Psyllid ID: psy2724

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170----
MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEDHEGEV
cccccccEEEEEcccccccccccccccccEEccccccccccccccccccccccEEcHHHHHcccccEEcccccccccccHHHHHHHHHHHHHHHHccccccccEEEEccccccHHHHHHHHHHHHccccccEEHHHHHHHHHHHHccccEEEEEEcccccEEEEcccccccccc
ccccccccEEEEEcccEEEEEEcccccccEEEEccEEEcccHHHHHHccccccEEcHHHHHcEccEEEEccccccccccHHHHHHHHHHHHHccccccHHHccEEEEEcccccHHHHHHHHHHHHHcccccEEEEEEHHHHHHHHcccccEEEEEEccccEEEEEEEccEcccc
MCDDDVAALVVdngsgmckagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgiltlkypiehgiitnwddmEKIWHHTFYNelrvapeehpillteaplnpkanrEKMTQIMFETFNTPAMYVAIQAVLSLYASGrttgivldsgdgvshtvpiyedhegev
MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPILLteaplnpkaNREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGivldsgdgvshtvpiyedhegev
MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEDHEGEV
******AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMG****YVG****SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPILLTEAP********KMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPI********
****DVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQ*****MGQ*DSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEDHEGEV
MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEDHEGEV
****DVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEDHEG**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEDHEGEV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query174 2.2.26 [Sep-21-2011]
P10984 376 Actin-2 OS=Caenorhabditis yes N/A 0.977 0.452 0.970 2e-97
P49871 376 Actin, muscle OS=Manduca N/A N/A 0.977 0.452 0.976 2e-97
P45886 376 Actin-3, muscle-specific N/A N/A 0.977 0.452 0.976 2e-97
P41340 376 Actin-3 OS=Limulus polyph N/A N/A 0.977 0.452 0.970 2e-97
P18603 376 Actin, clone 403 OS=Artem N/A N/A 0.977 0.452 0.970 3e-97
P18601 376 Actin, clone 211 OS=Artem N/A N/A 0.977 0.452 0.976 3e-97
P41339 376 Actin, acrosomal process N/A N/A 0.977 0.452 0.970 4e-97
P45885 376 Actin-2, muscle-specific N/A N/A 0.977 0.452 0.970 5e-97
P53501 376 Actin-57B OS=Drosophila m yes N/A 0.977 0.452 0.970 5e-97
P18600 376 Actin, clone 205 OS=Artem N/A N/A 0.977 0.452 0.970 6e-97
>sp|P10984|ACT2_CAEEL Actin-2 OS=Caenorhabditis elegans GN=act-2 PE=3 SV=3 Back     alignment and function desciption
 Score =  354 bits (908), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 169/170 (99%)

Query: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60
           MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKM 120
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEDH 170
           TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYE +
Sbjct: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGY 170
Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells.
Caenorhabditis elegans (taxid: 6239)
>sp|P49871|ACT_MANSE Actin, muscle OS=Manduca sexta PE=2 SV=1 Back     alignment and function description
>sp|P45886|ACT3_BACDO Actin-3, muscle-specific OS=Bactrocera dorsalis PE=2 SV=1 Back     alignment and function description
>sp|P41340|ACT3_LIMPO Actin-3 OS=Limulus polyphemus PE=1 SV=1 Back     alignment and function description
>sp|P18603|ACT4_ARTSX Actin, clone 403 OS=Artemia sp. PE=2 SV=1 Back     alignment and function description
>sp|P18601|ACT2_ARTSX Actin, clone 211 OS=Artemia sp. PE=2 SV=1 Back     alignment and function description
>sp|P41339|ACTA_LIMPO Actin, acrosomal process isoform OS=Limulus polyphemus PE=2 SV=1 Back     alignment and function description
>sp|P45885|ACT2_BACDO Actin-2, muscle-specific OS=Bactrocera dorsalis PE=2 SV=1 Back     alignment and function description
>sp|P53501|ACT3_DROME Actin-57B OS=Drosophila melanogaster GN=Act57B PE=1 SV=1 Back     alignment and function description
>sp|P18600|ACT1_ARTSX Actin, clone 205 OS=Artemia sp. PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query174
381414109 339 actin, partial [Merizodus soledadinus] 0.977 0.501 0.988 1e-96
318087092 331 actin 5C [Latrodectus hesperus] 0.977 0.513 0.982 2e-96
91079925 376 PREDICTED: similar to RE12057p isoform 1 0.977 0.452 0.988 3e-96
51988476 275 actin [Reticulitermes flavipes] 0.977 0.618 0.988 3e-96
217330650 376 actin related protein 1 [Acyrthosiphon p 0.977 0.452 0.988 3e-96
284027006 376 beta actin [Liposcelis bostrychophila] 0.977 0.452 0.988 3e-96
167683064 359 actin [Paraphidippus aurantius] 0.977 0.473 0.976 3e-96
238683607 376 actin [Agelena silvatica] 0.977 0.452 0.976 4e-96
118142406 376 cytoplasmic actin [Orgyia thyellina] 0.977 0.452 0.976 5e-96
260401068 376 beta-actin [Mythimna separata] 0.977 0.452 0.976 5e-96
>gi|381414109|gb|AFG29036.1| actin, partial [Merizodus soledadinus] Back     alignment and taxonomy information
 Score =  357 bits (915), Expect = 1e-96,   Method: Compositional matrix adjust.
 Identities = 168/170 (98%), Positives = 169/170 (99%)

Query: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60
           MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKM 120
           SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKM 120

Query: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEDH 170
           TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYE +
Sbjct: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGY 170

Source: Merizodus soledadinus

Species: Merizodus soledadinus

Genus: Merizodus

Family: Carabidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|318087092|gb|ADV40137.1| actin 5C [Latrodectus hesperus] Back     alignment and taxonomy information
>gi|91079925|ref|XP_966415.1| PREDICTED: similar to RE12057p isoform 1 [Tribolium castaneum] gi|270004581|gb|EFA01029.1| hypothetical protein TcasGA2_TC003944 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|51988476|gb|AAU20854.1| actin [Reticulitermes flavipes] Back     alignment and taxonomy information
>gi|217330650|ref|NP_001136108.1| actin related protein 1 [Acyrthosiphon pisum] gi|242011914|ref|XP_002426688.1| Actin, muscle [Pediculus humanus corporis] gi|46561736|gb|AAT01073.1| putative muscle actin [Homalodisca vitripennis] gi|52630959|gb|AAU84943.1| putative muscle actin [Toxoptera citricida] gi|53830696|gb|AAU95191.1| putative muscle actin [Oncometopia nigricans] gi|77158630|gb|ABA62321.1| beta-actin [Reticulitermes flavipes] gi|91221295|gb|ABE27979.1| putative muscle actin [Lygus lineolaris] gi|212510859|gb|EEB13950.1| Actin, muscle [Pediculus humanus corporis] gi|326490788|dbj|BAJ90061.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|284027006|gb|ACJ65018.2| beta actin [Liposcelis bostrychophila] Back     alignment and taxonomy information
>gi|167683064|gb|ABZ91674.1| actin [Paraphidippus aurantius] Back     alignment and taxonomy information
>gi|238683607|gb|ACR54088.1| actin [Agelena silvatica] Back     alignment and taxonomy information
>gi|118142406|dbj|BAF36978.1| cytoplasmic actin [Orgyia thyellina] Back     alignment and taxonomy information
>gi|260401068|gb|ACX37085.1| beta-actin [Mythimna separata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query174
WB|WBGene00000064 376 act-2 [Caenorhabditis elegans 0.977 0.452 0.970 7.5e-89
UNIPROTKB|P10984 376 act-2 "Actin-2" [Caenorhabditi 0.977 0.452 0.970 7.5e-89
ZFIN|ZDB-GENE-051030-60 376 zgc:123289 "zgc:123289" [Danio 0.977 0.452 0.970 9.6e-89
FB|FBgn0000044 376 Act57B "Actin 57B" [Drosophila 0.977 0.452 0.970 2e-88
FB|FBgn0000043 376 Act42A "Actin 42A" [Drosophila 0.977 0.452 0.964 2.5e-88
FB|FBgn0000042 376 Act5C "Actin 5C" [Drosophila m 0.977 0.452 0.964 2.5e-88
FB|FBgn0000046 376 Act87E "Actin 87E" [Drosophila 0.977 0.452 0.970 2.5e-88
WB|WBGene00000063 376 act-1 [Caenorhabditis elegans 0.977 0.452 0.958 2.5e-88
WB|WBGene00000065 376 act-3 [Caenorhabditis elegans 0.977 0.452 0.958 2.5e-88
WB|WBGene00000066 376 act-4 [Caenorhabditis elegans 0.977 0.452 0.958 2.5e-88
WB|WBGene00000064 act-2 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 887 (317.3 bits), Expect = 7.5e-89, P = 7.5e-89
 Identities = 165/170 (97%), Positives = 169/170 (99%)

Query:     1 MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60
             MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ
Sbjct:     1 MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60

Query:    61 SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKM 120
             SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKM
Sbjct:    61 SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query:   121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEDH 170
             TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYE +
Sbjct:   121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGY 170
GO:0005524 "ATP binding" evidence=IEA;ISS
GO:0000003 "reproduction" evidence=IMP
GO:0002119 "nematode larval development" evidence=IMP
GO:0040007 "growth" evidence=IMP
GO:0040035 "hermaphrodite genitalia development" evidence=IMP
GO:0009792 "embryo development ending in birth or egg hatching" evidence=IMP
GO:0000910 "cytokinesis" evidence=IMP
GO:0040039 "inductive cell migration" evidence=IMP
GO:0006898 "receptor-mediated endocytosis" evidence=IMP
GO:0040011 "locomotion" evidence=IMP
GO:0071688 "striated muscle myosin thick filament assembly" evidence=IMP
GO:0009790 "embryo development" evidence=IGI;IMP
GO:0000281 "cytokinesis after mitosis" evidence=IGI
GO:0007126 "meiosis" evidence=IMP
GO:0030029 "actin filament-based process" evidence=IMP
GO:0007108 "cytokinesis, initiation of separation" evidence=IMP
GO:0030036 "actin cytoskeleton organization" evidence=IMP
GO:0005938 "cell cortex" evidence=IDA
GO:0005737 "cytoplasm" evidence=IDA
GO:0005884 "actin filament" evidence=IDA
GO:0016887 "ATPase activity" evidence=ISS
UNIPROTKB|P10984 act-2 "Actin-2" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051030-60 zgc:123289 "zgc:123289" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0000044 Act57B "Actin 57B" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0000043 Act42A "Actin 42A" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0000042 Act5C "Actin 5C" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0000046 Act87E "Actin 87E" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00000063 act-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00000065 act-3 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
WB|WBGene00000066 act-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P84183ACT4_BOMMONo assigned EC number0.96470.97700.4521N/AN/A
O16808ACT_MAYDENo assigned EC number0.96470.97700.4521N/AN/A
Q26065ACT_PLAMGNo assigned EC number0.95880.97700.4521N/AN/A
P92179ACTC_BIOGLNo assigned EC number0.95880.97700.4521N/AN/A
P49128ACT1_AEDAENo assigned EC number0.95880.97700.4521N/AN/A
P84185ACT5C_ANOGANo assigned EC number0.96470.97700.4521yesN/A
P84184ACT3B_HELAMNo assigned EC number0.96470.97700.4521N/AN/A
P53463ACTM_HELERNo assigned EC number0.95880.97700.4521N/AN/A
P53464ACTM_HELTBNo assigned EC number0.95880.97700.4521N/AN/A
Q964E1ACTC_BIOOBNo assigned EC number0.96470.97700.4521N/AN/A
P53461ACTC_HALRONo assigned EC number0.96470.97700.4521N/AN/A
Q964E3ACTC_BIOALNo assigned EC number0.95880.97700.4521N/AN/A
Q964E2ACTC_BIOPFNo assigned EC number0.96470.97700.4521N/AN/A
P18601ACT2_ARTSXNo assigned EC number0.97640.97700.4521N/AN/A
P18600ACT1_ARTSXNo assigned EC number0.97050.97700.4521N/AN/A
P18603ACT4_ARTSXNo assigned EC number0.97050.97700.4521N/AN/A
P17126ACT_HYDVUNo assigned EC number0.95880.97700.4521N/AN/A
P30162ACT1_ONCVONo assigned EC number0.95880.97700.4521N/AN/A
P30163ACT2_ONCVONo assigned EC number0.95880.97700.4521N/AN/A
P41340ACT3_LIMPONo assigned EC number0.97050.97700.4521N/AN/A
P41341ACTY_LIMPONo assigned EC number0.96470.97700.4521N/AN/A
Q25010ACT3A_HELAMNo assigned EC number0.96470.97700.4521N/AN/A
P12717ACTM_PISOCNo assigned EC number0.95290.97700.4521N/AN/A
P12716ACTC_PISOCNo assigned EC number0.96470.97700.4521N/AN/A
P41113ACT3_PODCANo assigned EC number0.96470.97700.4521N/AN/A
P53501ACT3_DROMENo assigned EC number0.97050.97700.4521yesN/A
P41112ACT1_PODCANo assigned EC number0.96470.97700.4521N/AN/A
P45885ACT2_BACDONo assigned EC number0.97050.97700.4521N/AN/A
P49871ACT_MANSENo assigned EC number0.97640.97700.4521N/AN/A
P45887ACT5_BACDONo assigned EC number0.95290.97700.4521N/AN/A
P45886ACT3_BACDONo assigned EC number0.97640.97700.4521N/AN/A
O18500ACT2_SACKONo assigned EC number0.94700.97700.4521yesN/A
P02572ACT2_DROMENo assigned EC number0.96470.97700.4521yesN/A
P41339ACTA_LIMPONo assigned EC number0.97050.97700.4521N/AN/A
O18499ACT1_SACKONo assigned EC number0.94110.97700.4521yesN/A
P07836ACT1_BOMMONo assigned EC number0.96470.97700.4521N/AN/A
P07837ACT2_BOMMONo assigned EC number0.97050.97700.4521N/AN/A
Q07903ACTC_STRPUNo assigned EC number0.95880.97700.4521noN/A
Q964D9ACTC_HELTINo assigned EC number0.95880.97700.4521N/AN/A
P83968ACT6_DROSINo assigned EC number0.97020.96550.4468N/AN/A
P04829ACT3_BOMMONo assigned EC number0.96470.97700.4521N/AN/A
P83967ACT6_DROMENo assigned EC number0.97020.96550.4468yesN/A
P83969ACT1_BACDONo assigned EC number0.97020.96550.4468N/AN/A
P18499ACTF_STRPUNo assigned EC number0.95880.97700.4521noN/A
P10986ACT4_CAEELNo assigned EC number0.95880.97700.4521yesN/A
P10987ACT1_DROMENo assigned EC number0.96470.97700.4521yesN/A
P10984ACT2_CAEELNo assigned EC number0.97050.97700.4521yesN/A
P10981ACT5_DROMENo assigned EC number0.97050.97700.4521yesN/A
P10983ACT1_CAEELNo assigned EC number0.95880.97700.4521yesN/A
Q964E0ACTC_BIOTENo assigned EC number0.96470.97700.4521N/AN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
PTZ00281 376 PTZ00281, PTZ00281, actin; Provisional 1e-123
PTZ00004 378 PTZ00004, PTZ00004, actin-2; Provisional 1e-111
smart00268 373 smart00268, ACTIN, Actin 1e-102
pfam00022 367 pfam00022, Actin, Actin 1e-101
PTZ00466 380 PTZ00466, PTZ00466, actin-like protein; Provisiona 8e-78
COG5277 444 COG5277, COG5277, Actin and related proteins [Cyto 2e-77
PTZ00452 375 PTZ00452, PTZ00452, actin; Provisional 2e-76
PTZ00280 414 PTZ00280, PTZ00280, Actin-related protein 3; Provi 1e-61
cd00012185 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide- 6e-17
>gnl|CDD|173506 PTZ00281, PTZ00281, actin; Provisional Back     alignment and domain information 
 Score =  352 bits (903), Expect = e-123
 Identities = 159/170 (93%), Positives = 165/170 (97%)

Query: 1   MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQ 60
           M  +DV ALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRH GVMVGMGQKDSYVGDEAQ
Sbjct: 1   MDGEDVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSYVGDEAQ 60

Query: 61  SKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKM 120
           SKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKM
Sbjct: 61  SKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKM 120

Query: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEDH 170
           TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIV+DSGDGVSHTVPIYE +
Sbjct: 121 TQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGY 170

Length = 376
>gnl|CDD|240225 PTZ00004, PTZ00004, actin-2; Provisional Back     alignment and domain information
>gnl|CDD|214592 smart00268, ACTIN, Actin Back     alignment and domain information
>gnl|CDD|200935 pfam00022, Actin, Actin Back     alignment and domain information
>gnl|CDD|240426 PTZ00466, PTZ00466, actin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|227602 COG5277, COG5277, Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|185631 PTZ00452, PTZ00452, actin; Provisional Back     alignment and domain information
>gnl|CDD|240343 PTZ00280, PTZ00280, Actin-related protein 3; Provisional Back     alignment and domain information
>gnl|CDD|212657 cd00012, NBD_sugar-kinase_HSP70_actin, Nucleotide-Binding Domain of the sugar kinase/HSP70/actin superfamily Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 174
PTZ00281 376 actin; Provisional 100.0
PTZ00452 375 actin; Provisional 100.0
PTZ00466 380 actin-like protein; Provisional 100.0
KOG0679|consensus 426 100.0
PTZ00004 378 actin-2; Provisional 100.0
KOG0676|consensus 372 100.0
PTZ00280 414 Actin-related protein 3; Provisional 100.0
KOG0677|consensus 389 100.0
PF00022 393 Actin: Actin; InterPro: IPR004000 Actin [, ] is a 100.0
smart00268 373 ACTIN Actin. ACTIN subfamily of ACTIN/mreB/sugarki 100.0
cd00012 371 ACTIN Actin; An ubiquitous protein involved in the 100.0
COG5277 444 Actin and related proteins [Cytoskeleton] 100.0
KOG0681|consensus 645 100.0
KOG0678|consensus 415 99.97
KOG0680|consensus 400 99.97
PRK13930 335 rod shape-determining protein MreB; Provisional 99.94
PRK13927 334 rod shape-determining protein MreB; Provisional 99.94
TIGR00904 333 mreB cell shape determining protein, MreB/Mrl fami 99.9
PRK13929 335 rod-share determining protein MreBH; Provisional 99.89
PRK13928 336 rod shape-determining protein Mbl; Provisional 99.83
PF06723 326 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Ba 99.8
KOG0797|consensus 618 99.79
COG1077 342 MreB Actin-like ATPase involved in cell morphogene 99.64
TIGR02529 239 EutJ ethanolamine utilization protein EutJ family 99.09
PRK15080 267 ethanolamine utilization protein EutJ; Provisional 98.95
TIGR01991 599 HscA Fe-S protein assembly chaperone HscA. The Hea 98.65
PLN03184 673 chloroplast Hsp70; Provisional 98.63
PRK13410 668 molecular chaperone DnaK; Provisional 98.62
CHL00094 621 dnaK heat shock protein 70 98.6
PRK13411 653 molecular chaperone DnaK; Provisional 98.59
PTZ00400 663 DnaK-type molecular chaperone; Provisional 98.57
PRK05183 616 hscA chaperone protein HscA; Provisional 98.56
PRK11678 450 putative chaperone; Provisional 98.52
TIGR02350 595 prok_dnaK chaperone protein DnaK. Members of this 98.49
PRK00290 627 dnaK molecular chaperone DnaK; Provisional 98.44
PTZ00009 653 heat shock 70 kDa protein; Provisional 98.4
COG0443 579 DnaK Molecular chaperone [Posttranslational modifi 98.39
PTZ00186 657 heat shock 70 kDa precursor protein; Provisional 98.34
PRK01433 595 hscA chaperone protein HscA; Provisional 98.33
PF00012 602 HSP70: Hsp70 protein; InterPro: IPR013126 Heat sho 98.12
TIGR03739 320 PRTRC_D PRTRC system protein D. A novel genetic sy 98.06
PRK13917 344 plasmid segregation protein ParM; Provisional 97.57
TIGR01174 371 ftsA cell division protein FtsA. This bacterial ce 97.38
PRK10719 475 eutA reactivating factor for ethanolamine ammonia 97.28
KOG0104|consensus 902 96.89
PF06406 318 StbA: StbA protein; InterPro: IPR009440 This entry 96.7
TIGR01175 348 pilM type IV pilus assembly protein PilM. This pro 96.27
PF06277 473 EutA: Ethanolamine utilisation protein EutA; Inter 96.16
COG4820 277 EutJ Ethanolamine utilization protein, possible ch 95.8
PRK11031 496 guanosine pentaphosphate phosphohydrolase; Provisi 95.69
KOG0103|consensus 727 95.29
TIGR03706 300 exo_poly_only exopolyphosphatase. It appears that 95.09
KOG0101|consensus 620 95.08
COG1548 330 Predicted transcriptional regulator/sugar kinase [ 94.84
PRK09472 420 ftsA cell division protein FtsA; Reviewed 94.8
TIGR03123 318 one_C_unchar_1 probable H4MPT-linked C1 transfer p 94.76
PRK10854 513 exopolyphosphatase; Provisional 94.52
PF11104 340 PilM_2: Type IV pilus assembly protein PilM;; PDB: 94.29
COG0248 492 GppA Exopolyphosphatase [Nucleotide transport and 94.08
PF01968 290 Hydantoinase_A: Hydantoinase/oxoprolinase; InterPr 93.55
PRK13321256 pantothenate kinase; Reviewed 92.92
COG4972 354 PilM Tfp pilus assembly protein, ATPase PilM [Cell 92.67
COG1521251 Pantothenate kinase type III (Bvg accessory factor 90.64
PRK13324258 pantothenate kinase; Reviewed 88.48
COG4819 473 EutA Ethanolamine utilization protein, possible ch 88.03
cd08627229 PI-PLCc_gamma1 Catalytic domain of metazoan phosph 87.55
TIGR00671243 baf pantothenate kinase, type III. This model desc 87.38
TIGR0336792 queuosine_QueD queuosine biosynthesis protein QueD 87.32
cd08626257 PI-PLCc_beta4 Catalytic domain of metazoan phospho 86.84
cd08630258 PI-PLCc_delta3 Catalytic domain of metazoan phosph 86.64
cd08632253 PI-PLCc_eta1 Catalytic domain of metazoan phosphoi 86.42
COG0849 418 ftsA Cell division ATPase FtsA [Cell division and 86.35
PRK13318258 pantothenate kinase; Reviewed 86.26
cd08596254 PI-PLCc_epsilon Catalytic domain of metazoan phosp 86.16
cd08629258 PI-PLCc_delta1 Catalytic domain of metazoan phosph 86.08
cd08595257 PI-PLCc_zeta Catalytic domain of metazoan phosphoi 86.01
cd08594227 PI-PLCc_eta Catalytic domain of metazoan phosphoin 85.98
cd08631258 PI-PLCc_delta4 Catalytic domain of metazoan phosph 85.97
cd08593257 PI-PLCc_delta Catalytic domain of metazoan phospho 85.84
cd08633254 PI-PLCc_eta2 Catalytic domain of metazoan phosphoi 85.6
smart00842187 FtsA Cell division protein FtsA. FtsA is essential 85.42
cd08591257 PI-PLCc_beta Catalytic domain of metazoan phosphoi 85.15
cd08592229 PI-PLCc_gamma Catalytic domain of metazoan phospho 84.8
cd08598231 PI-PLC1c_yeast Catalytic domain of putative yeast 84.39
cd08597260 PI-PLCc_PRIP_metazoa Catalytic domain of metazoan 83.29
TIGR00241 248 CoA_E_activ CoA-substrate-specific enzyme activase 82.96
cd08558226 PI-PLCc_eukaryota Catalytic domain of eukaryotic p 82.88
cd08628254 PI-PLCc_gamma2 Catalytic domain of metazoan phosph 81.63
PF08735254 DUF1786: Putative pyruvate format-lyase activating 81.5
cd08623258 PI-PLCc_beta1 Catalytic domain of metazoan phospho 81.5
cd08624261 PI-PLCc_beta2 Catalytic domain of metazoan phospho 81.02
KOG0100|consensus 663 80.96
TIGR03286 404 methan_mark_15 putative methanogenesis marker prot 80.3
>PTZ00281 actin; Provisional Back     alignment and domain information 
Probab=100.00  E-value=3.1e-48  Score=315.10  Aligned_cols=172  Identities=92%  Similarity=1.420  Sum_probs=160.8

Q ss_pred             CCCCCCceEEEECCCccEEEeeeCCCCCCCCCCceeEEeCCCCccccCCCcceeecchhhhccCcceeeccccCCeecCH
Q psy2724           1 MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNW   80 (174)
Q Consensus         1 ~~~~~~~~vViD~Gs~~~k~G~~g~~~P~~~~ps~~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~p~~~g~i~d~   80 (174)
                      |.+|+.++||||+||+++|+||+|++.|++++||+++++++.....+.++++.++|+++...+..+.+++|+++|.|.||
T Consensus         1 ~~~~~~~~vViD~Gs~~~k~G~age~~P~~i~ps~vg~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~l~~Pi~~G~i~dw   80 (376)
T PTZ00281          1 MDGEDVQALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHTGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNW   80 (376)
T ss_pred             CCCCcCCeEEEECCCCeEEEeeCCCCCCCeeccccceeecCcccccCcccCCeEECchhhccccCcEEeccCcCCEEcCH
Confidence            78999999999999999999999999999999999999877543333345678999998777778899999999999999


Q ss_pred             HHHHHHHHHhhccccccCCCCCceEEeeCCCCChHHHHHHHHHhhhhcCCCeeeeehhhhHHhhhcCCCeEEEEecCCCc
Q psy2724          81 DDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGV  160 (174)
Q Consensus        81 ~~~~~l~~~~~~~~L~~~~~~~~vll~e~~~~~~~~r~~l~e~lFE~~~~~sv~~~~~~~la~~~~g~~tglVVDiG~~~  160 (174)
                      |+++.+|+|+|.+.|+++|+++|++++||+++++..|++++|++||.|++|++++.+++++++|+.|++||||||+|++.
T Consensus        81 d~~e~l~~~~f~~~l~v~p~~~pvllte~~~~~~~~re~l~e~lFE~~~vp~~~~~~~~~ls~ya~g~~tglVVDiG~~~  160 (376)
T PTZ00281         81 DDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGV  160 (376)
T ss_pred             HHHHHHHHHHHHhhccCCCccCeEEEecCCCCcHHHHHHHHHHHhcccCCceeEeeccHHHHHHhcCCceEEEEECCCce
Confidence            99999999999889999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             eEEEeeeCCeec
Q psy2724         161 SHTVPIYEDHEG  172 (174)
Q Consensus       161 t~v~pV~dG~~~  172 (174)
                      |+|+||+||++.
T Consensus       161 t~v~PV~dG~~~  172 (376)
T PTZ00281        161 SHTVPIYEGYAL  172 (376)
T ss_pred             EEEEEEEecccc
Confidence            999999999986

>PTZ00452 actin; Provisional Back     alignment and domain information
>PTZ00466 actin-like protein; Provisional Back     alignment and domain information
>KOG0679|consensus Back     alignment and domain information
>PTZ00004 actin-2; Provisional Back     alignment and domain information
>KOG0676|consensus Back     alignment and domain information
>PTZ00280 Actin-related protein 3; Provisional Back     alignment and domain information
>KOG0677|consensus Back     alignment and domain information
>PF00022 Actin: Actin; InterPro: IPR004000 Actin [, ] is a ubiquitous protein involved in the formation of filaments that are major components of the cytoskeleton Back     alignment and domain information
>smart00268 ACTIN Actin Back     alignment and domain information
>cd00012 ACTIN Actin; An ubiquitous protein involved in the formation of filaments that are a major component of the cytoskeleton Back     alignment and domain information
>COG5277 Actin and related proteins [Cytoskeleton] Back     alignment and domain information
>KOG0681|consensus Back     alignment and domain information
>KOG0678|consensus Back     alignment and domain information
>KOG0680|consensus Back     alignment and domain information
>PRK13930 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>PRK13927 rod shape-determining protein MreB; Provisional Back     alignment and domain information
>TIGR00904 mreB cell shape determining protein, MreB/Mrl family Back     alignment and domain information
>PRK13929 rod-share determining protein MreBH; Provisional Back     alignment and domain information
>PRK13928 rod shape-determining protein Mbl; Provisional Back     alignment and domain information
>PF06723 MreB_Mbl: MreB/Mbl protein; InterPro: IPR004753 Bacterial cell shape varies greatly between species, and characteristic morphologies are used for identification purposes Back     alignment and domain information
>KOG0797|consensus Back     alignment and domain information
>COG1077 MreB Actin-like ATPase involved in cell morphogenesis [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02529 EutJ ethanolamine utilization protein EutJ family protein Back     alignment and domain information
>PRK15080 ethanolamine utilization protein EutJ; Provisional Back     alignment and domain information
>TIGR01991 HscA Fe-S protein assembly chaperone HscA Back     alignment and domain information
>PLN03184 chloroplast Hsp70; Provisional Back     alignment and domain information
>PRK13410 molecular chaperone DnaK; Provisional Back     alignment and domain information
>CHL00094 dnaK heat shock protein 70 Back     alignment and domain information
>PRK13411 molecular chaperone DnaK; Provisional Back     alignment and domain information
>PTZ00400 DnaK-type molecular chaperone; Provisional Back     alignment and domain information
>PRK05183 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>PRK11678 putative chaperone; Provisional Back     alignment and domain information
>TIGR02350 prok_dnaK chaperone protein DnaK Back     alignment and domain information
>PRK00290 dnaK molecular chaperone DnaK; Provisional Back     alignment and domain information
>PTZ00009 heat shock 70 kDa protein; Provisional Back     alignment and domain information
>COG0443 DnaK Molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00186 heat shock 70 kDa precursor protein; Provisional Back     alignment and domain information
>PRK01433 hscA chaperone protein HscA; Provisional Back     alignment and domain information
>PF00012 HSP70: Hsp70 protein; InterPro: IPR013126 Heat shock proteins, Hsp70 chaperones help to fold many proteins Back     alignment and domain information
>TIGR03739 PRTRC_D PRTRC system protein D Back     alignment and domain information
>PRK13917 plasmid segregation protein ParM; Provisional Back     alignment and domain information
>TIGR01174 ftsA cell division protein FtsA Back     alignment and domain information
>PRK10719 eutA reactivating factor for ethanolamine ammonia lyase; Provisional Back     alignment and domain information
>KOG0104|consensus Back     alignment and domain information
>PF06406 StbA: StbA protein; InterPro: IPR009440 This entry represents bacterial plasmid segregation proteins ParM and StbA [] Back     alignment and domain information
>TIGR01175 pilM type IV pilus assembly protein PilM Back     alignment and domain information
>PF06277 EutA: Ethanolamine utilisation protein EutA; InterPro: IPR009377 Proteins in this entry are EutA ethanolamine utilization proteins, reactivating factors for ethanolamine ammonia lyase, encoded by the ethanolamine utilization eut operon Back     alignment and domain information
>COG4820 EutJ Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11031 guanosine pentaphosphate phosphohydrolase; Provisional Back     alignment and domain information
>KOG0103|consensus Back     alignment and domain information
>TIGR03706 exo_poly_only exopolyphosphatase Back     alignment and domain information
>KOG0101|consensus Back     alignment and domain information
>COG1548 Predicted transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09472 ftsA cell division protein FtsA; Reviewed Back     alignment and domain information
>TIGR03123 one_C_unchar_1 probable H4MPT-linked C1 transfer pathway protein Back     alignment and domain information
>PRK10854 exopolyphosphatase; Provisional Back     alignment and domain information
>PF11104 PilM_2: Type IV pilus assembly protein PilM;; PDB: 2YCH_A Back     alignment and domain information
>COG0248 GppA Exopolyphosphatase [Nucleotide transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PF01968 Hydantoinase_A: Hydantoinase/oxoprolinase; InterPro: IPR002821 This family includes the enzymes hydantoinase and oxoprolinase (3 Back     alignment and domain information
>PRK13321 pantothenate kinase; Reviewed Back     alignment and domain information
>COG4972 PilM Tfp pilus assembly protein, ATPase PilM [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>COG1521 Pantothenate kinase type III (Bvg accessory factor family protein) [Transcription] Back     alignment and domain information
>PRK13324 pantothenate kinase; Reviewed Back     alignment and domain information
>COG4819 EutA Ethanolamine utilization protein, possible chaperonin protecting lyase from inhibition [Amino acid transport and metabolism] Back     alignment and domain information
>cd08627 PI-PLCc_gamma1 Catalytic domain of metazoan phosphoinositide-specific phospholipase C-gamma1 Back     alignment and domain information
>TIGR00671 baf pantothenate kinase, type III Back     alignment and domain information
>TIGR03367 queuosine_QueD queuosine biosynthesis protein QueD Back     alignment and domain information
>cd08626 PI-PLCc_beta4 Catalytic domain of metazoan phosphoinositide-specific phospholipase C-beta4 Back     alignment and domain information
>cd08630 PI-PLCc_delta3 Catalytic domain of metazoan phosphoinositide-specific phospholipase C-delta3 Back     alignment and domain information
>cd08632 PI-PLCc_eta1 Catalytic domain of metazoan phosphoinositide-specific phospholipase C-eta1 Back     alignment and domain information
>COG0849 ftsA Cell division ATPase FtsA [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK13318 pantothenate kinase; Reviewed Back     alignment and domain information
>cd08596 PI-PLCc_epsilon Catalytic domain of metazoan phosphoinositide-specific phospholipase C-epsilon Back     alignment and domain information
>cd08629 PI-PLCc_delta1 Catalytic domain of metazoan phosphoinositide-specific phospholipase C-delta1 Back     alignment and domain information
>cd08595 PI-PLCc_zeta Catalytic domain of metazoan phosphoinositide-specific phospholipase C-zeta Back     alignment and domain information
>cd08594 PI-PLCc_eta Catalytic domain of metazoan phosphoinositide-specific phospholipase C-eta Back     alignment and domain information
>cd08631 PI-PLCc_delta4 Catalytic domain of metazoan phosphoinositide-specific phospholipase C-delta4 Back     alignment and domain information
>cd08593 PI-PLCc_delta Catalytic domain of metazoan phosphoinositide-specific phospholipase C-delta Back     alignment and domain information
>cd08633 PI-PLCc_eta2 Catalytic domain of metazoan phosphoinositide-specific phospholipase C-eta2 Back     alignment and domain information
>smart00842 FtsA Cell division protein FtsA Back     alignment and domain information
>cd08591 PI-PLCc_beta Catalytic domain of metazoan phosphoinositide-specific phospholipase C-beta Back     alignment and domain information
>cd08592 PI-PLCc_gamma Catalytic domain of metazoan phosphoinositide-specific phospholipase C-gamma Back     alignment and domain information
>cd08598 PI-PLC1c_yeast Catalytic domain of putative yeast phosphatidylinositide-specific phospholipases C Back     alignment and domain information
>cd08597 PI-PLCc_PRIP_metazoa Catalytic domain of metazoan phospholipase C related, but catalytically inactive protein Back     alignment and domain information
>TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative Back     alignment and domain information
>cd08558 PI-PLCc_eukaryota Catalytic domain of eukaryotic phosphoinositide-specific phospholipase C and similar proteins Back     alignment and domain information
>cd08628 PI-PLCc_gamma2 Catalytic domain of metazoan phosphoinositide-specific phospholipase C-gamma2 Back     alignment and domain information
>PF08735 DUF1786: Putative pyruvate format-lyase activating enzyme (DUF1786); InterPro: IPR014846 This family is annotated as pyruvate formate-lyase activating enzyme (1 Back     alignment and domain information
>cd08623 PI-PLCc_beta1 Catalytic domain of metazoan phosphoinositide-specific phospholipase C-beta1 Back     alignment and domain information
>cd08624 PI-PLCc_beta2 Catalytic domain of metazoan phosphoinositide-specific phospholipase C-beta2 Back     alignment and domain information
>KOG0100|consensus Back     alignment and domain information
>TIGR03286 methan_mark_15 putative methanogenesis marker protein 15 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
3eks_A 375 Crystal Structure Of Monomeric Actin Bound To Cytoc 2e-97
1d4x_A 375 Crystal Structure Of Caenorhabditis Elegans Mg-Atp 3e-97
3byh_A 374 Model Of Actin-Fimbrin Abd2 Complex Length = 374 3e-96
2oan_A 375 Structure Of Oxidized Beta-Actin Length = 375 3e-96
3u4l_A 375 Cryocooled Bovine Profilin:actin Crystal Structure 3e-96
2hf3_A 374 Crystal Structure Of Monomeric Actin In The Adp Bou 3e-96
2btf_A 375 The Structure Of Crystalline Profilin-Beta-Actin Le 2e-95
1nlv_A 375 Crystal Structure Of Dictyostelium Discoideum Actin 4e-94
4efh_A 375 Acanthamoeba Actin Complex With Spir Domain D Lengt 4e-94
3b63_L 365 Actin Filament Model In The Extended Form Of Acroms 4e-94
3chw_A 375 Complex Of Dictyostelium Discoideum Actin With Prof 3e-93
1dej_A 375 Crystal Structure Of A DictyosteliumTETRAHYMENA CHI 4e-93
1c0g_A 375 Crystal Structure Of 1:1 Complex Between Gelsolin S 4e-93
3a5l_C 375 Crystal Structure Of A Dictyostelium P109a Mg2+-Act 2e-92
3ci5_A 375 Complex Of Phosphorylated Dictyostelium Discoideum 3e-92
1ijj_A 377 The X-Ray Crystal Structure Of The Complex Between 3e-92
3a5m_C 375 Crystal Structure Of A Dictyostelium P109i Mg2+-Act 3e-92
4b1v_A 376 Structure Of The Phactr1 Rpel-N Domain Bound To G-A 1e-91
1yag_A 375 Structure Of The Yeast Actin-human Gelsolin Segment 2e-91
3m6g_A 371 Crystal Structure Of Actin In Complex With Lobophor 2e-91
2w49_D 372 Isometrically Contracting Insect Asynchronous Fligh 2e-91
1kxp_A 375 Crystal Structure Of Human Vitamin D-binding Protei 2e-91
1eqy_A 377 Complex Between Rabbit Muscle Alpha-Actin: Human Ge 3e-91
3w3d_A 374 Crystal Structure Of Smooth Muscle G Actin Dnase I 8e-91
1yvn_A 375 The Yeast Actin Val 159 Asn Mutant Complex With Hum 1e-90
3b63_E 365 Actin Filament Model In The Extended Form Of Acroms 2e-90
1atn_A 373 Atomic Structure Of The Actin:dnase I Complex Lengt 2e-90
3g37_O 376 Cryo-Em Structure Of Actin Filament In The Presence 2e-90
1qz5_A 375 Structure Of Rabbit Actin In Complex With Kabiramid 2e-90
1t44_A 370 Structural Basis Of Actin Sequestration By Thymosin 2e-90
3b63_C 365 Actin Filament Model In The Extended Form Of Acroms 2e-90
3b63_A 365 Actin Filament Model In The Extended Form Of Acroms 2e-89
2gwj_A 371 Spvb Adp-Ribosylated Actin: Hexagonal Crystal Form 2e-89
1lcu_A 371 Polylysine Induces An Antiparallel Actin Dimer That 1e-88
3b63_B 364 Actin Filament Model In The Extended Form Of Acroms 3e-88
3b63_F 357 Actin Filament Model In The Extended Form Of Acroms 3e-88
3b63_D 357 Actin Filament Model In The Extended Form Of Acroms 3e-88
1c0f_A 368 Crystal Structure Of Dictyostelium Caatp-Actin In C 6e-87
3mn5_A 359 Structures Of Actin-Bound Wh2 Domains Of Spire And 6e-78
2p9k_B 394 Crystal Structure Of Bovine Arp23 COMPLEX CO-Crysta 8e-44
1k8k_B 394 Crystal Structure Of Arp23 COMPLEX Length = 394 2e-43
3dwl_A 427 Crystal Structure Of Fission Yeast Arp2/3 Complex L 6e-32
1k8k_A 418 Crystal Structure Of Arp23 COMPLEX Length = 418 8e-31
3qb0_A 498 Crystal Structure Of Actin-Related Protein Arp4 Fro 1e-16
4i6m_A 477 Structure Of Arp7-arp9-snf2(hsa)-rtt102 Subcomplex 3e-12
>pdb|3EKS|A Chain A, Crystal Structure Of Monomeric Actin Bound To Cytochalasin D Length = 375 Back     alignment and structure 
Iteration: 1

 Score =  350 bits (898), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 163/169 (96%), Positives = 168/169 (99%)
Query: 2   CDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS 61
           CD++VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS
Sbjct: 1   CDEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQS 60
Query: 62  KRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMT 121
           KRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP+LLTEAPLNPKANREKMT
Sbjct: 61  KRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMT 120
Query: 122 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEDH 170
           QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYE +
Sbjct: 121 QIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGY 169
>pdb|1D4X|A Chain A, Crystal Structure Of Caenorhabditis Elegans Mg-Atp Actin Complexed With Human Gelsolin Segment 1 At 1.75 A Resolution Length = 375 Back     alignment and structure
>pdb|3BYH|A Chain A, Model Of Actin-Fimbrin Abd2 Complex Length = 374 Back     alignment and structure
>pdb|2OAN|A Chain A, Structure Of Oxidized Beta-Actin Length = 375 Back     alignment and structure
>pdb|3U4L|A Chain A, Cryocooled Bovine Profilin:actin Crystal Structure To 2.4 A Length = 375 Back     alignment and structure
>pdb|2HF3|A Chain A, Crystal Structure Of Monomeric Actin In The Adp Bound State Length = 374 Back     alignment and structure
>pdb|2BTF|A Chain A, The Structure Of Crystalline Profilin-Beta-Actin Length = 375 Back     alignment and structure
>pdb|1NLV|A Chain A, Crystal Structure Of Dictyostelium Discoideum Actin Complexed With Ca Atp And Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|4EFH|A Chain A, Acanthamoeba Actin Complex With Spir Domain D Length = 375 Back     alignment and structure
>pdb|3B63|L Chain L, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|3CHW|A Chain A, Complex Of Dictyostelium Discoideum Actin With Profilin And The Last Poly-Pro Of Human Vasp Length = 375 Back     alignment and structure
>pdb|1DEJ|A Chain A, Crystal Structure Of A DictyosteliumTETRAHYMENA CHIMERA Actin (Mutant 646: Q228kT229AA230YA231KS232EE360H) IN Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|1C0G|A Chain A, Crystal Structure Of 1:1 Complex Between Gelsolin Segment 1 And A DictyosteliumTETRAHYMENA CHIMERA ACTIN (MUTANT 228: Q228kT229AA230YE360H) Length = 375 Back     alignment and structure
>pdb|3A5L|C Chain C, Crystal Structure Of A Dictyostelium P109a Mg2+-Actin In Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|3CI5|A Chain A, Complex Of Phosphorylated Dictyostelium Discoideum Actin With Gelsolin Length = 375 Back     alignment and structure
>pdb|1IJJ|A Chain A, The X-Ray Crystal Structure Of The Complex Between Rabbit Skeletal Muscle Actin And Latrunculin A At 2.85 A Resolution Length = 377 Back     alignment and structure
>pdb|3A5M|C Chain C, Crystal Structure Of A Dictyostelium P109i Mg2+-Actin In Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|4B1V|A Chain A, Structure Of The Phactr1 Rpel-N Domain Bound To G-Actin Length = 376 Back     alignment and structure
>pdb|1YAG|A Chain A, Structure Of The Yeast Actin-human Gelsolin Segment 1 Complex Length = 375 Back     alignment and structure
>pdb|3M6G|A Chain A, Crystal Structure Of Actin In Complex With Lobophorolide Length = 371 Back     alignment and structure
>pdb|2W49|D Chain D, Isometrically Contracting Insect Asynchronous Flight Muscle Length = 372 Back     alignment and structure
>pdb|1KXP|A Chain A, Crystal Structure Of Human Vitamin D-binding Protein In Complex With Skeletal Actin Length = 375 Back     alignment and structure
>pdb|1EQY|A Chain A, Complex Between Rabbit Muscle Alpha-Actin: Human Gelsolin Domain 1 Length = 377 Back     alignment and structure
>pdb|3W3D|A Chain A, Crystal Structure Of Smooth Muscle G Actin Dnase I Complex Length = 374 Back     alignment and structure
>pdb|1YVN|A Chain A, The Yeast Actin Val 159 Asn Mutant Complex With Human Gelsolin Segment 1 Length = 375 Back     alignment and structure
>pdb|3B63|E Chain E, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|1ATN|A Chain A, Atomic Structure Of The Actin:dnase I Complex Length = 373 Back     alignment and structure
>pdb|3G37|O Chain O, Cryo-Em Structure Of Actin Filament In The Presence Of Phosphate Length = 376 Back     alignment and structure
>pdb|1QZ5|A Chain A, Structure Of Rabbit Actin In Complex With Kabiramide C Length = 375 Back     alignment and structure
>pdb|1T44|A Chain A, Structural Basis Of Actin Sequestration By Thymosin-B4: Implications For Arp23 ACTIVATION Length = 370 Back     alignment and structure
>pdb|3B63|C Chain C, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|3B63|A Chain A, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 365 Back     alignment and structure
>pdb|2GWJ|A Chain A, Spvb Adp-Ribosylated Actin: Hexagonal Crystal Form Length = 371 Back     alignment and structure
>pdb|1LCU|A Chain A, Polylysine Induces An Antiparallel Actin Dimer That Nucleates Filament Assembly: Crystal Structure At 3.5 A Resolution Length = 371 Back     alignment and structure
>pdb|3B63|B Chain B, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 364 Back     alignment and structure
>pdb|3B63|F Chain F, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 357 Back     alignment and structure
>pdb|3B63|D Chain D, Actin Filament Model In The Extended Form Of Acromsomal Bundle In The Limulus Sperm Length = 357 Back     alignment and structure
>pdb|1C0F|A Chain A, Crystal Structure Of Dictyostelium Caatp-Actin In Complex With Gelsolin Segment 1 Length = 368 Back     alignment and structure
>pdb|3MN5|A Chain A, Structures Of Actin-Bound Wh2 Domains Of Spire And The Implication For Filament Nucleation Length = 359 Back     alignment and structure
>pdb|2P9K|B Chain B, Crystal Structure Of Bovine Arp23 COMPLEX CO-Crystallized With Atp And Crosslinked With Glutaraldehyde Length = 394 Back     alignment and structure
>pdb|1K8K|B Chain B, Crystal Structure Of Arp23 COMPLEX Length = 394 Back     alignment and structure
>pdb|3DWL|A Chain A, Crystal Structure Of Fission Yeast Arp2/3 Complex Lacking The Arp2 Subunit Length = 427 Back     alignment and structure
>pdb|1K8K|A Chain A, Crystal Structure Of Arp23 COMPLEX Length = 418 Back     alignment and structure
>pdb|3QB0|A Chain A, Crystal Structure Of Actin-Related Protein Arp4 From S. Cerevisiae Complexed With Atp Length = 498 Back     alignment and structure
>pdb|4I6M|A Chain A, Structure Of Arp7-arp9-snf2(hsa)-rtt102 Subcomplex Of Swi/snf Chromatin Remodeler Length = 477 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
2fxu_A 375 Alpha-actin-1, actin, alpha skeletal muscle; actin 1e-122
1k8k_A 418 ARP3, actin-like protein 3, actin-2; beta-propelle 1e-117
1k8k_B 394 ARP2, actin-like protein 2; beta-propeller, struct 1e-116
3dwl_A 427 Actin-related protein 3; propellor, actin-binding, 1e-107
3qb0_A 498 Actin-related protein 4; actin fold, ATP binding, 1e-105
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Length = 375 Back     alignment and structure
 Score =  347 bits (893), Expect = e-122
 Identities = 155/168 (92%), Positives = 160/168 (95%)

Query: 3   DDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 62
           +D+  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK
Sbjct: 2   EDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSK 61

Query: 63  RGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQ 122
           RGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQ
Sbjct: 62  RGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQ 121

Query: 123 IMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEDH 170
           IMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYE +
Sbjct: 122 IMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGY 169
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Length = 418 Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Length = 394 Back     alignment and structure
>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Length = 427 Back     alignment and structure
>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Length = 498 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query174
3dwl_A 427 Actin-related protein 3; propellor, actin-binding, 100.0
3qb0_A 498 Actin-related protein 4; actin fold, ATP binding, 100.0
4fo0_A 593 Actin-related protein 8; chromatin remodeling, nuc 100.0
2fxu_A 375 Alpha-actin-1, actin, alpha skeletal muscle; actin 100.0
1k8k_B 394 ARP2, actin-like protein 2; beta-propeller, struct 100.0
1k8k_A 418 ARP3, actin-like protein 3, actin-2; beta-propelle 100.0
4am6_A 655 Actin-like protein ARP8; nuclear protein, chromati 100.0
1jce_A 344 ROD shape-determining protein MREB; MBL, actin, HS 99.9
3h1q_A 272 Ethanolamine utilization protein EUTJ; ethanolamin 99.59
2v7y_A 509 Chaperone protein DNAK; HSP70, heat shock protein, 99.5
3qfu_A 394 78 kDa glucose-regulated protein homolog; HSP70, K 99.38
3i33_A 404 Heat shock-related 70 kDa protein 2; protein-ADP c 99.27
1dkg_D 383 Molecular chaperone DNAK; HSP70, GRPE, nucleotide 99.2
2fsj_A 346 Hypothetical protein TA0583; actin homologs, archa 99.13
1yuw_A 554 Heat shock cognate 71 kDa protein; chaperone; 2.60 98.83
2kho_A 605 Heat shock protein 70; molecular chaperone, HSP70, 98.8
4gni_A 409 Putative heat shock protein; HSP70-type ATPase, AT 98.77
4b9q_A 605 Chaperone protein DNAK; HET: ATP; 2.40A {Escherich 98.64
3d2f_A 675 Heat shock protein homolog SSE1; nucleotide exchan 98.56
2ych_A 377 Competence protein PILM; cell cycle, type IV pilus 98.35
3js6_A 355 Uncharacterized PARM protein; partition, segregati 98.24
4apw_A 329 ALP12; actin-like protein; 19.70A {Clostridium tet 98.05
2zgy_A 320 Plasmid segregation protein PARM; plasmid partitio 97.85
4a2a_A 419 Cell division protein FTSA, putative; cell cycle, 97.58
3hi0_A 508 Putative exopolyphosphatase; 17739545, structural 95.57
1t6c_A 315 Exopolyphosphatase; alpha/beta protein, actin-like 94.96
3mdq_A 315 Exopolyphosphatase; structural genomics, joint cen 94.9
3cer_A 343 Possible exopolyphosphatase-like protein; NESG, BL 94.89
1u6z_A 513 Exopolyphosphatase; alpha/beta protein, askha (ace 94.74
3aap_A 353 Ectonucleoside triphosphate diphosphohydrolase I; 93.95
3cet_A 334 Conserved archaeal protein; Q6M145, MRR63, NESG, X 92.83
2h3g_X268 Biosynthetic protein; pantothenate kinase, anthrax 90.8
3djc_A266 Type III pantothenate kinase; structural genomics, 89.7
3zx3_A 452 Ectonucleoside triphosphate diphosphohydrolase 1; 88.45
3bex_A249 Type III pantothenate kinase; actin-like fold, ATP 86.57
>3dwl_A Actin-related protein 3; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
Probab=100.00  E-value=4.6e-47  Score=311.33  Aligned_cols=171  Identities=44%  Similarity=0.783  Sum_probs=151.3

Q ss_pred             CCCCCCceEEEECCCccEEEeeeCCCCCCCCCCceeEEeCCCC----------------------ccccCCCcceeecch
Q psy2724           1 MCDDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG----------------------VMVGMGQKDSYVGDE   58 (174)
Q Consensus         1 ~~~~~~~~vViD~Gs~~~k~G~~g~~~P~~~~ps~~~~~~~~~----------------------~~~~~~~~~~~~g~~   58 (174)
                      |. -+.++||||+||+++|+||||++.|++++||++|++++..                      ...+..+++.++|++
T Consensus         1 m~-~~~~~iViDnGs~~~KaG~ag~~~P~~v~Ps~vg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vG~e   79 (427)
T 3dwl_A            1 MA-SFNVPIIMDNGTGYSKLGYAGNDAPSYVFPTVIATRSAGASSGPAVSSKPSYMASKGSGHLSSKRATEDLDFFIGND   79 (427)
T ss_dssp             ---CCCSCEEECCCSSBC-CEETTSSSCSCCCBCCEECC------------------------------CCSSCCEETHH
T ss_pred             CC-CCCCeEEEECCCCeEEEEECCCCCCCCcCCceEEeecccccccccccccccccccccccccccccCcccCCeEEchH
Confidence            44 4678999999999999999999999999999999987531                      011334567899999


Q ss_pred             hhhccC-cceeeccccCCeecCHHHHHHHHHHhhccccccCCCCCceEEeeCCCCChHHHHHHHHHhhhhcCCCeeeeeh
Q psy2724          59 AQSKRG-ILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAI  137 (174)
Q Consensus        59 ~~~~~~-~~~~~~p~~~g~i~d~~~~~~l~~~~~~~~L~~~~~~~~vll~e~~~~~~~~r~~l~e~lFE~~~~~sv~~~~  137 (174)
                      +...+. .+.+++|+++|+|.|||.+|++|+|+|++.|++++.++|++++||+++++..|++++|++||.|++|+++++.
T Consensus        80 a~~~~~~~l~~~~Pi~~GvI~dwd~~e~iw~~~~~~~L~v~~~~~pvlltep~~~~~~~re~~~ei~FE~~~~p~v~l~~  159 (427)
T 3dwl_A           80 ALKKASAGYSLDYPIRHGQIENWDHMERFWQQSLFKYLRCEPEDHYFLLTEPPLNPPENRENTAEIMFESFNCAGLYIAV  159 (427)
T ss_dssp             HHHTHHHHCCCCCSEETTEECCHHHHHHHHHHHHHTTSCCCGGGCEEEEEECTTCCHHHHHHHHHHHTTTTCCSEEEEEE
T ss_pred             HhhCcccCcEEecCcccCeeccHHHHHHHHHHHHhHhhCCCCcCCcEEEEcCCCCCHHHHHHHHHHHHHhccCceeeecc
Confidence            987664 6889999999999999999999999998999999999999999999999999999999999999999999999


Q ss_pred             hhhHHhhhcC--------CCeEEEEecCCCceEEEeeeCCeec
Q psy2724         138 QAVLSLYASG--------RTTGIVLDSGDGVSHTVPIYEDHEG  172 (174)
Q Consensus       138 ~~~la~~~~g--------~~tglVVDiG~~~t~v~pV~dG~~~  172 (174)
                      +++||+|++|        ++||||||+|++.|+|+||++|++.
T Consensus       160 ~~vla~~a~G~~~~~~~~~~tglVVDiG~g~T~v~PV~~G~~l  202 (427)
T 3dwl_A          160 QAVLALAASWTSSKVTDRSLTGTVVDSGDGVTHIIPVAEGYVI  202 (427)
T ss_dssp             HHHHHHHGGGGSTTTCSCCCCEEEEEESSSCEEEEEEETTEEC
T ss_pred             hHHHHHHhcCCcccccCCCceEEEEECCCCceEEEEEECCEEe
Confidence            9999999998        6899999999999999999999986
>3qb0_A Actin-related protein 4; actin fold, ATP binding, nucleus, structural protein; HET: ATP; 3.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4fo0_A Actin-related protein 8; chromatin remodeling, nucleosomes, NU gene regulation; HET: ATP; 2.60A {Homo sapiens} Back     alignment and structure
>2fxu_A Alpha-actin-1, actin, alpha skeletal muscle; actin complexed to bistramide A, structural protein; HET: HIC ATP BID; 1.35A {Oryctolagus cuniculus} SCOP: c.55.1.1 c.55.1.1 PDB: 1h1v_A* 1kxp_A* 1lot_B* 1m8q_7* 1ma9_B* 1mvw_1* 1nwk_A* 1o18_1* 1o19_1* 1o1a_1* 1o1b_0* 1o1c_0* 1o1d_0* 1o1e_1* 1o1f_0* 1o1g_1* 1j6z_A* 1qz6_A* 1rdw_X* 1rfq_A* ... Back     alignment and structure
>1k8k_B ARP2, actin-like protein 2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 PDB: 1tyq_B* 1u2v_B* 2p9i_B* 2p9l_B 2p9n_B* 2p9p_B* 2p9s_B* 2p9u_B* 3dxk_B* 3dxm_B* 3rse_B 2p9k_B* Back     alignment and structure
>1k8k_A ARP3, actin-like protein 3, actin-2; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: c.55.1.1 c.55.1.1 PDB: 1tyq_A* 1u2v_A* 2p9i_A* 2p9k_A* 2p9l_A 2p9n_A* 2p9p_A* 2p9s_A* 2p9u_A* 3dxk_A* 3dxm_A* 3rse_A Back     alignment and structure
>4am6_A Actin-like protein ARP8; nuclear protein, chromatin remodelling complex, ATP-binding nuclear actin-related protein; 2.70A {Saccharomyces cerevisiae} PDB: 4am7_A* Back     alignment and structure
>1jce_A ROD shape-determining protein MREB; MBL, actin, HSP-70, FTSZ, structural protein; 2.10A {Thermotoga maritima} SCOP: c.55.1.1 c.55.1.1 PDB: 1jcf_A 1jcg_A* 2wus_A Back     alignment and structure
>3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} Back     alignment and structure
>2v7y_A Chaperone protein DNAK; HSP70, heat shock protein, ATPase, domain rearrangement; HET: ADP; 2.37A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3i33_A Heat shock-related 70 kDa protein 2; protein-ADP complex, ATP-binding, chaperone, nucleotide-BIND phosphoprotein, stress response; HET: ADP; 1.30A {Homo sapiens} PDB: 4fsv_A* 1hx1_A 3jxu_A* 2qwl_A* 2qw9_A* 2qwm_A* 1hpm_A* 1ngi_A* 1ngj_A* 3hsc_A* 1ngb_A* 3ldq_A* 3fzf_A* 3fzk_A* 3fzl_A* 3fzm_A* 3fzh_A* 3m3z_A* 1ngh_A* 1ngd_A* ... Back     alignment and structure
>1dkg_D Molecular chaperone DNAK; HSP70, GRPE, nucleotide exchange factor, coiled-coil, complex (HSP24/HSP70); 2.80A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 Back     alignment and structure
>2fsj_A Hypothetical protein TA0583; actin homologs, archaea, ATPase, MREB, PARM, structural PROT; 1.90A {Thermoplasma acidophilum} SCOP: c.55.1.12 c.55.1.12 PDB: 2fsk_A 2fsn_A* Back     alignment and structure
>1yuw_A Heat shock cognate 71 kDa protein; chaperone; 2.60A {Bos taurus} SCOP: b.130.1.1 c.55.1.1 c.55.1.1 PDB: 3c7n_B* 2v7z_A* Back     alignment and structure
>2kho_A Heat shock protein 70; molecular chaperone, HSP70, peptide binding, protein folding, acetylation, ATP-binding, cell inner membrane; NMR {Escherichia coli} Back     alignment and structure
>4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} Back     alignment and structure
>4b9q_A Chaperone protein DNAK; HET: ATP; 2.40A {Escherichia coli} PDB: 2kho_A 1dkg_D Back     alignment and structure
>3d2f_A Heat shock protein homolog SSE1; nucleotide exchange factor, protein folding, ATP-binding, Ca binding, chaperone, nucleotide-binding, phosphoprotein; HET: ATP; 2.30A {Saccharomyces cerevisiae} PDB: 3d2e_A* 3c7n_A* 2qxl_A* Back     alignment and structure
>2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} Back     alignment and structure
>3js6_A Uncharacterized PARM protein; partition, segregation, filament, unknown function; 1.95A {Staphylococcus aureus} Back     alignment and structure
>4apw_A ALP12; actin-like protein; 19.70A {Clostridium tetani} Back     alignment and structure
>2zgy_A Plasmid segregation protein PARM; plasmid partition, structural protein; HET: GDP; 1.90A {Escherichia coli} SCOP: c.55.1.1 c.55.1.1 PDB: 1mwk_A* 2qu4_A 1mwm_A* 2zgz_A* 2zhc_A* 3iku_A 3iky_A Back     alignment and structure
>4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* Back     alignment and structure
>3hi0_A Putative exopolyphosphatase; 17739545, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>1t6c_A Exopolyphosphatase; alpha/beta protein, actin-like fold, hydrolase; 1.53A {Aquifex aeolicus} SCOP: c.55.1.8 c.55.1.8 PDB: 1t6d_A 2j4r_A* Back     alignment and structure
>3mdq_A Exopolyphosphatase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE; 1.50A {Cytophaga hutchinsonii} Back     alignment and structure
>3cer_A Possible exopolyphosphatase-like protein; NESG, BLR13, Q8G5J2, X-RAY, structure, structural genomics, PSI-2; 2.40A {Bifidobacterium longum NCC2705} Back     alignment and structure
>1u6z_A Exopolyphosphatase; alpha/beta protein, askha (acetate and sugar kinases, HSC70, superfamily; 1.90A {Escherichia coli} SCOP: a.211.1.5 c.55.1.8 c.55.1.8 PDB: 2flo_A* Back     alignment and structure
>3aap_A Ectonucleoside triphosphate diphosphohydrolase I; adenosine triphosphatase, ntpdase; 1.60A {Legionella pneumophila} PDB: 3aaq_A* 3aar_A* Back     alignment and structure
>3cet_A Conserved archaeal protein; Q6M145, MRR63, NESG, XRAY, structure, structural genomics, PSI-2, protein structure initiative; 1.80A {Methanococcus maripaludis S2} PDB: 3c0b_A Back     alignment and structure
>2h3g_X Biosynthetic protein; pantothenate kinase, anthrax, type III pantothenate kinase, COAX, COAA, askha; 2.00A {Bacillus anthracis str} Back     alignment and structure
>3djc_A Type III pantothenate kinase; structural genomics, putative transfera 2, protein structure initiative; 2.40A {Legionella pneumophila subsp} Back     alignment and structure
>3zx3_A Ectonucleoside triphosphate diphosphohydrolase 1; domain rotation, purinergic signaling; 1.70A {Rattus norvegicus} PDB: 3zx2_A* 3zx0_A* Back     alignment and structure
>3bex_A Type III pantothenate kinase; actin-like fold, ATP-binding, coenzyme A biosynthesis, cytoplasm, metal-binding, nucleotide-binding, potassium; HET: PAU; 1.51A {Thermotoga maritima} SCOP: c.55.1.13 c.55.1.13 PDB: 3bf1_A* 3bf3_A* 2gtd_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 174
d2fxua1140 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 2e-80
d1k8ka1158 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 { 5e-76
d2fxua2 225 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxI 1e-07
d1k8ka2 258 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 1e-06
d1k8kb1 190 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 1e-05
>d2fxua1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]} Length = 140 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Actin
species: Cow (Bos taurus) [TaxId: 9913]

 Score =  232 bits (593), Expect = 2e-80
 Identities = 135/140 (96%), Positives = 136/140 (97%)

Query: 8   ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 67
           ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT
Sbjct: 1   ALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILT 60

Query: 68  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFET 127
           LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFET
Sbjct: 61  LKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFET 120

Query: 128 FNTPAMYVAIQAVLSLYASG 147
           FN PAMYVAIQAVLSLYASG
Sbjct: 121 FNVPAMYVAIQAVLSLYASG 140
>d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Length = 158 Back     information, alignment and structure
>d2fxua2 c.55.1.1 (A:147-371) Actin {Cow (Bos taurus) [TaxId: 9913]} Length = 225 Back     information, alignment and structure
>d1k8ka2 c.55.1.1 (A:161-418) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Length = 258 Back     information, alignment and structure
>d1k8kb1 c.55.1.1 (B:154-343) Actin-related protein 2, Arp2 {Cow (Bos taurus) [TaxId: 9913]} Length = 190 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query174
d1k8ka1158 Actin-related protein 3, Arp3 {Cow (Bos taurus) [T 100.0
d2fxua1140 Actin {Cow (Bos taurus) [TaxId: 9913]} 100.0
d1jcea1137 Prokaryotic actin homolog MreB {Thermotoga maritim 98.92
d1dkgd1183 Heat shock protein 70kDa, ATPase fragment {Escheri 98.19
d1bupa1185 Heat shock protein 70kDa, ATPase fragment {Cow (Bo 98.17
d2fsja2164 Hypothetical protein Ta0583 {Archaeon Thermoplasma 95.18
d2zgya1157 Plasmid segregation protein ParM {Escherichia coli 94.78
d1q18a1110 Glucokinase Glk {Escherichia coli [TaxId: 562]} 93.6
d2aa4a1119 N-acetylmannosamine kinase NanK {Escherichia coli 90.09
d1zc6a1114 Probable N-acetylglucosamine kinase CV2896 {Chromo 88.04
d2ch5a2117 N-acetylglucosamine kinase, NAGK {Human (Homo sapi 87.29
>d1k8ka1 c.55.1.1 (A:3-160) Actin-related protein 3, Arp3 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Ribonuclease H-like motif
superfamily: Actin-like ATPase domain
family: Actin/HSP70
domain: Actin-related protein 3, Arp3
species: Cow (Bos taurus) [TaxId: 9913]

Probab=100.00  E-value=2.3e-42  Score=247.15  Aligned_cols=145  Identities=43%  Similarity=0.745  Sum_probs=128.6

Q ss_pred             CceEEEECCCccEEEeeeCCCCCCCCCCceeEEeCCCCc--------cccCCCcceeecchhhhccCcceeeccccCCee
Q psy2724           6 VAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGV--------MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGII   77 (174)
Q Consensus         6 ~~~vViD~Gs~~~k~G~~g~~~P~~~~ps~~~~~~~~~~--------~~~~~~~~~~~g~~~~~~~~~~~~~~p~~~g~i   77 (174)
                      .++||||+||+++||||||++.|++++||++|.++....        ..+....+.++|+++.. +..+.+.+|+++|.+
T Consensus         3 ~PavViD~GS~~~KaG~age~~P~~i~Ps~vg~~~~~~~~~~~~~~~~~~~~~~~~~ig~e~~~-~~~~~~~~pi~~G~i   81 (158)
T d1k8ka1           3 LPACVVDCGTGYTKLGYAGNTEPQFIIPSCIAIKESAKVGDQAQRRVMKGVDDLDFFIGDEAIE-KPTYATKWPIRHGIV   81 (158)
T ss_dssp             SCCEEEEECSSEEEEEETTCSSCSEEEESCEEECC-----------CCCTTGGGCEEEGGGGTS-CTTSEEECCEETTEE
T ss_pred             CCcEEEECCCCeEEEEECCCCCCCEEeccceeecccccccCchhcccccCCCccceecChhhhh-CCCccccccccCCeE
Confidence            578999999999999999999999999999998755321        12233456789999864 456889999999999


Q ss_pred             cCHHHHHHHHHHhhccccccCCCCCceEEeeCCCCChHHHHHHHHHhhhhcCCCeeeeehhhhHHhhhcCCCeE
Q psy2724          78 TNWDDMEKIWHHTFYNELRVAPEEHPILLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTG  151 (174)
Q Consensus        78 ~d~~~~~~l~~~~~~~~L~~~~~~~~vll~e~~~~~~~~r~~l~e~lFE~~~~~sv~~~~~~~la~~~~g~~tg  151 (174)
                      .|||.++.+|+|+|++.|+++++++|+++|||+++++..|++++|+|||+|++|+++++++++||+||+|++++
T Consensus        82 ~dwd~~e~l~~~~~~~~l~v~~~~~pvlltEp~~~~~~~Re~~~EilFE~~~vpa~~~~~~~~Lslya~g~~~~  155 (158)
T d1k8ka1          82 EDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNVPGLYIAVQAVLALAASWTSRQ  155 (158)
T ss_dssp             SCHHHHHHHHHHHHHTTTCCCGGGCCEEEEECTTCCHHHHHHHHHHHHHTSCCSEEEEEEHHHHHHHHGGGSTT
T ss_pred             ecHHHHHHHHHHHHHHhcccCCCCCceeeeecCCCCHHHHHHHHHHHhhhcCCCEEEEEchhhhhheeCCCCCC
Confidence            99999999999999899999999999999999999999999999999999999999999999999999998765
>d2fxua1 c.55.1.1 (A:7-146) Actin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} Back     information, alignment and structure
>d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fsja2 c.55.1.12 (A:1-164) Hypothetical protein Ta0583 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2zgya1 c.55.1.1 (A:1-157) Plasmid segregation protein ParM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q18a1 c.55.1.7 (A:2-111) Glucokinase Glk {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2aa4a1 c.55.1.10 (A:1-119) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zc6a1 c.55.1.5 (A:8-121) Probable N-acetylglucosamine kinase CV2896 {Chromobacterium violaceum [TaxId: 536]} Back     information, alignment and structure
>d2ch5a2 c.55.1.5 (A:1-117) N-acetylglucosamine kinase, NAGK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure