Psyllid ID: psy2696

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180
MFMYRGSGSMYQQSTEGTGPPEGEEAPTPTSCGPKNPLLCHVCDDYYTEPCLLSCYHSFCARCLRGRTVDGKLSCPICGQHTLLKEGSTLPPPDNVLKQLIEVANAENPPCANCDKRDRNAMYFCSTCASVRTGLMNCRSSLDELQLNCDTEKMTIQSFCQGMIDAITKTQNSMIMEVQR
cccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccHHHHHcccccccEEEccccccEEEcccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cEEEcccccccccccccccccccccccccccccccccccccccHHHcccccccccHHHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHHccccccccccccccccEEEEEcccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
mfmyrgsgsmyqqstegtgppegeeaptptscgpknpllchvcddyytepcllscyhSFCArclrgrtvdgklscpicgqhtllkegstlpppdnVLKQLIEVanaenppcancdkrdrnamyfCSTCASVRTGLMNCRSSLDelqlncdteKMTIQSFCQGMIDAITKTQNSMIMEVQR
mfmyrgsgsmyqqstegtgppEGEEAPTPTSCGPKNPLLCHVCDDYYTEPCLLSCYHSFCARCLRGRTVDGKLSCPICGQHtllkegstlpPPDNVLKQLIEVANAENPPCANCDKRDRNAMYFCSTCASVRTGLMNCRSSLDELQLNCDTEKMTIQSFCQGMIDAITKTQNSMIMEVQR
MFMYRGSGSMYQQStegtgppegeeaptptSCGPKNPLLCHVCDDYYTEPCLLSCYHSFCARCLRGRTVDGKLSCPICGQHTLLKEGSTLPPPDNVLKQLIEVANAENPPCANCDKRDRNAMYFCSTCASVRTGLMNCRSSLDELQLNCDTEKMTIQSFCQGMIDAITKTQNSMIMEVQR
************************************PLLCHVCDDYYTEPCLLSCYHSFCARCLRGRTVDGKLSCPICGQHTLLKEGSTL***DNVLKQLIEVANAENPPCANCDKRDRNAMYFCSTCASVRTGLMNCRSSLDELQLNCDTEKMTIQSFCQGMIDAITK***********
**************************************LCHVCDDYYTEPCLLSCYHSFCARCLRGRTVDGKLSCPICGQHTL*****TLPPPDNVLKQLI******************NAMYFCSTCASVRTGLMNCRSSLDELQLNCDTEKMTI*****************MIM****
*******************************CGPKNPLLCHVCDDYYTEPCLLSCYHSFCARCLRGRTVDGKLSCPICGQHTLLKEGSTLPPPDNVLKQLIEVANAENPPCANCDKRDRNAMYFCSTCASVRTGLMNCRSSLDELQLNCDTEKMTIQSFCQGMIDAITKTQNSMIMEVQR
************************************PLLCHVCDDYYTEPCLLSCYHSFCARCLRGRTVDGKLSCPICGQHTLLKEGSTLPPPDNVLKQLIEVANAENPPCANCDKRDRNAMYFCSTCASVRTGLMNCRSSLDELQLNCDTEKMTIQSFCQGMIDAITKTQNSMIMEVQR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFMYRGSGSMYQQSTEGTGPPEGEEAPTPTSCGPKNPLLCHVCDDYYTEPCLLSCYHSFCARCLRGRTVDGKLSCPICGQHTLLKEGSTLPPPDNVLKQLIEVANAENPPCANCDKRDRNAMYFCSTCASVRTGLMNCRSSLDELQLNCDTEKMTIQSFCQGMIDAITKTQNSMIMEVQR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query180 2.2.26 [Sep-21-2011]
Q6ZRF8 634 RING finger protein 207 O yes N/A 0.594 0.168 0.448 1e-20
A0JNG4 556 RING finger protein 207 O yes N/A 0.622 0.201 0.421 1e-20
Q3V3A7 635 RING finger protein 207 O yes N/A 0.522 0.148 0.47 3e-20
D3ZQG6 744 Tripartite motif-containi no N/A 0.605 0.146 0.287 2e-07
Q9C040 744 Tripartite motif-containi no N/A 0.605 0.146 0.287 8e-07
Q60MF5 836 Probable RING finger prot N/A N/A 0.483 0.104 0.329 1e-06
Q9ESN6 744 Tripartite motif-containi no N/A 0.605 0.146 0.280 2e-06
Q20548 822 Probable RING finger prot yes N/A 0.483 0.105 0.340 2e-06
F7H9X2 744 Tripartite motif-containi no N/A 0.588 0.142 0.274 2e-06
A4IF63 744 Tripartite motif-containi no N/A 0.516 0.125 0.272 8e-06
>sp|Q6ZRF8|RN207_HUMAN RING finger protein 207 OS=Homo sapiens GN=RNF207 PE=2 SV=2 Back     alignment and function desciption
 Score = 99.4 bits (246), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 52/116 (44%), Positives = 69/116 (59%), Gaps = 9/116 (7%)

Query: 19  GPPEGEEAPTPTSCGPKNPLLCHVCDDYYTEPCLLSCYHSFCARCLRGRTVDGKLSCPIC 78
           GP EG   P+       +PL+C +C   Y  PCLL C+H FCA CLRGR  DG+L+CP+C
Sbjct: 7   GPLEG---PSSLDAPSIHPLVCPLCHVQYERPCLLDCFHDFCAGCLRGRATDGRLTCPLC 63

Query: 79  GQHTLLKEGSTLPPPDNVLKQLIEVA--NAENPPCANCD----KRDRNAMYFCSTC 128
              T+LK  S LPP D +L+ L++ +    E   CANCD    ++D    YFC+TC
Sbjct: 64  QHQTVLKGPSGLPPVDRLLQFLVDSSGDGVEAVRCANCDLECSEQDVETTYFCNTC 119

Homo sapiens (taxid: 9606)
>sp|A0JNG4|RN207_BOVIN RING finger protein 207 OS=Bos taurus GN=RNF207 PE=2 SV=1 Back     alignment and function description
>sp|Q3V3A7|RN207_MOUSE RING finger protein 207 OS=Mus musculus GN=Rnf207 PE=2 SV=2 Back     alignment and function description
>sp|D3ZQG6|TRIM2_RAT Tripartite motif-containing protein 2 OS=Rattus norvegicus GN=Trim2 PE=1 SV=2 Back     alignment and function description
>sp|Q9C040|TRIM2_HUMAN Tripartite motif-containing protein 2 OS=Homo sapiens GN=TRIM2 PE=1 SV=1 Back     alignment and function description
>sp|Q60MF5|RN207_CAEBR Probable RING finger protein 207 homolog OS=Caenorhabditis briggsae GN=CBG23170 PE=4 SV=3 Back     alignment and function description
>sp|Q9ESN6|TRIM2_MOUSE Tripartite motif-containing protein 2 OS=Mus musculus GN=Trim2 PE=1 SV=1 Back     alignment and function description
>sp|Q20548|RN207_CAEEL Probable RING finger protein 207 homolog OS=Caenorhabditis elegans GN=F47G9.4 PE=4 SV=2 Back     alignment and function description
>sp|F7H9X2|TRIM2_CALJA Tripartite motif-containing protein 2 OS=Callithrix jacchus GN=TRIM2 PE=3 SV=1 Back     alignment and function description
>sp|A4IF63|TRIM2_BOVIN Tripartite motif-containing protein 2 OS=Bos taurus GN=TRIM2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query180
383854563 886 PREDICTED: RING finger protein 207-like 0.644 0.130 0.594 5e-39
328785011 887 PREDICTED: RING finger protein 207-like 0.533 0.108 0.677 1e-38
380022034 879 PREDICTED: uncharacterized protein LOC10 0.533 0.109 0.677 1e-38
242017595 1129 conserved hypothetical protein [Pediculu 0.611 0.097 0.581 2e-38
350425019 913 PREDICTED: RING finger protein 207-like 0.533 0.105 0.666 5e-38
340724517 913 PREDICTED: RING finger protein 207-like 0.533 0.105 0.666 5e-38
91085117 836 PREDICTED: similar to ring finger protei 0.511 0.110 0.705 7e-38
307195643 928 RING finger protein 207 [Harpegnathos sa 0.538 0.104 0.659 3e-37
345479925 906 PREDICTED: RING finger protein 207-like 0.6 0.119 0.648 2e-36
332020692 909 RING finger protein 207 [Acromyrmex echi 0.527 0.104 0.652 2e-36
>gi|383854563|ref|XP_003702790.1| PREDICTED: RING finger protein 207-like [Megachile rotundata] Back     alignment and taxonomy information
 Score =  166 bits (419), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 94/116 (81%)

Query: 14  STEGTGPPEGEEAPTPTSCGPKNPLLCHVCDDYYTEPCLLSCYHSFCARCLRGRTVDGKL 73
           + +G G  E +     T  GP+NPL+C VC DY+ EPCLLSC+H+FCARC+RG  ++GK+
Sbjct: 8   TVDGIGVGENDGTTGVTGGGPRNPLICGVCHDYFNEPCLLSCFHTFCARCIRGPHLEGKV 67

Query: 74  SCPICGQHTLLKEGSTLPPPDNVLKQLIEVANAENPPCANCDKRDRNAMYFCSTCA 129
           SCPICGQ T LK+G+ LPPPD++++QL+E+AN+ENPPCANCDKRD++ M+FC+TC 
Sbjct: 68  SCPICGQQTQLKDGAQLPPPDHLMRQLVELANSENPPCANCDKRDKSTMFFCTTCG 123

Source: Megachile rotundata

Species: Megachile rotundata

Genus: Megachile

Family: Megachilidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328785011|ref|XP_001122392.2| PREDICTED: RING finger protein 207-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380022034|ref|XP_003694860.1| PREDICTED: uncharacterized protein LOC100862946 [Apis florea] Back     alignment and taxonomy information
>gi|242017595|ref|XP_002429273.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212514169|gb|EEB16535.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|350425019|ref|XP_003493987.1| PREDICTED: RING finger protein 207-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340724517|ref|XP_003400628.1| PREDICTED: RING finger protein 207-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|91085117|ref|XP_968832.1| PREDICTED: similar to ring finger protein 207 [Tribolium castaneum] gi|270008488|gb|EFA04936.1| hypothetical protein TcasGA2_TC015003 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307195643|gb|EFN77485.1| RING finger protein 207 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|345479925|ref|XP_001607532.2| PREDICTED: RING finger protein 207-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332020692|gb|EGI61097.1| RING finger protein 207 [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query180
ZFIN|ZDB-GENE-080227-9 634 rnf207b "ring finger protein 2 0.516 0.146 0.494 2.8e-27
RGD|1586262 635 Rnf207 "ring finger protein 20 0.516 0.146 0.494 1.5e-22
UNIPROTKB|A0JNG4 556 RNF207 "RING finger protein 20 0.516 0.167 0.474 7.6e-22
UNIPROTKB|G3X7K4 556 RNF207 "RING finger protein 20 0.516 0.167 0.474 7.6e-22
UNIPROTKB|E1C348 559 RNF207 "Uncharacterized protei 0.538 0.173 0.436 7.7e-22
MGI|MGI:2684989 635 Rnf207 "ring finger protein 20 0.516 0.146 0.474 8.3e-22
UNIPROTKB|F1RIM2 634 RNF207 "Uncharacterized protei 0.516 0.146 0.474 1.7e-21
UNIPROTKB|Q6ZRF8 634 RNF207 "RING finger protein 20 0.516 0.146 0.474 2.2e-21
UNIPROTKB|E2RD18 634 RNF207 "Uncharacterized protei 0.516 0.146 0.464 2.7e-20
WB|WBGene00009831 822 F47G9.4 [Caenorhabditis elegan 0.483 0.105 0.340 9.7e-14
ZFIN|ZDB-GENE-080227-9 rnf207b "ring finger protein 207b" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 294 (108.6 bits), Expect = 2.8e-27, Sum P(2) = 2.8e-27
 Identities = 49/99 (49%), Positives = 70/99 (70%)

Query:    36 NPLLCHVCDDYYTEPCLLSCYHSFCARCLRGRTVDGKLSCPICGQHTLLKEGSTLPPPDN 95
             +PL+CH+C + Y  PCLL CYH+FCA CLRGR  D +L+CP+CG  +++K  + LPP D 
Sbjct:    21 HPLVCHLCQEQYEHPCLLDCYHTFCASCLRGRVADSRLTCPVCGHQSVVKGINALPPEDR 80

Query:    96 VLKQLIEVA--NAENPPCANCD----KRDRNAMYFCSTC 128
             +LK L++ +  + E   CANCD    K+D +AMY+C+TC
Sbjct:    81 LLKFLVDSSADSEETVQCANCDLECKKQDVDAMYYCNTC 119
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005622 "intracellular" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
RGD|1586262 Rnf207 "ring finger protein 207" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A0JNG4 RNF207 "RING finger protein 207" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G3X7K4 RNF207 "RING finger protein 207" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E1C348 RNF207 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:2684989 Rnf207 "ring finger protein 207" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1RIM2 RNF207 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q6ZRF8 RNF207 "RING finger protein 207" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RD18 RNF207 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
WB|WBGene00009831 F47G9.4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer6.3.2LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
COG5152259 COG5152, COG5152, Uncharacterized conserved protei 8e-07
COG5432 391 COG5432, RAD18, RING-finger-containing E3 ubiquiti 9e-07
TIGR00599 397 TIGR00599, rad18, DNA repair protein rad18 3e-06
cd0016245 cd00162, RING, RING-finger (Really Interesting New 2e-05
smart0018440 smart00184, RING, Ring finger 2e-04
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 0.003
>gnl|CDD|227481 COG5152, COG5152, Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information 
 Score = 47.4 bits (112), Expect = 8e-07
 Identities = 24/61 (39%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 22  EGEEAPTPTSCGPKNPLLCHVCDDYYTEPCLLSCYHSFCARCLRGRTVDGKLSCPICGQH 81
           E EEAP  +  G K P LC +C   Y  P +  C HSFC+ C   +   G   C +CG+ 
Sbjct: 181 EYEEAPVISGPGEKIPFLCGICKKDYESPVVTECGHSFCSLCAIRKYQKGD-ECGVCGKA 239

Query: 82  T 82
           T
Sbjct: 240 T 240

Length = 259
>gnl|CDD|227719 COG5432, RAD18, RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|233043 TIGR00599, rad18, DNA repair protein rad18 Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 180
KOG4367|consensus 699 99.52
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.46
KOG2177|consensus 386 99.43
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 99.3
KOG0287|consensus 442 99.23
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.23
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 99.17
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.14
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.13
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 99.11
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 99.07
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 99.05
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.0
PF1463444 zf-RING_5: zinc-RING finger domain 98.93
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.88
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.88
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.85
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.78
PHA02929238 N1R/p28-like protein; Provisional 98.71
KOG4185|consensus 296 98.67
PHA02926242 zinc finger-like protein; Provisional 98.61
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.6
KOG2164|consensus 513 98.59
KOG0317|consensus293 98.57
KOG0320|consensus187 98.56
KOG0823|consensus230 98.56
KOG2660|consensus 331 98.48
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.32
KOG0804|consensus 493 98.32
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.26
KOG4628|consensus348 98.25
KOG0978|consensus698 98.15
KOG2879|consensus298 98.06
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.02
KOG0311|consensus 381 97.98
KOG0824|consensus 324 97.91
COG5243491 HRD1 HRD ubiquitin ligase complex, ER membrane com 97.84
COG5152259 Uncharacterized conserved protein, contains RING a 97.71
KOG0802|consensus 543 97.61
KOG4159|consensus 398 97.59
COG5222427 Uncharacterized conserved protein, contains RING Z 97.58
KOG0297|consensus 391 97.57
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.51
KOG1039|consensus344 97.5
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 97.48
KOG1002|consensus 791 97.48
KOG1813|consensus313 97.44
KOG0825|consensus 1134 97.4
KOG0827|consensus 465 97.24
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 97.19
KOG1785|consensus563 97.19
KOG1734|consensus328 97.17
KOG4739|consensus233 97.03
KOG4172|consensus62 97.02
KOG1814|consensus 445 96.95
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.75
smart00502127 BBC B-Box C-terminal domain. Coiled coil region C- 96.74
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 96.73
KOG1645|consensus 463 96.69
KOG0828|consensus636 96.61
KOG3161|consensus 861 96.57
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 96.42
KOG4265|consensus349 96.17
KOG2817|consensus394 96.11
PF04641260 Rtf2: Rtf2 RING-finger 95.98
KOG3800|consensus 300 95.82
KOG1941|consensus518 95.68
KOG4275|consensus350 95.47
KOG1493|consensus84 95.39
KOG1571|consensus355 95.12
KOG3002|consensus 299 95.09
COG5175 480 MOT2 Transcriptional repressor [Transcription] 94.93
KOG3039|consensus303 94.91
KOG2932|consensus 389 94.32
COG52191525 Uncharacterized conserved protein, contains RING Z 94.28
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 94.14
KOG3579|consensus352 94.14
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 93.91
KOG4692|consensus489 93.81
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 93.69
KOG1001|consensus674 93.64
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 93.63
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 93.6
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 92.53
KOG4362|consensus 684 92.38
PF10083158 DUF2321: Uncharacterized protein conserved in bact 92.33
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 92.29
COG5236 493 Uncharacterized conserved protein, contains RING Z 91.81
KOG2114|consensus933 91.39
KOG1940|consensus276 90.88
KOG1812|consensus384 90.64
KOG0826|consensus357 90.43
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 89.92
PHA02825162 LAP/PHD finger-like protein; Provisional 89.81
KOG3970|consensus299 88.89
COG5109396 Uncharacterized conserved protein, contains RING Z 88.76
PF10272358 Tmpp129: Putative transmembrane protein precursor; 88.74
PF0719170 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 88.64
PHA03096284 p28-like protein; Provisional 88.26
KOG1100|consensus207 87.73
PRK00420112 hypothetical protein; Validated 87.12
KOG3039|consensus 303 86.32
PHA02862156 5L protein; Provisional 85.19
KOG1952|consensus 950 85.08
PF1277350 DZR: Double zinc ribbon 84.74
KOG1815|consensus 444 84.11
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 83.98
cd0002139 BBOX B-Box-type zinc finger; zinc binding domain ( 83.56
PF0064342 zf-B_box: B-box zinc finger; InterPro: IPR000315 Z 83.25
KOG4185|consensus296 83.22
COG381384 Uncharacterized protein conserved in bacteria [Fun 82.72
PF0690657 DUF1272: Protein of unknown function (DUF1272); In 82.63
PF1456980 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A. 82.54
KOG2930|consensus114 82.53
PF12126 324 DUF3583: Protein of unknown function (DUF3583); In 82.43
PF0560554 zf-Di19: Drought induced 19 protein (Di19), zinc-b 81.82
KOG2462|consensus279 80.53
>KOG4367|consensus Back     alignment and domain information 
Probab=99.52  E-value=8.5e-14  Score=111.41  Aligned_cols=96  Identities=30%  Similarity=0.732  Sum_probs=75.6

Q ss_pred             CCCccccccccccCCCceeccccccchHHhhhccccC-------------------------------------------
Q psy2696          34 PKNPLLCHVCDDYYTEPCLLSCYHSFCARCLRGRTVD-------------------------------------------   70 (180)
Q Consensus        34 l~~~l~C~iC~~~~~~P~~l~C~H~fC~~Cl~~~~~~-------------------------------------------   70 (180)
                      +++++.|+||...|.+|++|||+|..|..|......+                                           
T Consensus         1 meeelkc~vc~~f~~epiil~c~h~lc~~ca~~~~~~tp~~~spq~~~aa~s~vs~~~~~~~d~msl~~~ad~g~~~~~~   80 (699)
T KOG4367|consen    1 MEEELKCPVCGSFYREPIILPCSHNLCQACARNILVQTPESESPQSHRAAGSGVSDYDYLDLDKMSLYSEADSGYGSYGG   80 (699)
T ss_pred             CcccccCceehhhccCceEeecccHHHHHHHHhhcccCCCCCCchhhhhcCCCCCccccccccceeeEeeccCCCCccCC
Confidence            4688999999999999999999999999997532000                                           


Q ss_pred             ----------------------------------------CccCCCCCCCCcccCC-CCCCCCChHHHHHHHHHHhcCC-
Q psy2696          71 ----------------------------------------GKLSCPICGQHTLLKE-GSTLPPPDNVLKQLIEVANAEN-  108 (180)
Q Consensus        71 ----------------------------------------~~~~CP~Cr~~~~~~~-~~~~l~~n~~l~~l~~~~~~~~-  108 (180)
                                                              ..+.||.|...+-..+ +.+.++.|..+..+++.+.... 
T Consensus        81 ~a~~~~t~~~~~~~g~~~~p~am~pp~t~l~~~lap~~~~~~i~c~~c~rs~~~dd~~l~~~p~n~~le~vi~ryq~s~~  160 (699)
T KOG4367|consen   81 FASAPTTPCQKSPNGVRVFPPAMPPPATHLSPALAPVPRNSCITCPQCHRSLILDDRGLRGFPKNRVLEGVIDRYQQSKA  160 (699)
T ss_pred             eeecCCCccccCCCCceeCCCCCCCchhhccccccCCCCCceEEcchhhhheEecccccccCchhhHHHHHHHHHhhhhH
Confidence                                                    0478999999887766 6778999999999988886543 


Q ss_pred             --CCCCCcCcccccccccccCCH
Q psy2696         109 --PPCANCDKRDRNAMYFCSTCA  129 (180)
Q Consensus       109 --~~c~~C~~h~~~~~~~C~~C~  129 (180)
                        ..|..|+...+.+..||+.|+
T Consensus       161 aa~kcqlce~a~k~a~v~ceqcd  183 (699)
T KOG4367|consen  161 AALKCQLCEKAPKEATVMCEQCD  183 (699)
T ss_pred             HhhhhhhhcCChhhhhhhHhhCc
Confidence              468888877777776666665

>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG2177|consensus Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>KOG4185|consensus Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>KOG2660|consensus Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4628|consensus Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0311|consensus Back     alignment and domain information
>KOG0824|consensus Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>KOG4159|consensus Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0297|consensus Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>KOG1734|consensus Back     alignment and domain information
>KOG4739|consensus Back     alignment and domain information
>KOG4172|consensus Back     alignment and domain information
>KOG1814|consensus Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>smart00502 BBC B-Box C-terminal domain Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG0828|consensus Back     alignment and domain information
>KOG3161|consensus Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG4265|consensus Back     alignment and domain information
>KOG2817|consensus Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG3800|consensus Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>KOG4275|consensus Back     alignment and domain information
>KOG1493|consensus Back     alignment and domain information
>KOG1571|consensus Back     alignment and domain information
>KOG3002|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>KOG2932|consensus Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG3579|consensus Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG4692|consensus Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4362|consensus Back     alignment and domain information
>PF10083 DUF2321: Uncharacterized protein conserved in bacteria (DUF2321); InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454 Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG1940|consensus Back     alignment and domain information
>KOG1812|consensus Back     alignment and domain information
>KOG0826|consensus Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG3970|consensus Back     alignment and domain information
>COG5109 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>PF07191 zinc-ribbons_6: zinc-ribbons; InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG1100|consensus Back     alignment and domain information
>PRK00420 hypothetical protein; Validated Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG1952|consensus Back     alignment and domain information
>PF12773 DZR: Double zinc ribbon Back     alignment and domain information
>KOG1815|consensus Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>cd00021 BBOX B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction Back     alignment and domain information
>PF00643 zf-B_box: B-box zinc finger; InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4185|consensus Back     alignment and domain information
>COG3813 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF06906 DUF1272: Protein of unknown function (DUF1272); InterPro: IPR010696 This family consists of several hypothetical bacterial proteins of around 80 residues in length Back     alignment and domain information
>PF14569 zf-UDP: Zinc-binding RING-finger; PDB: 1WEO_A Back     alignment and domain information
>KOG2930|consensus Back     alignment and domain information
>PF12126 DUF3583: Protein of unknown function (DUF3583); InterPro: IPR021978 This domain is found in eukaryotes, and is typically between 302 and 338 amino acids in length Back     alignment and domain information
>PF05605 zf-Di19: Drought induced 19 protein (Di19), zinc-binding; InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins Back     alignment and domain information
>KOG2462|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
4ayc_B138 Rnf8 Ring Domain Structure Length = 138 2e-05
4ayc_A138 Rnf8 Ring Domain Structure Length = 138 3e-05
4epo_C149 Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HE 4e-05
>pdb|4AYC|B Chain B, Rnf8 Ring Domain Structure Length = 138 Back     alignment and structure 
Iteration: 1

 Score = 45.1 bits (105), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 3/67 (4%)
Query: 35  KNPLLCHVCDDYYTEPCLLSCYHSFCARCLRGRTVDGKLSCPICGQHTLLKEGSTLPPPD 94
           +N L C +C +Y+ E   L+C HSFC+ C+    +  K+ CPIC +   +K  +     D
Sbjct: 51  ENELQCIICSEYFIEAVTLNCAHSFCSYCI-NEWMKRKIECPICRKD--IKSKTYSLVLD 107
Query: 95  NVLKQLI 101
           N + +++
Sbjct: 108 NXINKMV 114
>pdb|4AYC|A Chain A, Rnf8 Ring Domain Structure Length = 138 Back     alignment and structure
>pdb|4EPO|C Chain C, Crystal Structure Of Rnf8 Bound To The Ubc13MMS2 HETERODIMER Length = 149 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 2e-09
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 2e-09
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 6e-09
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 4e-08
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 5e-08
2ecw_A85 Tripartite motif-containing protein 30; metal bind 1e-07
1z6u_A150 NP95-like ring finger protein isoform B; structura 2e-07
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 3e-07
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 3e-07
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 5e-07
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 7e-07
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 9e-07
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 1e-06
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 1e-06
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 1e-06
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 2e-06
2ysl_A73 Tripartite motif-containing protein 31; ring-type 2e-06
2ysj_A63 Tripartite motif-containing protein 31; ring-type 3e-06
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 5e-06
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 1e-05
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 2e-05
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 2e-05
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 3e-05
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 7e-05
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 8e-05
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 1e-04
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 2e-04
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 5e-04
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 7e-04
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
 Score = 51.0 bits (122), Expect = 2e-09
 Identities = 19/85 (22%), Positives = 29/85 (34%), Gaps = 5/85 (5%)

Query: 23  GEEAPTPTSCGPKNPLLCHVCDDYYTEPCLLSCYHSFCARCLRGRTVDGKLSCPICGQHT 82
           G    +  S   + P  C +C   +  P +  C H FC  C           C IC Q T
Sbjct: 1   GSSGSSGGSEEEEIPFRCFICRQAFQNPVVTKCRHYFCESCALEH-FRATPRCYICDQPT 59

Query: 83  LLKEGSTLPPPDNVLKQLIEVANAE 107
               G    P   ++ +L +   + 
Sbjct: 60  ----GGIFNPAKELMAKLQKSGPSS 80
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 56 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Length = 85 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 112 Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 58 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Length = 118 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Length = 141 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Length = 165 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Length = 117 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Length = 116 Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Length = 170 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query180
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.65
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.63
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.63
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.63
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.61
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.59
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.59
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.58
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.58
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.57
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.57
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.55
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.55
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.53
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.52
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.52
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.51
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.5
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.49
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.48
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.48
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.47
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.47
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.46
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.46
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.45
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.45
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.45
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.43
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.41
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.41
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.38
2f42_A179 STIP1 homology and U-box containing protein 1; cha 99.38
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.37
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.37
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.34
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.34
2ect_A78 Ring finger protein 126; metal binding protein, st 99.32
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.32
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 99.28
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.28
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.24
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.23
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.23
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.19
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.18
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.16
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.14
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.14
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.14
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.12
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.1
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.07
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.02
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.96
2ea5_A68 Cell growth regulator with ring finger domain prot 98.95
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.89
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.88
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.83
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.82
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.8
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.75
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.73
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.65
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.62
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.5
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.31
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 98.3
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.27
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 97.91
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 97.87
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.16
3nw0_A238 Non-structural maintenance of chromosomes element 94.96
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 93.68
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 93.62
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 93.13
3i2d_A371 E3 SUMO-protein ligase SIZ1; signal transduction, 91.02
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 90.8
4fo9_A360 E3 SUMO-protein ligase PIAS2; E3 ligase, pinit dom 89.36
1weu_A91 Inhibitor of growth family, member 4; structural g 89.22
1weo_A93 Cellulose synthase, catalytic subunit (IRX3); stru 88.88
1fre_A42 Nuclear factor XNF7; zinc-binding protein, BBOX, d 87.27
2yvr_A50 Transcription intermediary factor 1-beta; ZF-B_BOX 86.99
2ct7_A86 Ring finger protein 31; IBR, structural genomics, 86.71
2did_A53 Tripartite motif protein 39; ZF-B-box domian, Zn b 85.57
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 85.42
3ddt_A48 E3 ubiquitin-protein ligase TRIM63; zinc-binding m 85.22
2d8u_A64 Ubiquitin ligase TRIM63; tripartite motif-containi 84.39
1wil_A89 KIAA1045 protein; ring finger domain, structural g 84.11
1z2q_A84 LM5-1; membrane protein, FYVE domain, zinc-finger; 83.45
2egm_A57 Tripartite motif-containing protein 41; ZF-B_BOX d 82.71
3mjh_B34 Early endosome antigen 1; protein-zinc finger comp 82.0
2k16_A75 Transcription initiation factor TFIID subunit 3; p 81.29
2csv_A72 Tripartite motif protein 29; ZF-B_BOX domain, TRIM 81.08
2jr6_A68 UPF0434 protein NMA0874; solution, structural geno 80.77
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>4fo9_A E3 SUMO-protein ligase PIAS2; E3 ligase, pinit domain, SP-ring domain, structural GE consortium, SGC; 2.39A {Homo sapiens} PDB: 2asq_B Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1weo_A Cellulose synthase, catalytic subunit (IRX3); structure genomics, ring-finger, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: g.44.1.1 Back     alignment and structure
>1fre_A Nuclear factor XNF7; zinc-binding protein, BBOX, development, MID-blastula- transition; NMR {Xenopus laevis} SCOP: g.43.1.1 Back     alignment and structure
>2yvr_A Transcription intermediary factor 1-beta; ZF-B_BOX domain, structural genomics, NPPSFA; 1.80A {Homo sapiens} Back     alignment and structure
>2ct7_A Ring finger protein 31; IBR, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.4 Back     alignment and structure
>2did_A Tripartite motif protein 39; ZF-B-box domian, Zn binding, one sequence two fold, NPPSFA; NMR {Homo sapiens} SCOP: g.43.1.1 PDB: 2dif_A Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>3ddt_A E3 ubiquitin-protein ligase TRIM63; zinc-binding motif, ring-like fold, coiled coil, cytoplasm, metal-binding, muscle protein, nucleus; 1.90A {Homo sapiens} SCOP: g.43.1.1 PDB: 3q1d_A Back     alignment and structure
>2d8u_A Ubiquitin ligase TRIM63; tripartite motif-containing 63, muscle-specific ring finger protein 1, MURF1, ring finger protein 28; NMR {Homo sapiens} SCOP: g.43.1.1 Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>1z2q_A LM5-1; membrane protein, FYVE domain, zinc-finger; NMR {Leishmania major} Back     alignment and structure
>2egm_A Tripartite motif-containing protein 41; ZF-B_BOX domain, tripartite motif protein 41, TRIM41, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mjh_B Early endosome antigen 1; protein-zinc finger complex, beta BETA alpha fold, beta HAIR RAB5A GTPase, EEA1, protein transport; HET: GTP; 2.03A {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>2csv_A Tripartite motif protein 29; ZF-B_BOX domain, TRIM29, ataxia-telangiectasia group D-associated protein, ATDC, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.43.1.1 Back     alignment and structure
>2jr6_A UPF0434 protein NMA0874; solution, structural genomics, PSI, structure initiative, northeast structural genomics consort NESG; NMR {Neisseria meningitidis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 180
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 4e-06
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 1e-05
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 3e-05
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 4e-05
d1t1ha_78 g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cre 0.003
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 0.004
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Acute promyelocytic leukaemia proto-oncoprotein PML
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 40.2 bits (94), Expect = 4e-06
 Identities = 16/50 (32%), Positives = 19/50 (38%), Gaps = 4/50 (8%)

Query: 38 LLCHVCDDYYTEPCLLSCYHSFCARCLRGRTVDGKLSCPICGQHTLLKEG 87
          L C  C      P LL C H+ C+ CL        + CPIC     L   
Sbjct: 7  LRCQQCQAEAKCPKLLPCLHTLCSGCLEAS----GMQCPICQAPWPLGAD 52
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 78 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query180
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.61
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.59
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.58
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.58
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.54
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.5
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.38
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.25
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.23
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.22
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.11
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.1
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.78
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.76
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.49
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.33
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 94.09
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 93.69
d1frea_39 Nuclear factor XNF7 {African clawed frog (Xenopus 93.06
d2dida140 Tripartite motif-containing protein 39 {Human (Hom 92.07
d1dvpa272 Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7 90.36
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 90.26
d2d8ua151 Ubiquitin ligase trim63 {Human (Homo sapiens) [Tax 90.08
d2csva159 Tripartite motif-containing protein 29 {Human (Hom 89.14
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 89.04
d2dq5a147 Midline-1 {Human (Homo sapiens) [TaxId: 9606]} 87.34
d2djaa171 Midline-2 {Human (Homo sapiens) [TaxId: 9606]} 87.02
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 85.06
d1wfla_74 Zinc finger A20 domain containing protein 2 {Mouse 84.25
d1wfpa_74 Zinc finger A20 and AN1 domains containing protein 80.34
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: U-box
domain: STIP1 homology and U box-containing protein 1, STUB1
species: Mouse (Mus musculus) [TaxId: 10090]

Probab=99.61  E-value=1.9e-16  Score=99.07  Aligned_cols=71  Identities=13%  Similarity=0.156  Sum_probs=61.2

Q ss_pred             CCCCccccccccccCCCceeccccccchHHhhhccccCCccCCCCCCCCcccCCCCCCCCChHHHHHHHHHHhcC
Q psy2696          33 GPKNPLLCHVCDDYYTEPCLLSCYHSFCARCLRGRTVDGKLSCPICGQHTLLKEGSTLPPPDNVLKQLIEVANAE  107 (180)
Q Consensus        33 ~l~~~l~C~iC~~~~~~P~~l~C~H~fC~~Cl~~~~~~~~~~CP~Cr~~~~~~~~~~~l~~n~~l~~l~~~~~~~  107 (180)
                      .+-+++.||||+++|.+|++++|||+||..||.+|...+...||.|+..+....    +.+|..+.++++.+...
T Consensus         3 eiP~~l~CpIc~~l~~dPv~~~cGhtfc~~ci~~~l~~~~~~cP~c~~~l~~~~----l~pN~~L~~~I~~~l~~   73 (80)
T d2c2la2           3 DIPDYLCGKISFELMREPCITPSGITYDRKDIEEHLQRVGHFNPVTRSPLTQEQ----LIPNLAMKEVIDAFISE   73 (80)
T ss_dssp             CCCSTTBCTTTCSBCSSEEECSSCCEEETTHHHHHHHHTCSSCTTTCCCCCGGG----CEECHHHHHHHHHHHTT
T ss_pred             CCCccccCcCcCchhhhhcccCCcCeecHHHHHHHHhcCCccCCCccccccccc----cccHHHHHHHHHHHHHH
Confidence            345789999999999999999999999999999987666668999999876665    77899999999887543
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1frea_ g.43.1.1 (A:) Nuclear factor XNF7 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d2dida1 g.43.1.1 (A:8-47) Tripartite motif-containing protein 39 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dvpa2 g.50.1.1 (A:149-220) Hrs {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2d8ua1 g.43.1.1 (A:8-58) Ubiquitin ligase trim63 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2csva1 g.43.1.1 (A:8-66) Tripartite motif-containing protein 29 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dq5a1 g.43.1.1 (A:168-214) Midline-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djaa1 g.43.1.1 (A:8-78) Midline-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wfla_ g.80.1.1 (A:) Zinc finger A20 domain containing protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfpa_ g.80.1.1 (A:) Zinc finger A20 and AN1 domains containing protein At1g12440 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure