 MYSc_type_VI Myosin motor domain, type VI myosins. 100.0
cd01386 767 MYSc_type_XVIII Myosin motor domain, type XVIII my 99.97
KOG0163|consensus 1259 99.97
KOG0161|consensus 1930 99.96
KOG0160|consensus 862 99.96
KOG4229|consensus 1062 99.89
>COG5022 Myosin heavy chain [Cytoskeleton] Back     alignment and domain information 
Probab=100.00  E-value=2.6e-39  Score=299.64  Aligned_cols=150  Identities=28%  Similarity=0.419  Sum_probs=142.8

Q ss_pred             CCCCCCCccccccCC-CCCCCCCCcHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHhhcCceEeecCCCCccccCCchh
Q psy2669           3 MLTNDIYDYYNVSQG-KITIPGMDDGEEFQLTDQAFDILGFTKEEKENVYKITASVMHMGGMKFKQRGREEQAEPDGTEE   81 (166)
Q Consensus         3 ~L~~~~~~y~yL~~~-~~~~~~~dD~~~f~~~~~al~~lg~~~~e~~~i~~ilaaILhLGNi~F~~~~~~~~~~v~~~~~   81 (166)
                      ++.+.|++|.||++| |..++|+||+++|+.|++||+++||+++||..||++||||||||||+|... +++.+.+++.+.
T Consensus       275 ~~~~~~~dY~Yl~~~~~~~I~gIdD~kefk~t~~AlktiGi~~eeq~~IF~iLAaILhiGNIef~~~-r~g~a~~~~~~~  353 (1463)
T COG5022         275 LLLQNPKDYIYLSQGGCDKIDGIDDAKEFKITLDALKTIGIDEEEQDQIFKILAAILHIGNIEFKED-RNGAAIFSDNSV  353 (1463)
T ss_pred             hhccChHhhHhHhhcCCCcCCCcccHHHHHHHHHHHHHhCCChHHHHHHHHHHHHHHhhcceeeeec-ccchhhcCCchH
Confidence            445899999999998 789999999999999999999999999999999999999999999999986 467889999999


Q ss_pred             HHHHHhhhCCCHHHHHhhhccceeeeCCeeEEecCChhHHHHhhhhhhHHHHHHHHHHHHHHHhccCccccc
Q psy2669          82 GDRVSKLLGVDSQQLYTNLVKPRIKVGNEFVTQGRNVNQQAFDILGFTKEEKENVYKITASVMHMGGMKFKQ  153 (166)
Q Consensus        82 l~~~a~LLgv~~~~L~~~L~~~~~~~~~e~~~~~~~~~~A~~~rdalaK~lY~~LF~wiV~~IN~~~~~~~~  153 (166)
                      ++.+|+|||||++.|.++|+.|.+++|||.+.+|+|..||...||||||+||++||+|||.|||.+...+..
T Consensus       354 ~~~~c~LLgId~~~f~k~lvk~~ikt~~E~i~~~~n~~QA~~irdslAK~lY~~lFdwiV~rIN~sL~~~~~  425 (1463)
T COG5022         354 LDKACYLLGIDPSLFVKWLVKRQIKTGGEWIVVPLNLEQALAIRDSLAKALYSNLFDWIVDRINKSLDHSAA  425 (1463)
T ss_pred             HHHHHHHhCCCHHHHHHHHHHhHhhcCceEEEecCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccCccc
Confidence            999999999999999999999999999999999999999999999999999999999999999998877654

>cd01377 MYSc_type_II Myosin motor domain, type II myosins Back     alignment and domain information
>PTZ00014 myosin-A; Provisional Back     alignment and domain information
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information
>KOG0164|consensus Back     alignment and domain information
>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins Back     alignment and domain information
>cd01380 MYSc_type_V Myosin motor domain, type V myosins Back     alignment and domain information
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>cd01378 MYSc_type_I Myosin motor domain, type I myosins Back     alignment and domain information
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins Back     alignment and domain information
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins Back     alignment and domain information
>cd00124 MYSc Myosin motor domain Back     alignment and domain information
>PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>cd01379 MYSc_type_III Myosin motor domain, type III myosins Back     alignment and domain information
>smart00242 MYSc Myosin Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins Back     alignment and domain information
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins Back     alignment and domain information
>KOG0163|consensus Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>KOG0160|consensus Back     alignment and domain information
>KOG4229|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
4db1_A 783 Cardiac Human Myosin S1dc, Beta Isoform Complexed W 2e-37
4db1_A 783 Cardiac Human Myosin S1dc, Beta Isoform Complexed W 1e-13
2w4g_M 840 Isometrically Contracting Insect Asynchronous Fligh 3e-37
2w4g_M 840 Isometrically Contracting Insect Asynchronous Fligh 1e-12
1qvi_A 840 Crystal Structure Of Scallop Myosin S1 In The Pre-P 8e-34
1qvi_A 840 Crystal Structure Of Scallop Myosin S1 In The Pre-P 8e-15
1dfk_A 830 Nucleotide-Free Scallop Myosin S1-Near Rigor State 9e-34
1dfk_A 830 Nucleotide-Free Scallop Myosin S1-Near Rigor State 8e-15
1dfl_A 831 Scallop Myosin S1 Complexed With Mgadp:vanadate-Tra 9e-34
1dfl_A 831 Scallop Myosin S1 Complexed With Mgadp:vanadate-Tra 9e-15
1kk7_A 837 Scallop Myosin In The Near Rigor Conformation Lengt 1e-33
1kk7_A 837 Scallop Myosin In The Near Rigor Conformation Lengt 9e-15
1b7t_A 835 Myosin Digested By Papain Length = 835 1e-33
1b7t_A 835 Myosin Digested By Papain Length = 835 9e-15
2ec6_A 838 Placopecten Striated Muscle Myosin Ii Length = 838 7e-33
2ec6_A 838 Placopecten Striated Muscle Myosin Ii Length = 838 2e-14
2os8_A 840 Rigor-Like Structures Of Muscle Myosins Reveal Key 8e-33
2os8_A 840 Rigor-Like Structures Of Muscle Myosins Reveal Key 2e-14
2mys_A 843 Myosin Subfragment-1, Alpha Carbon Coordinates Only 1e-31
2mys_A 843 Myosin Subfragment-1, Alpha Carbon Coordinates Only 1e-10
1m8q_A 840 Molecular Models Of Averaged Rigor Crossbridges Fro 1e-31
1m8q_A 840 Molecular Models Of Averaged Rigor Crossbridges Fro 1e-10
3i5g_A 839 Crystal Structure Of Rigor-Like Squid Myosin S1 Len 4e-30
3i5g_A 839 Crystal Structure Of Rigor-Like Squid Myosin S1 Len 5e-10
1i84_S 1184 Cryo-Em Structure Of The Heavy Meromyosin Subfragme 1e-16
3dtp_B 973 Tarantula Heavy Meromyosin Obtained By Flexible Doc 1e-16
3dtp_A 971 Tarantula Heavy Meromyosin Obtained By Flexible Doc 1e-16
3j04_A 909 Em Structure Of The Heavy Meromyosin Subfragment Of 1e-16
1br2_A 791 Smooth Muscle Myosin Motor Domain Complexed With Mg 1e-16
1br1_A 820 Smooth Muscle Myosin Motor Domain-Essential Light C 1e-16
2x9h_A 695 Crystal Structure Of Myosin-2 Motor Domain In Compl 2e-15
2x9h_A 695 Crystal Structure Of Myosin-2 Motor Domain In Compl 4e-05
3mkd_A 692 Crystal Structure Of Myosin-2 Dictyostelium Discoid 2e-15
3mkd_A 692 Crystal Structure Of Myosin-2 Dictyostelium Discoid 4e-05
1mma_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 2e-15
1mma_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 4e-05
2aka_A 776 Structure Of The Nucleotide-Free Myosin Ii Motor Do 2e-15
2aka_A 776 Structure Of The Nucleotide-Free Myosin Ii Motor Do 4e-05
2y9e_X 758 Structural Basis For The Allosteric Interference Of 2e-15
2y9e_X 758 Structural Basis For The Allosteric Interference Of 4e-05
3myh_X 762 Insights Into The Importance Of Hydrogen Bonding In 2e-15
3myh_X 762 Insights Into The Importance Of Hydrogen Bonding In 4e-05
1yv3_A 762 The Structural Basis Of Blebbistatin Inhibition And 2e-15
1yv3_A 762 The Structural Basis Of Blebbistatin Inhibition And 4e-05
2y0r_X 758 Structural Basis For The Allosteric Interference Of 2e-15
2y0r_X 758 Structural Basis For The Allosteric Interference Of 4e-05
1d0x_A 761 Dictyostelium Myosin S1dc (Motor Domain Fragment) C 2e-15
1d0x_A 761 Dictyostelium Myosin S1dc (Motor Domain Fragment) C 4e-05
1fmv_A 761 Crystal Structure Of The Apo Motor Domain Of Dictyo 2e-15
1fmv_A 761 Crystal Structure Of The Apo Motor Domain Of Dictyo 4e-05
1jwy_A 776 Crystal Structure Of The Dynamin A Gtpase Domain Co 2e-15
1jwy_A 776 Crystal Structure Of The Dynamin A Gtpase Domain Co 4e-05
3mnq_A 788 Crystal Structure Of Myosin-2 Motor Domain In Compl 3e-15
3mnq_A 788 Crystal Structure Of Myosin-2 Motor Domain In Compl 4e-05
1w9k_A 770 Dictyostelium Discoideum Myosin Ii Motor Domain S45 3e-15
1w9k_A 770 Dictyostelium Discoideum Myosin Ii Motor Domain S45 4e-05
2xel_A 776 Molecular Mechanism Of Pentachloropseudilin Mediate 3e-15
2xel_A 776 Molecular Mechanism Of Pentachloropseudilin Mediate 4e-05
2jhr_A 788 Crystal Structure Of Myosin-2 Motor Domain In Compl 3e-15
2jhr_A 788 Crystal Structure Of Myosin-2 Motor Domain In Compl 4e-05
2xo8_A 776 Crystal Structure Of Myosin-2 In Complex With Tribr 3e-15
2xo8_A 776 Crystal Structure Of Myosin-2 In Complex With Tribr 4e-05
1w9l_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 3e-15
1w9l_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 4e-05
1w9j_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 3e-15
1w9j_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 4e-05
1w9i_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 3e-15
1w9i_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 4e-05
1mmn_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 5e-15
1mmn_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 4e-05
1mmg_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 1e-14
1mmg_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 4e-05
1g8x_A 1010 Structure Of A Genetically Engineered Molecular Mot 1e-14
1g8x_A 1010 Structure Of A Genetically Engineered Molecular Mot 4e-05
1lvk_A 762 X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N 1e-14
1lvk_A 762 X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N 4e-05
1mmd_A 762 Truncated Head Of Myosin From Dictyostelium Discoid 1e-14
1mmd_A 762 Truncated Head Of Myosin From Dictyostelium Discoid 4e-05
2ycu_A 995 Crystal Structure Of Human Non Muscle Myosin 2c In 3e-09
2dfs_A 1080 3-D Structure Of Myosin-V Inhibited State Length = 1e-07
1oe9_A 795 Crystal Structure Of Myosin V Motor With Essential 6e-07
1w8j_A 766 Crystal Structure Of Myosin V Motor Domain - Nucleo 6e-07
4a7f_C 697 Structure Of The Actin-Tropomyosin-Myosin Complex ( 3e-06
1lkx_A 697 Motor Domain Of Myoe, A Class-I Myosin Length = 697 1e-05
3l9i_A 814 Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant 4e-05
4e7s_A 798 Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke Stat 2e-04
4e7z_A 798 Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal F 2e-04
4dbr_A 786 Myosin Vi D179y (md) Pre-powerstroke State Length = 2e-04
2v26_A 784 Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) L 2e-04
4anj_A 1052 Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke St 2e-04
4dbq_A 788 Myosin Vi D179y (md-insert2-cam, Delta-insert1) Pos 4e-04
2x51_A 789 M6 Delta Insert1 Length = 789 4e-04
2vas_A 788 Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigo 4e-04
2bki_A 858 Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal St 5e-04
4dbp_A 814 Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal 5e-04
2bkh_A 814 Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc 5e-04
>pdb|4DB1|A Chain A, Cardiac Human Myosin S1dc, Beta Isoform Complexed With Mn-Amppnp Length = 783 Back     alignment and structure 
Iteration: 1

 Score =  150 bits (380), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 69/137 (50%), Positives = 95/137 (69%)
Query: 1   MCMLTNDIYDYYNVSQGKITIPGMDDGEEFQLTDQAFDILGFTKEEKENVYKITASVMHM 60
           M ++TN+ YDY  +SQG+ T+  +DD EE   TD AFD+LGFT EEK ++YK+T ++MH 
Sbjct: 300 MLLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTSEEKNSMYKLTGAIMHF 359
Query: 61  GGMKFKQRGREEQAEPDGTEEGDRVSKLLGVDSQQLYTNLVKPRIKVGNEFVTQGRNVNQ 120
           G MKFK + REEQAEPDGTEE D+ + L+G++S  L   L  PR+KVGNE+VT+G+NV Q
Sbjct: 360 GNMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQ 419
Query: 121 QAFDILGFTKEEKENVY 137
             +      K   E ++
Sbjct: 420 VIYATGALAKAVYERMF 436
>pdb|4DB1|A Chain A, Cardiac Human Myosin S1dc, Beta Isoform Complexed With Mn-Amppnp Length = 783 Back     alignment and structure
>pdb|1QVI|A Chain A, Crystal Structure Of Scallop Myosin S1 In The Pre-Power Stroke State To 2.6 Angstrom Resolution: Flexibility And Function In The Head Length = 840 Back     alignment and structure
>pdb|1QVI|A Chain A, Crystal Structure Of Scallop Myosin S1 In The Pre-Power Stroke State To 2.6 Angstrom Resolution: Flexibility And Function In The Head Length = 840 Back     alignment and structure
>pdb|1DFK|A Chain A, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 830 Back     alignment and structure
>pdb|1DFK|A Chain A, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 830 Back     alignment and structure
>pdb|1DFL|A Chain A, Scallop Myosin S1 Complexed With Mgadp:vanadate-Transition State Length = 831 Back     alignment and structure
>pdb|1DFL|A Chain A, Scallop Myosin S1 Complexed With Mgadp:vanadate-Transition State Length = 831 Back     alignment and structure
>pdb|1KK7|A Chain A, Scallop Myosin In The Near Rigor Conformation Length = 837 Back     alignment and structure
>pdb|1KK7|A Chain A, Scallop Myosin In The Near Rigor Conformation Length = 837 Back     alignment and structure
>pdb|1B7T|A Chain A, Myosin Digested By Papain Length = 835 Back     alignment and structure
>pdb|1B7T|A Chain A, Myosin Digested By Papain Length = 835 Back     alignment and structure
>pdb|2EC6|A Chain A, Placopecten Striated Muscle Myosin Ii Length = 838 Back     alignment and structure
>pdb|2EC6|A Chain A, Placopecten Striated Muscle Myosin Ii Length = 838 Back     alignment and structure
>pdb|2OS8|A Chain A, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 840 Back     alignment and structure
>pdb|2OS8|A Chain A, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 840 Back     alignment and structure
>pdb|2MYS|A Chain A, Myosin Subfragment-1, Alpha Carbon Coordinates Only For The Two Light Chains Length = 843 Back     alignment and structure
>pdb|2MYS|A Chain A, Myosin Subfragment-1, Alpha Carbon Coordinates Only For The Two Light Chains Length = 843 Back     alignment and structure
>pdb|1M8Q|A Chain A, Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle Length = 840 Back     alignment and structure
>pdb|1M8Q|A Chain A, Molecular Models Of Averaged Rigor Crossbridges From Tomograms Of Insect Flight Muscle Length = 840 Back     alignment and structure
>pdb|3I5G|A Chain A, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 839 Back     alignment and structure
>pdb|3I5G|A Chain A, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 839 Back     alignment and structure
>pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184 Back     alignment and structure
>pdb|3DTP|B Chain B, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 973 Back     alignment and structure
>pdb|3DTP|A Chain A, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 971 Back     alignment and structure
>pdb|3J04|A Chain A, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 909 Back     alignment and structure
>pdb|1BR2|A Chain A, Smooth Muscle Myosin Motor Domain Complexed With Mgadp.Alf4 Length = 791 Back     alignment and structure
>pdb|1BR1|A Chain A, Smooth Muscle Myosin Motor Domain-Essential Light Chain Complex With Mgadp.Alf4 Bound At The Active Site Length = 820 Back     alignment and structure
>pdb|2X9H|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentachlorocarbazole Length = 695 Back     alignment and structure
>pdb|2X9H|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentachlorocarbazole Length = 695 Back     alignment and structure
>pdb|3MKD|A Chain A, Crystal Structure Of Myosin-2 Dictyostelium Discoideum Motor Domain S456y Mutant In Complex With Adp-Orthovanadate Length = 692 Back     alignment and structure
>pdb|3MKD|A Chain A, Crystal Structure Of Myosin-2 Dictyostelium Discoideum Motor Domain S456y Mutant In Complex With Adp-Orthovanadate Length = 692 Back     alignment and structure
>pdb|1MMA|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1MMA|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|2AKA|A Chain A, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 776 Back     alignment and structure
>pdb|2AKA|A Chain A, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 776 Back     alignment and structure
>pdb|2Y9E|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 Back     alignment and structure
>pdb|2Y9E|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 Back     alignment and structure
>pdb|3MYH|X Chain X, Insights Into The Importance Of Hydrogen Bonding In The Gamma- Phosphate Binding Pocket Of Myosin: Structural And Functional Studies Of Ser236 Length = 762 Back     alignment and structure
>pdb|3MYH|X Chain X, Insights Into The Importance Of Hydrogen Bonding In The Gamma- Phosphate Binding Pocket Of Myosin: Structural And Functional Studies Of Ser236 Length = 762 Back     alignment and structure
>pdb|1YV3|A Chain A, The Structural Basis Of Blebbistatin Inhibition And Specificity For Myosin Ii Length = 762 Back     alignment and structure
>pdb|1YV3|A Chain A, The Structural Basis Of Blebbistatin Inhibition And Specificity For Myosin Ii Length = 762 Back     alignment and structure
>pdb|2Y0R|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 Back     alignment and structure
>pdb|2Y0R|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 Back     alignment and structure
>pdb|1D0X|A Chain A, Dictyostelium Myosin S1dc (Motor Domain Fragment) Complexed With M-Nitrophenyl Aminoethyldiphosphate Beryllium Trifluoride. Length = 761 Back     alignment and structure
>pdb|1D0X|A Chain A, Dictyostelium Myosin S1dc (Motor Domain Fragment) Complexed With M-Nitrophenyl Aminoethyldiphosphate Beryllium Trifluoride. Length = 761 Back     alignment and structure
>pdb|1FMV|A Chain A, Crystal Structure Of The Apo Motor Domain Of Dictyostellium Myosin Ii Length = 761 Back     alignment and structure
>pdb|1FMV|A Chain A, Crystal Structure Of The Apo Motor Domain Of Dictyostellium Myosin Ii Length = 761 Back     alignment and structure
>pdb|1JWY|A Chain A, Crystal Structure Of The Dynamin A Gtpase Domain Complexed With Gdp, Determined As Myosin Fusion Length = 776 Back     alignment and structure
>pdb|1JWY|A Chain A, Crystal Structure Of The Dynamin A Gtpase Domain Complexed With Gdp, Determined As Myosin Fusion Length = 776 Back     alignment and structure
>pdb|3MNQ|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp- Metavanadate And Resveratrol Length = 788 Back     alignment and structure
>pdb|3MNQ|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp- Metavanadate And Resveratrol Length = 788 Back     alignment and structure
>pdb|1W9K|A Chain A, Dictyostelium Discoideum Myosin Ii Motor Domain S456e With Bound Mgadp-Befx Length = 770 Back     alignment and structure
>pdb|1W9K|A Chain A, Dictyostelium Discoideum Myosin Ii Motor Domain S456e With Bound Mgadp-Befx Length = 770 Back     alignment and structure
>pdb|2XEL|A Chain A, Molecular Mechanism Of Pentachloropseudilin Mediated Inhibition Of Myosin Motor Activity Length = 776 Back     alignment and structure
>pdb|2XEL|A Chain A, Molecular Mechanism Of Pentachloropseudilin Mediated Inhibition Of Myosin Motor Activity Length = 776 Back     alignment and structure
>pdb|2JHR|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentabromopseudilin Length = 788 Back     alignment and structure
>pdb|2JHR|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentabromopseudilin Length = 788 Back     alignment and structure
>pdb|2XO8|A Chain A, Crystal Structure Of Myosin-2 In Complex With Tribromodichloropseudilin Length = 776 Back     alignment and structure
>pdb|2XO8|A Chain A, Crystal Structure Of Myosin-2 In Complex With Tribromodichloropseudilin Length = 776 Back     alignment and structure
>pdb|1W9L|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456e Bound With Mgadp-Alf4 Length = 770 Back     alignment and structure
>pdb|1W9L|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456e Bound With Mgadp-Alf4 Length = 770 Back     alignment and structure
>pdb|1W9J|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Alf4 Length = 770 Back     alignment and structure
>pdb|1W9J|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Alf4 Length = 770 Back     alignment and structure
>pdb|1W9I|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Befx Length = 770 Back     alignment and structure
>pdb|1W9I|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Befx Length = 770 Back     alignment and structure
>pdb|1MMN|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1MMN|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1MMG|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1MMG|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1G8X|A Chain A, Structure Of A Genetically Engineered Molecular Motor Length = 1010 Back     alignment and structure
>pdb|1G8X|A Chain A, Structure Of A Genetically Engineered Molecular Motor Length = 1010 Back     alignment and structure
>pdb|1LVK|A Chain A, X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N- Methylanthraniloyl) Nucleotide Bound To Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1LVK|A Chain A, X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N- Methylanthraniloyl) Nucleotide Bound To Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1MMD|A Chain A, Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mgadp-Bef3 Length = 762 Back     alignment and structure
>pdb|1MMD|A Chain A, Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mgadp-Bef3 Length = 762 Back     alignment and structure
>pdb|2YCU|A Chain A, Crystal Structure Of Human Non Muscle Myosin 2c In Pre-power Stroke State Length = 995 Back     alignment and structure
>pdb|2DFS|A Chain A, 3-D Structure Of Myosin-V Inhibited State Length = 1080 Back     alignment and structure
>pdb|1OE9|A Chain A, Crystal Structure Of Myosin V Motor With Essential Light Chain - Nucleotide-Free Length = 795 Back     alignment and structure
>pdb|1W8J|A Chain A, Crystal Structure Of Myosin V Motor Domain - Nucleotide-Free Length = 766 Back     alignment and structure
>pdb|4A7F|C Chain C, Structure Of The Actin-Tropomyosin-Myosin Complex (Rigor Atm 3) Length = 697 Back     alignment and structure
>pdb|1LKX|A Chain A, Motor Domain Of Myoe, A Class-I Myosin Length = 697 Back     alignment and structure
>pdb|3L9I|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant Crystal Structure Length = 814 Back     alignment and structure
>pdb|4E7S|A Chain A, Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke State Length = 798 Back     alignment and structure
>pdb|4E7Z|A Chain A, Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal Form Length = 798 Back     alignment and structure
>pdb|4DBR|A Chain A, Myosin Vi D179y (md) Pre-powerstroke State Length = 786 Back     alignment and structure
>pdb|2V26|A Chain A, Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) Length = 784 Back     alignment and structure
>pdb|4ANJ|A Chain A, Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke State (Mg.Adp.Alf4) Length = 1052 Back     alignment and structure
>pdb|4DBQ|A Chain A, Myosin Vi D179y (md-insert2-cam, Delta-insert1) Post-rigor State Length = 788 Back     alignment and structure
>pdb|2X51|A Chain A, M6 Delta Insert1 Length = 789 Back     alignment and structure
>pdb|2VAS|A Chain A, Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigor State Length = 788 Back     alignment and structure
>pdb|2BKI|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal Structure Length = 858 Back     alignment and structure
>pdb|4DBP|A Chain A, Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal Structure Length = 814 Back     alignment and structure
>pdb|2BKH|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 814 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query166
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 3e-51
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 1e-17
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 3e-50
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 3e-17
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 3e-44
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 2e-16
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 2e-42
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 7e-16
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 2e-42
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 4e-16
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-42
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-15
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 3e-42
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 3e-13
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 5e-41
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 2e-15
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 8e-39
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 2e-12
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 4e-34
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 6e-13
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Length = 783 Back     alignment and structure
 Score =  173 bits (441), Expect = 3e-51
 Identities = 67/120 (55%), Positives = 90/120 (75%)

Query: 1   MCMLTNDIYDYYNVSQGKITIPGMDDGEEFQLTDQAFDILGFTKEEKENVYKITASVMHM 60
           M ++TN+ YDY  +SQG+ T+  +DD EE   TD AFD+LGFT EEK ++YK+T ++MH 
Sbjct: 300 MLLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTSEEKNSMYKLTGAIMHF 359

Query: 61  GGMKFKQRGREEQAEPDGTEEGDRVSKLLGVDSQQLYTNLVKPRIKVGNEFVTQGRNVNQ 120
           G MKFK + REEQAEPDGTEE D+ + L+G++S  L   L  PR+KVGNE+VT+G+NV Q
Sbjct: 360 GNMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQ 419
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Length = 783 Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Length = 795 Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Length = 795 Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Length = 770 Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Length = 770 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Length = 697 Back     alignment and structure
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Length = 697 Back     alignment and structure
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Length = 784 Back     alignment and structure
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Length = 784 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query166
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 100.0
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 100.0
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 100.0
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 100.0
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 100.0
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 100.0
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 100.0
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 100.0
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 100.0
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 100.0
4anj_A 1052 Unconventional myosin-VI, green fluorescent prote; 100.0
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Back     alignment and structure
Probab=100.00  E-value=3.1e-40  Score=301.05  Aligned_cols=148  Identities=45%  Similarity=0.675  Sum_probs=135.5

Q ss_pred             CCCCCCCCccccccCCCCCCCCCCcHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHhhcCceEeecCCCCccccCCchh
Q psy2669           2 CMLTNDIYDYYNVSQGKITIPGMDDGEEFQLTDQAFDILGFTKEEKENVYKITASVMHMGGMKFKQRGREEQAEPDGTEE   81 (166)
Q Consensus         2 l~L~~~~~~y~yL~~~~~~~~~~dD~~~f~~~~~al~~lg~~~~e~~~i~~ilaaILhLGNi~F~~~~~~~~~~v~~~~~   81 (166)
                      |+|..+|++|+||++|+..++++||+++|+++++||++|||+++|+..||+|||||||||||+|.+.++++.+.+.+.+.
T Consensus       300 l~L~~~~~~y~yL~~g~~~~~~~dD~~~f~~~~~Am~~lGfs~~e~~~i~~ilAaILhLGNi~F~~~~~~~~~~~~~~~~  379 (837)
T 1kk8_A          300 MLVTPDSGLYSFINQGCLTVDNIDDVEEFKLCDEAFDILGFTKEEKQSMFKCTASILHMGEMKFKQRPREEQAESDGTAE  379 (837)
T ss_dssp             HTCCSCGGGCTTTCSSCSCBTTBCHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHTTCCEEC----CCCEESCSHH
T ss_pred             hCCCCChhhcccccCCCcccCCcChHHHHHHHHHHHHhcCcCHHHHHHHHHHHHHHHhhccceEEecCCCCccccCCHHH
Confidence            67878999999999999899999999999999999999999999999999999999999999999876567888999999


Q ss_pred             HHHHHhhhCCCHHHHHhhhccceeeeCCeeEEecCChhHHHHhhhhhhHHHHHHHHHHHHHHHhccCc
Q psy2669          82 GDRVSKLLGVDSQQLYTNLVKPRIKVGNEFVTQGRNVNQQAFDILGFTKEEKENVYKITASVMHMGGM  149 (166)
Q Consensus        82 l~~~a~LLgv~~~~L~~~L~~~~~~~~~e~~~~~~~~~~A~~~rdalaK~lY~~LF~wiV~~IN~~~~  149 (166)
                      ++.+|+||||++++|.++|++|++.+|+|.++++++++||..+||||||+||+|||+|||.|||.++.
T Consensus       380 l~~~a~LLgv~~~~L~~aL~~~~~~~~~e~v~~~~~~~qA~~~rdalaK~lY~rLF~wlV~~IN~~l~  447 (837)
T 1kk8_A          380 AEKVAFLCGINAGDLLKALLKPKVKVGTEMVTKGQNMNQVVNSVGALAKSLYDRMFNWLVRRVNKTLD  447 (837)
T ss_dssp             HHHHHHHHTSCHHHHHHHHHSCEEC----CEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC
T ss_pred             HHHHHHHHCCCHHHHHHHhcCcEEEcCCceEEeCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999864
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Back     alignment and structure
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Back     alignment and structure
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Back     alignment and structure
>4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 166
d2mysa2 794 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain 6e-29
d2mysa2 794 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain 2e-09
d1kk8a2 789 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain 3e-28
d1kk8a2 789 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain 3e-09
d1br2a2 710 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chick 2e-25
d1br2a2 710 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chick 3e-07
d1d0xa2 712 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain 9e-25
d1d0xa2 712 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain 5e-09
d1w7ja2 730 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chick 9e-24
d1w7ja2 730 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chick 3e-08
d1lkxa_ 684 c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli 4e-23
d1lkxa_ 684 c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli 6e-08
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]

 Score =  109 bits (273), Expect = 6e-29
 Identities = 64/130 (49%), Positives = 90/130 (69%)

Query: 1   MCMLTNDIYDYYNVSQGKITIPGMDDGEEFQLTDQAFDILGFTKEEKENVYKITASVMHM 60
           M ++T + YDY+ VS+G+IT+P +DD EE   TD A DILGF+ +EK  +YK+T +VMH 
Sbjct: 253 MLLITTNPYDYHYVSEGEITVPSIDDQEELMATDSAIDILGFSADEKTAIYKLTGAVMHY 312

Query: 61  GGMKFKQRGREEQAEPDGTEEGDRVSKLLGVDSQQLYTNLVKPRIKVGNEFVTQGRNVNQ 120
           G +KFKQ+ REEQAEPDGTE  D+ + L+G++S +L   L  PR+ VGNE VT+G  V++
Sbjct: 313 GNLKFKQKQREEQAEPDGTEVADKAAYLMGLNSAELLKALCYPRVGVGNEAVTKGETVSE 372

Query: 121 QAFDILGFTK 130
               +    K
Sbjct: 373 VHNSVGALAK 382
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 710 Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 710 Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Length = 712 Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Length = 712 Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Length = 730 Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Length = 730 Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684 Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query166
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 100.0
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 100.0
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 100.0
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 100.0
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 100.0
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 100.0
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidu 86.06
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Dictyostelium discoideum [TaxId: 44689]

Probab=100.00  E-value=7e-37  Score=273.63  Aligned_cols=147  Identities=27%  Similarity=0.426  Sum_probs=137.4

Q ss_pred             CCCCCCCCccccccCC-CCCCCCCCcHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHhhcCceEeecCCCCccccCCch
Q psy2669           2 CMLTNDIYDYYNVSQG-KITIPGMDDGEEFQLTDQAFDILGFTKEEKENVYKITASVMHMGGMKFKQRGREEQAEPDGTE   80 (166)
Q Consensus         2 l~L~~~~~~y~yL~~~-~~~~~~~dD~~~f~~~~~al~~lg~~~~e~~~i~~ilaaILhLGNi~F~~~~~~~~~~v~~~~   80 (166)
                      |+| .++++|+||+++ +..++++||+++|+.++.||+.|||+++|+..||+|||||||||||+|.+.+ .+.+.+.+..
T Consensus       249 ~~l-~~~~~~~yL~~~~~~~~~~~dd~~~f~~~~~al~~lgfs~~e~~~i~~iLaaILhLGNi~F~~~~-~~~~~i~~~~  326 (712)
T d1d0xa2         249 LHL-AGPESFNYLNQSGCVDIKGVSDSEEFKITRQAMDIVGFSQEEQMSIFKIIAGILHLGNIKFEKGA-GEGAVLKDKT  326 (712)
T ss_dssp             HTC-CCGGGCTTTSSSSCCCCTTCCHHHHHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHHTCCCBCCS-SSSCBCSCCH
T ss_pred             hCC-CCchhcccccCCCCcccCCcChHHHHHHHHHHHHHcCCCHHHHHHHHHHHHHHHhhccceEeecC-CcceecCCHH
Confidence            456 678999999987 4788999999999999999999999999999999999999999999998753 4677889999


Q ss_pred             hHHHHHhhhCCCHHHHHhhhccceeeeCCeeEEecCChhHHHHhhhhhhHHHHHHHHHHHHHHHhccCcc
Q psy2669          81 EGDRVSKLLGVDSQQLYTNLVKPRIKVGNEFVTQGRNVNQQAFDILGFTKEEKENVYKITASVMHMGGMK  150 (166)
Q Consensus        81 ~l~~~a~LLgv~~~~L~~~L~~~~~~~~~e~~~~~~~~~~A~~~rdalaK~lY~~LF~wiV~~IN~~~~~  150 (166)
                      .++.+|+||||++++|.++|+++++.++|+.+.+++++++|..+||+|||+||++||+|||.+||..+.+
T Consensus       327 ~l~~~a~LLgv~~~~L~~~L~~~~~~~~~e~i~~~l~~~~A~~~rdalaK~LY~~LF~wiV~~IN~~l~~  396 (712)
T d1d0xa2         327 ALNAASTVFGVNPSVLEKALMEPRILAGRDLVAQHLNVEKSSSSRDALVKALYGRLFLWLVKKINNVLCQ  396 (712)
T ss_dssp             HHHHHHHHHTCCHHHHHHHHHSCEEEETTEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC
T ss_pred             HHHHHHHHhCCChhHhhhhhcceeeccCCceEEecCCHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhccc
Confidence            9999999999999999999999999999999999999999999999999999999999999999997643
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure