Psyllid ID: psy2693


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
MEILAKFQIIPVATQARKLLAICNANPTDEHTIDYDEHNPFQICARSYTPIYHGRESEACVYCGASYLPKYKGELCAVCTVSVIDTHRNAYGLQICAGLMKSDVINNIDSSLAATEHWMMKI
cccccccccHHHHHHHHHHHHHHHccccccEEEcccccccEEEEccccEEEccccccEEccccccEEcccccccccccccEEEEccccccccEEEEccccHHHHHHccHHHHHHHHHHcccc
cHHHHHccccHHHHHHHHHHHHHHccccccEEEEccccccEEEEEccccEcccccccEEcccccccccccccccEcEEEEEEEEcccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHcc
meilakfqiIPVATQARKLLAICnanptdehtidydehnpfqicarsytpiyhgreseacvycgasylpkykgelCAVCTVSVIDTHRNAYGLQICAGLMKSDVINNIDSSLAATEHWMMKI
meilakfqiiPVATQARKLLAICNANPTDEHTIDYDEHNPFQICARSYTPIYHGRESEACVYCGASYLPKYKGELCAVCTVSVIDTHRNAYGLQICAGLMKSDVINNIDSslaatehwmmki
MEILAKFQIIPVATQARKLLAICNANPTDEHTIDYDEHNPFQICARSYTPIYHGRESEACVYCGASYLPKYKGELCAVCTVSVIDTHRNAYGLQICAGLMKSDVINNIDSSLAATEHWMMKI
**ILAKFQIIPVATQARKLLAICNANPTDEHTIDYDEHNPFQICARSYTPIYHGRESEACVYCGASYLPKYKGELCAVCTVSVIDTHRNAYGLQICAGLMKSDVINNIDSSLAAT*******
MEI************************TDEHTIDYDEHNPFQICARSYTPIYHGRESEACVYCGASYLPKYKGELCAVCTVSVIDTHRNAYGLQICAGLM**********SLAATEHWMMKI
MEILAKFQIIPVATQARKLLAICNANPTDEHTIDYDEHNPFQICARSYTPIYHGRESEACVYCGASYLPKYKGELCAVCTVSVIDTHRNAYGLQICAGLMKSDVINNIDSSLAATEHWMMKI
MEILAKFQIIPVATQARKLLAICNANPTDEHTIDYDEHNPFQICARSYTPIYHGRESEACVYCGASYLPKYKGELCAVCTVSVIDTHRNAYGLQICAGLMKSDVINNIDSSLAATEHWMMKI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEILAKFQIIPVATQARKLLAICNANPTDEHTIDYDEHNPFQICARSYTPIYHGRESEACVYCGASYLPKYKGELCAVCTVSVIDTHRNAYGLQICAGLMKSDVINNIDSSLAATEHWMMKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query122 2.2.26 [Sep-21-2011]
Q279541224 Coatomer subunit alpha OS yes N/A 0.672 0.066 0.5 1e-18
P536211224 Coatomer subunit alpha OS yes N/A 0.672 0.066 0.5 1e-18
Q8CIE61224 Coatomer subunit alpha OS yes N/A 0.672 0.066 0.5 6e-18
Q55FR91221 Coatomer subunit alpha OS yes N/A 0.672 0.067 0.453 2e-15
Q94A401216 Coatomer subunit alpha-1 yes N/A 0.606 0.060 0.402 1e-13
Q9SJT91218 Coatomer subunit alpha-2 no N/A 0.647 0.064 0.419 2e-13
Q9AUR71218 Coatomer subunit alpha-2 no N/A 0.663 0.066 0.352 1e-11
Q9AUR81218 Coatomer subunit alpha-1 no N/A 0.639 0.064 0.358 1e-11
Q0J3D91218 Coatomer subunit alpha-3 no N/A 0.639 0.064 0.358 4e-11
Q96WV51207 Putative coatomer subunit yes N/A 0.606 0.061 0.378 6e-10
>sp|Q27954|COPA_BOVIN Coatomer subunit alpha OS=Bos taurus GN=COPA PE=1 SV=1 Back     alignment and function desciption
 Score = 92.0 bits (227), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 56/84 (66%), Gaps = 2/84 (2%)

Query: 12   VATQARKLLAICNANPTDEHTIDYDEHNPFQICARSYTPIYHGRESEACVYCGASYLPKY 71
            VA Q RK+L+ C  NPTD + ++YD HNPF ICA SY PIY G+  E C   GA Y P++
Sbjct: 1137 VAQQTRKILSACEKNPTDAYQLNYDMHNPFDICAASYRPIYRGKPVEKCPLSGACYSPEF 1196

Query: 72   KGELCAVCTVSVIDTHRNAYGLQI 95
            KG++C V TV+ I   ++  GL+I
Sbjct: 1197 KGQICKVTTVTEIG--KDVIGLRI 1218




Xenin stimulates exocrine pancreatic secretion. It inhibits pentagastrin-stimulated secretion of acid, to induce exocrine pancreatic secretion and to affect small and large intestinal motility. In the gut, xenin interacts with the neurotensin receptor.
Bos taurus (taxid: 9913)
>sp|P53621|COPA_HUMAN Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2 Back     alignment and function description
>sp|Q8CIE6|COPA_MOUSE Coatomer subunit alpha OS=Mus musculus GN=Copa PE=1 SV=2 Back     alignment and function description
>sp|Q55FR9|COPA_DICDI Coatomer subunit alpha OS=Dictyostelium discoideum GN=copa PE=3 SV=1 Back     alignment and function description
>sp|Q94A40|COPA1_ARATH Coatomer subunit alpha-1 OS=Arabidopsis thaliana GN=At1g62020 PE=1 SV=2 Back     alignment and function description
>sp|Q9SJT9|COPA2_ARATH Coatomer subunit alpha-2 OS=Arabidopsis thaliana GN=At2g21390 PE=2 SV=1 Back     alignment and function description
>sp|Q9AUR7|COPA2_ORYSJ Coatomer subunit alpha-2 OS=Oryza sativa subsp. japonica GN=Os03g0711500 PE=2 SV=1 Back     alignment and function description
>sp|Q9AUR8|COPA1_ORYSJ Coatomer subunit alpha-1 OS=Oryza sativa subsp. japonica GN=Os03g0711400 PE=2 SV=1 Back     alignment and function description
>sp|Q0J3D9|COPA3_ORYSJ Coatomer subunit alpha-3 OS=Oryza sativa subsp. japonica GN=Os09g0127800 PE=2 SV=1 Back     alignment and function description
>sp|Q96WV5|COPA_SCHPO Putative coatomer subunit alpha OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBPJ4664.04 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
91094941 1220 PREDICTED: similar to coatomer [Triboliu 0.672 0.067 0.547 2e-21
289629216 1230 coatomer protein complex subunit alpha [ 0.680 0.067 0.552 5e-21
157108446 1223 coatomer [Aedes aegypti] gi|108868541|gb 0.721 0.071 0.544 5e-21
157134451 1227 coatomer [Aedes aegypti] gi|108870473|gb 0.721 0.071 0.544 5e-21
170050521 1227 coatomer subunit alpha [Culex quinquefas 0.721 0.071 0.544 6e-21
242002678 1018 coatomer, alpha chain, putative [Ixodes 0.672 0.080 0.5 2e-20
156380509 1224 predicted protein [Nematostella vectensi 0.672 0.066 0.511 4e-20
31236603 1231 AGAP010251-PA [Anopheles gambiae str. PE 0.721 0.071 0.511 3e-19
242015300 1222 coatomer alpha subunit, putative [Pedicu 0.688 0.068 0.523 4e-19
393905469 1237 proxenin [Loa loa] 0.680 0.067 0.494 7e-19
>gi|91094941|ref|XP_967472.1| PREDICTED: similar to coatomer [Tribolium castaneum] gi|270016760|gb|EFA13206.1| hypothetical protein TcasGA2_TC016033 [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  106 bits (264), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 46/84 (54%), Positives = 61/84 (72%), Gaps = 2/84 (2%)

Query: 12   VATQARKLLAICNANPTDEHTIDYDEHNPFQICARSYTPIYHGRESEACVYCGASYLPKY 71
            VA+Q RK+L +C +N TDE  + YDEHNPF +C  SYTPIY G+  E C +CG SYLPKY
Sbjct: 1133 VASQTRKILQVCESNLTDELQLHYDEHNPFNLCGYSYTPIYRGKAEEKCSFCGTSYLPKY 1192

Query: 72   KGELCAVCTVSVIDTHRNAYGLQI 95
            KG +C +CTV+ I   +++ GL+I
Sbjct: 1193 KGAMCCICTVAEIG--KDSIGLRI 1214




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|289629216|ref|NP_001166192.1| coatomer protein complex subunit alpha [Bombyx mori] gi|284027820|gb|ADB66734.1| coatomer protein complex subunit alpha [Bombyx mori] Back     alignment and taxonomy information
>gi|157108446|ref|XP_001650231.1| coatomer [Aedes aegypti] gi|108868541|gb|EAT32766.1| AAEL015001-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|157134451|ref|XP_001663309.1| coatomer [Aedes aegypti] gi|108870473|gb|EAT34698.1| AAEL013098-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170050521|ref|XP_001861349.1| coatomer subunit alpha [Culex quinquefasciatus] gi|167872144|gb|EDS35527.1| coatomer subunit alpha [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|242002678|ref|XP_002435982.1| coatomer, alpha chain, putative [Ixodes scapularis] gi|215499318|gb|EEC08812.1| coatomer, alpha chain, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|156380509|ref|XP_001631811.1| predicted protein [Nematostella vectensis] gi|156218857|gb|EDO39748.1| predicted protein [Nematostella vectensis] Back     alignment and taxonomy information
>gi|31236603|ref|XP_319442.1| AGAP010251-PA [Anopheles gambiae str. PEST] gi|21302213|gb|EAA14358.1| AGAP010251-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|242015300|ref|XP_002428302.1| coatomer alpha subunit, putative [Pediculus humanus corporis] gi|212512887|gb|EEB15564.1| coatomer alpha subunit, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|393905469|gb|EJD73980.1| proxenin [Loa loa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query122
ZFIN|ZDB-GENE-020905-21226 copa "coatomer protein complex 0.672 0.066 0.523 4.1e-18
UNIPROTKB|F1PU931214 COPA "Coatomer subunit alpha" 0.672 0.067 0.511 8.5e-18
RGD|1310525568 Copa "coatomer protein complex 0.672 0.144 0.5 1.8e-17
UNIPROTKB|Q279541224 COPA "Coatomer subunit alpha" 0.672 0.066 0.5 1.8e-17
UNIPROTKB|P536211224 COPA "Coatomer subunit alpha" 0.672 0.066 0.5 1.8e-17
UNIPROTKB|F1RJX81224 COPA "Uncharacterized protein" 0.672 0.066 0.5 1.8e-17
UNIPROTKB|H9L3L21134 LOC100859596 "Uncharacterized 0.672 0.072 0.488 3.4e-17
UNIPROTKB|H9KZL31169 LOC100859596 "Uncharacterized 0.672 0.070 0.488 3.5e-17
MGI|MGI:13344621224 Copa "coatomer protein complex 0.672 0.066 0.5 6.1e-17
UNIPROTKB|G3V6T11224 Copa "Protein Copa" [Rattus no 0.672 0.066 0.5 6.1e-17
ZFIN|ZDB-GENE-020905-2 copa "coatomer protein complex, subunit alpha" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 233 (87.1 bits), Expect = 4.1e-18, P = 4.1e-18
 Identities = 44/84 (52%), Positives = 55/84 (65%)

Query:    12 VATQARKLLAICNANPTDEHTIDYDEHNPFQICARSYTPIYHGRESEACVYCGASYLPKY 71
             VA Q RK+LA C  + TD H ++YD HNPF ICA SYTP+Y GR  E C   GA Y PKY
Sbjct:  1139 VAQQTRKILAACEKSLTDAHQLNYDPHNPFDICAASYTPLYRGRPVEKCPLSGACYCPKY 1198

Query:    72 KGELCAVCTVSVIDTHRNAYGLQI 95
             KGE+C V  V+ I   ++  GL++
Sbjct:  1199 KGEVCRVTQVTEIG--KDVIGLRV 1220




GO:0030117 "membrane coat" evidence=IEA
GO:0005198 "structural molecule activity" evidence=IEA
GO:0016192 "vesicle-mediated transport" evidence=IEA
GO:0030126 "COPI vesicle coat" evidence=IEA
GO:0006886 "intracellular protein transport" evidence=IEA
GO:0030903 "notochord development" evidence=IMP
UNIPROTKB|F1PU93 COPA "Coatomer subunit alpha" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1310525 Copa "coatomer protein complex subunit alpha" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q27954 COPA "Coatomer subunit alpha" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P53621 COPA "Coatomer subunit alpha" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RJX8 COPA "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|H9L3L2 LOC100859596 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|H9KZL3 LOC100859596 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1334462 Copa "coatomer protein complex subunit alpha" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G3V6T1 Copa "Protein Copa" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
pfam06957421 pfam06957, COPI_C, Coatomer (COPI) alpha subunit C 5e-32
>gnl|CDD|219240 pfam06957, COPI_C, Coatomer (COPI) alpha subunit C-terminus Back     alignment and domain information
 Score =  116 bits (291), Expect = 5e-32
 Identities = 44/84 (52%), Positives = 56/84 (66%), Gaps = 2/84 (2%)

Query: 12  VATQARKLLAICNANPTDEHTIDYDEHNPFQICARSYTPIYHGRESEACVYCGASYLPKY 71
           VA QARK+L  C  NPTD H ++YDEHNPF +C  SY PIY G+    C YCGAS+ P +
Sbjct: 334 VAQQARKVLQACEKNPTDAHQLNYDEHNPFVVCGASYVPIYRGKPDVKCPYCGASFSPGF 393

Query: 72  KGELCAVCTVSVIDTHRNAYGLQI 95
           +G LC VC V+ I   ++  GL+I
Sbjct: 394 EGNLCTVCEVAEIG--KDVIGLRI 415


This family represents the C-terminus (approximately 500 residues) of the eukaryotic coatomer alpha subunit. Coatomer (COPI) is a large cytosolic protein complex which forms a coat around vesicles budding from the Golgi apparatus. Such coatomer-coated vesicles have been proposed to play a role in many distinct steps of intracellular transport. Note that many family members also contain the pfam04053 domain. Length = 421

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 122
PF06957422 COPI_C: Coatomer (COPI) alpha subunit C-terminus; 100.0
KOG0292|consensus1202 99.97
COG439162 Uncharacterized protein conserved in bacteria [Fun 92.65
cd0035033 rubredoxin_like Rubredoxin_like; nonheme iron bind 92.6
PRK12496164 hypothetical protein; Provisional 92.2
PF0519136 ADK_lid: Adenylate kinase, active site lid; InterP 91.61
PF1027640 zf-CHCC: Zinc-finger domain; InterPro: IPR019401 Z 91.35
PF1324023 zinc_ribbon_2: zinc-ribbon domain 90.26
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 90.0
PF0827143 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013 88.81
PRK0039846 rpoP DNA-directed RNA polymerase subunit P; Provis 87.31
cd0072934 rubredoxin_SM Rubredoxin, Small Modular nonheme ir 87.25
PRK05452479 anaerobic nitric oxide reductase flavorubredoxin; 86.5
PF1324826 zf-ribbon_3: zinc-ribbon domain 86.18
PF0030147 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubred 86.12
TIGR02300129 FYDLN_acid conserved hypothetical protein TIGR0230 85.08
PF09538108 FYDLN_acid: Protein of unknown function (FYDLN_aci 84.84
PRK00420112 hypothetical protein; Validated 80.61
>PF06957 COPI_C: Coatomer (COPI) alpha subunit C-terminus; InterPro: IPR010714 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
Probab=100.00  E-value=2.1e-43  Score=302.70  Aligned_cols=98  Identities=54%  Similarity=0.981  Sum_probs=72.3

Q ss_pred             cccccCCChHHHHHHHHHHHHHhcCCCCceeecCCCCCCeeeecccceeccCCCcceecCCCCceecCCCCCcccCcccc
Q psy2693           2 EILAKFQIIPVATQARKLLAICNANPTDEHTIDYDEHNPFQICARSYTPIYHGRESEACVYCGASYLPKYKGELCAVCTV   81 (122)
Q Consensus         2 ~lLel~p~~~va~qArKIl~~ce~~~tDa~eIdYD~~npF~ICa~S~tPIY~G~~~v~CP~CgA~Y~p~~kG~lC~VC~l   81 (122)
                      +|||++|++++++||||||++|||+|||+|+||||+||||+||++||||||+|+++|+||||||+|+|+|||+||+||+|
T Consensus       325 RLLel~p~~~~a~qArKil~~~e~~~tDa~~i~yD~~npF~ICa~s~tPIY~G~~~v~CP~cgA~y~~~~kG~lC~vC~l  404 (422)
T PF06957_consen  325 RLLELNPSPEVAEQARKILQACERNPTDAHEIDYDERNPFDICAASYTPIYRGSPSVKCPYCGAKYHPEYKGQLCPVCEL  404 (422)
T ss_dssp             HHHCT--SCHHHHHHHHHHHHHCCS--BSS--S--TTS-EEEBTTT--EEETTS-EEE-TTT--EEEGGGTTSB-TTTTT
T ss_pred             HHHHcCCCHHHHHHHHHHHHHHhcCCCCceecCCCCCCCceeeecccccccCCCCCeeCCCCCCccChhhCCCCCCCCcc
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeecCCCcccCcceecccch
Q psy2693          82 SVIDTHRNAYGLQICAGLMK  101 (122)
Q Consensus        82 s~IG~~~~a~GLr~~~~~~~  101 (122)
                      ++||  ++++|||++++|+|
T Consensus       405 ~~IG--~~a~GLris~~q~r  422 (422)
T PF06957_consen  405 SEIG--ADASGLRISPSQFR  422 (422)
T ss_dssp             BBTT-----S----SGGG--
T ss_pred             eeeC--CcceeeEecccccC
Confidence            9999  99999999999998



This traffic is bidirectional, to ensure that proteins required to form vesicles are recycled. Vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transfer []. While clathrin mediates endocytic protein transport, and transport from ER to Golgi, coatomers primarily mediate intra-Golgi transport, as well as the reverse Golgi to ER transport of dilysine-tagged proteins []. For example, the coatomer COP1 (coat protein complex 1) is responsible for reverse transport of recycled proteins from Golgi and pre-Golgi compartments back to the ER, while COPII buds vesicles from the ER to the Golgi []. Coatomers reversibly associate with Golgi (non-clathrin-coated) vesicles to mediate protein transport and for budding from Golgi membranes []. Activated small guanine triphosphatases (GTPases) attract coat proteins to specific membrane export sites, thereby linking coatomers to export cargos. As coat proteins polymerise, vesicles are formed and budded from membrane-bound organelles. Coatomer complexes also influence Golgi structural integrity, as well as the processing, activity, and endocytic recycling of LDL receptors. In mammals, coatomer complexes can only be recruited by membranes associated to ADP-ribosylation factors (ARFs), which are small GTP-binding proteins. Coatomer complexes are hetero-oligomers composed of at least an alpha, beta, beta', gamma, delta, epsilon and zeta subunits. This entry represents the C terminus (approximately 500 residues) of the eukaryotic coatomer alpha subunit [, ]. This domain is found along with the IPR006692 from INTERPRO domain. More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0005198 structural molecule activity, 0005515 protein binding, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030126 COPI vesicle coat; PDB: 3MKR_B 3MV2_E 3MKQ_B 3MV3_A.

>KOG0292|consensus Back     alignment and domain information
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center Back     alignment and domain information
>PRK12496 hypothetical protein; Provisional Back     alignment and domain information
>PF05191 ADK_lid: Adenylate kinase, active site lid; InterPro: IPR007862 Adenylate kinases (ADK; 2 Back     alignment and domain information
>PF10276 zf-CHCC: Zinc-finger domain; InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13240 zinc_ribbon_2: zinc-ribbon domain Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF08271 TF_Zn_Ribbon: TFIIB zinc-binding; InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional Back     alignment and domain information
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>PF13248 zf-ribbon_3: zinc-ribbon domain Back     alignment and domain information
>PF00301 Rubredoxin: Rubredoxin; InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier [] Back     alignment and domain information
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300 Back     alignment and domain information
>PF09538 FYDLN_acid: Protein of unknown function (FYDLN_acid); InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues Back     alignment and domain information
>PRK00420 hypothetical protein; Validated Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
3mkr_B320 Crystal Structure Of Yeast AlphaEPSILON-Cop Subcomp 7e-20
3mv3_A325 Crystal Structure Of A-Cop In Complex With E-Cop Le 5e-06
3mv2_A325 Crystal Structure Of A-Cop In Complex With E-Cop Le 6e-06
>pdb|3MKR|B Chain B, Crystal Structure Of Yeast AlphaEPSILON-Cop Subcomplex Of The Copi Vesicular Coat Length = 320 Back     alignment and structure

Iteration: 1

Score = 92.0 bits (227), Expect = 7e-20, Method: Compositional matrix adjust. Identities = 42/84 (50%), Positives = 56/84 (66%), Gaps = 2/84 (2%) Query: 12 VATQARKLLAICNANPTDEHTIDYDEHNPFQICARSYTPIYHGRESEACVYCGASYLPKY 71 VA Q RK+L+ C NPTD + ++YD HNPF ICA SY PIY G+ E C GA Y P++ Sbjct: 233 VAQQTRKILSACEKNPTDAYQLNYDMHNPFDICAASYRPIYRGKPVEKCPLSGACYSPEF 292 Query: 72 KGELCAVCTVSVIDTHRNAYGLQI 95 KG++C V TV+ I ++ GL+I Sbjct: 293 KGQICKVTTVTEIG--KDVIGLRI 314
>pdb|3MV3|A Chain A, Crystal Structure Of A-Cop In Complex With E-Cop Length = 325 Back     alignment and structure
>pdb|3MV2|A Chain A, Crystal Structure Of A-Cop In Complex With E-Cop Length = 325 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query122
3mv2_A325 Coatomer subunit alpha; vesicular membrane coat CO 5e-31
3mkr_B320 Coatomer subunit alpha; tetratricopeptide repeats 4e-30
>3mv2_A Coatomer subunit alpha; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_A Length = 325 Back     alignment and structure
 Score =  111 bits (278), Expect = 5e-31
 Identities = 30/94 (31%), Positives = 45/94 (47%), Gaps = 2/94 (2%)

Query: 2   EILAKFQIIPVATQARKLLAICNANPTDEHTIDYDEHNPFQICARSYTPIYHGRESEACV 61
           E L      P A QARK+    ++  +D   ID+D +  F ICA +Y PIY    S +  
Sbjct: 232 EFLKIISSGPRAEQARKIKNKADSMASDAIPIDFDPYAKFDICAATYKPIYEDTPSVSDP 291

Query: 62  YCGASYLPKYKGELCAVCTVSVIDTHRNAYGLQI 95
             G+ Y+   K ++  +  +S I     A GL+I
Sbjct: 292 LTGSKYVITEKDKIDRIAMISKIG--APASGLRI 323


>3mkr_B Coatomer subunit alpha; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Length = 320 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
3mkr_B320 Coatomer subunit alpha; tetratricopeptide repeats 100.0
3mv2_A325 Coatomer subunit alpha; vesicular membrane coat CO 100.0
6rxn_A46 Rubredoxin; electron transfer(iron-sulfur protein) 88.99
3pwf_A170 Rubrerythrin; non heme iron peroxidases, oxidative 87.55
1yk4_A52 Rubredoxin, RD; electron transport; 0.69A {Pyrococ 85.65
2v3b_B55 Rubredoxin 2, rubredoxin; alkane degradation, iron 85.58
4rxn_A54 Rubredoxin; electron transfer(iron-sulfur protein) 84.87
1dx8_A70 Rubredoxin; electron transport, zinc-substitution; 83.93
2jvm_A80 Uncharacterized protein; alpha+beta, structural ge 83.16
4ayb_P48 DNA-directed RNA polymerase; transferase, multi-su 82.66
2kn9_A81 Rubredoxin; metalloprotein, ssgcid, structural gen 80.98
2jrr_A67 Uncharacterized protein; solution structure, SIR90 80.72
1yuz_A202 Nigerythrin; rubrythrin, rubredoxin, hemerythrin, 80.42
2lcq_A165 Putative toxin VAPC6; PIN domain, Zn ribbon domain 80.31
>3mkr_B Coatomer subunit alpha; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
Probab=100.00  E-value=5.7e-43  Score=290.34  Aligned_cols=98  Identities=44%  Similarity=0.821  Sum_probs=96.3

Q ss_pred             cccccCCChHHHHHHHHHHHHHhcCCCCceeecCCCCCCeeeecccceeccCCCcceecCCCCceecCCCCCcccCcccc
Q psy2693           2 EILAKFQIIPVATQARKLLAICNANPTDEHTIDYDEHNPFQICARSYTPIYHGRESEACVYCGASYLPKYKGELCAVCTV   81 (122)
Q Consensus         2 ~lLel~p~~~va~qArKIl~~ce~~~tDa~eIdYD~~npF~ICa~S~tPIY~G~~~v~CP~CgA~Y~p~~kG~lC~VC~l   81 (122)
                      +|||++|++++++|||||+++|||+|+|+|+||||++|||+||++||||||+|+++|+||||||+|+|+|||++|+||+|
T Consensus       223 rLLel~p~~~~~~qArkil~~ce~~~~da~eidyD~~~~f~iCa~s~tPIY~g~~~v~Cp~cgA~y~~~~kG~lC~vC~l  302 (320)
T 3mkr_B          223 RLLELGPKPEVAQQTRKILSACEKNPTDAYQLNYDMHNPFDICAASYRPIYRGKPVEKCPLSGACYSPEFKGQICKVTTV  302 (320)
T ss_dssp             HHHHTCCCHHHHHHHHHHHHHHHHSCCBSSCCSCCTTSCCCBBTTTCCBCCTTSCCEECTTTCCEECGGGTTSBCTTTSS
T ss_pred             HHHhcCCCHHHHHHHHHHHHHHhcCCCCccccCCCCCCccceecCCCccccCCCCCccCCCCCCeechhhCCCCCCCCcC
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eeecCCCcccCcceecccch
Q psy2693          82 SVIDTHRNAYGLQICAGLMK  101 (122)
Q Consensus        82 s~IG~~~~a~GLr~~~~~~~  101 (122)
                      ++||  ++++|||++..|+|
T Consensus       303 ~~IG--~~~~GL~~~~~~~~  320 (320)
T 3mkr_B          303 TEIG--KDVIGLRISPLQFR  320 (320)
T ss_dssp             BBSS--CCCCCCCCSGGGCC
T ss_pred             cccC--CcccCccccccccC
Confidence            9999  99999999988886



>3mv2_A Coatomer subunit alpha; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_A Back     alignment and structure
>6rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.50A {Desulfovibrio desulfuricans} SCOP: g.41.5.1 Back     alignment and structure
>3pwf_A Rubrerythrin; non heme iron peroxidases, oxidative stress, oxidoreductase; 1.64A {Pyrococcus furiosus} PDB: 3mps_A 3pza_A 3qvd_A 1nnq_A 2hr5_A Back     alignment and structure
>1yk4_A Rubredoxin, RD; electron transport; 0.69A {Pyrococcus abyssi} PDB: 2pya_A 1yk5_A 1bq8_A 1bq9_A* 3kyu_A 3kyv_A 3kyw_A 3kyx_A 3kyy_A 3ryg_A 3rz6_A 3rzt_A 3ss2_A 1brf_A 1caa_A 1cad_A 1vcx_A 1zrp_A 1iu5_A 1iu6_A ... Back     alignment and structure
>2v3b_B Rubredoxin 2, rubredoxin; alkane degradation, iron-sulfur protein, oxidoreductase, ELE transfer, electron transport, FAD, NAD, iron; HET: FAD; 2.45A {Pseudomonas aeruginosa} Back     alignment and structure
>4rxn_A Rubredoxin; electron transfer(iron-sulfur protein); 1.20A {Clostridium pasteurianum} SCOP: g.41.5.1 PDB: 5rxn_A 1bfy_A 1fhh_A 1fhm_A 1irn_A 1iro_A 1r0f_A 1r0g_A 1r0h_A 1r0i_A 1r0j_A 1t9q_A 1c09_A 1b2j_A 1b13_A 1smm_A 1smu_A 1smw_A 1be7_A 1t9o_A ... Back     alignment and structure
>1dx8_A Rubredoxin; electron transport, zinc-substitution; NMR {Guillardia theta} SCOP: g.41.5.1 PDB: 1h7v_A Back     alignment and structure
>2jvm_A Uncharacterized protein; alpha+beta, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Rhodobacter sphaeroides 2} Back     alignment and structure
>4ayb_P DNA-directed RNA polymerase; transferase, multi-subunit, transcription; 3.20A {Sulfolobus shibatae} PDB: 2pmz_P 2wb1_P 2y0s_P 3hkz_P 2waq_P 4b1o_P 4b1p_X Back     alignment and structure
>2kn9_A Rubredoxin; metalloprotein, ssgcid, structural genomics, seattle structural genomics center for infectious electron transport, iron; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>2jrr_A Uncharacterized protein; solution structure, SIR90, structural genomics, PSI-2, protein structure initiative; NMR {Silicibacter pomeroyi} Back     alignment and structure
>1yuz_A Nigerythrin; rubrythrin, rubredoxin, hemerythrin, electron transfer, DIIR center, oxidoreductase; 1.40A {Desulfovibrio vulgaris subsp} SCOP: a.25.1.1 g.41.5.1 PDB: 1yv1_A 1yux_A Back     alignment and structure
>2lcq_A Putative toxin VAPC6; PIN domain, Zn ribbon domain, ribosome biogenesis, metal BIN protein; NMR {Pyrococcus horikoshii} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query122
d1akya238 Microbial and mitochondrial ADK, insert "zinc fing 89.96
d2ak3a237 Microbial and mitochondrial ADK, insert "zinc fing 87.22
d1yuza236 Nigerythrin, C-terminal domain {Desulfovibrio vulg 84.76
d1e4va235 Microbial and mitochondrial ADK, insert "zinc fing 83.99
d1s3ga235 Microbial and mitochondrial ADK, insert "zinc fing 83.36
d1zina235 Microbial and mitochondrial ADK, insert "zinc fing 82.02
d2dsxa152 Rubredoxin {Desulfovibrio gigas [TaxId: 879]} 81.82
d1nnqa237 Rubrerythrin, C-terminal domain {Archaeon Pyrococc 80.36
>d1akya2 g.41.2.1 (A:131-168) Microbial and mitochondrial ADK, insert "zinc finger" domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Small proteins
fold: Rubredoxin-like
superfamily: Microbial and mitochondrial ADK, insert "zinc finger" domain
family: Microbial and mitochondrial ADK, insert "zinc finger" domain
domain: Microbial and mitochondrial ADK, insert "zinc finger" domain
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=89.96  E-value=0.085  Score=29.96  Aligned_cols=23  Identities=17%  Similarity=0.043  Sum_probs=16.7

Q ss_pred             eecCCCCceecCCCC----CcccCccc
Q psy2693          58 EACVYCGASYLPKYK----GELCAVCT   80 (122)
Q Consensus        58 v~CP~CgA~Y~p~~k----G~lC~VC~   80 (122)
                      -.||-||+.|+-.|+    ..+|.+|+
T Consensus         3 r~C~~cG~~Yh~~~~ppk~~g~CD~cg   29 (38)
T d1akya2           3 LIHPASGRSYHKIFNPPKEDMKDDVTG   29 (38)
T ss_dssp             EECTTTCCEEETTTBCCSSTTBCTTTC
T ss_pred             cCCcCccchhhhhccCcCcCCccCCCC
Confidence            369999999984443    34788776



>d2ak3a2 g.41.2.1 (A:125-161) Microbial and mitochondrial ADK, insert "zinc finger" domain {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1yuza2 g.41.5.1 (A:167-202) Nigerythrin, C-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} Back     information, alignment and structure
>d1e4va2 g.41.2.1 (A:122-156) Microbial and mitochondrial ADK, insert "zinc finger" domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s3ga2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d1zina2 g.41.2.1 (A:126-160) Microbial and mitochondrial ADK, insert "zinc finger" domain {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2dsxa1 g.41.5.1 (A:1-52) Rubredoxin {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1nnqa2 g.41.5.1 (A:135-171) Rubrerythrin, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure