Psyllid ID: psy2936

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170----
MPVFRIETNIPKEKIPANFGKETGALVAKTLGKPENYVAVIVVPDVNLVFGGSDAPAAIASLMSIGKLGTAENKKHSAVLFPHIEKTLGIPKDRMYISYIDSSTDVVGYNGTTFHEIFGGPVLNKRAMESIVLEFKNVLIKNQSTTTVAFSCGLLGKPSDYLNPYVVRISLPLQ
ccEEEEEEcccccccccHHHHHHHHHHHHHHccccccEEEEEEccEEEEEccccccEEEEEEEEEccccHHHHHHHHHHHHHHHHHHHccccccEEEEEEEcccccEEEcccHHHHHHcccccccHHHHHHHHHHHHHHHHccccEEEEEEEccccccccccccEEEEEEcccc
ccEEEEEEcccHHHccccHHHHHHHHHHHHHcccHHHcEEEEEcccEEEEccEccccEEEEEEEccccccccHHHHHHHHHHHHHHHHcccHHHEEEEEEEccHHHEEEccEccHHHHcccHHcHHHHHHHHHHHHHEEEEccccEEEEEEcccccccccccccEEEEEEcccc
mpvfrietnipkekipanfgkETGALVAKtlgkpenyVAVIVVPdvnlvfggsdaPAAIASLMSIgklgtaenkkhsavlfphiektlgipkdrmyisyidsstdvvgyngttfheifggpvlnkRAMESIVLEFKNVLIKNQSTTTVAfscgllgkpsdylnpyvVRISLPLQ
mpvfrietnipkekipanfgkETGALVAKTLGKPENYVAVIVVPDVNLVFGGSDAPAAIASLMSIGKLGTAENKKHSAVLFPHiektlgipkdRMYISYIDSSTDVVGYNGTTFHEIFGGPVLNKRAMESIVLEFKNVLIKNQSTTTVAFSCgllgkpsdylnpyVVRISLPLQ
MPVFRIETNIPKEKIPANFGKETGALVAKTLGKPENYVAVIVVPDVNLVFGGSDAPAAIASLMSIGKLGTAENKKHSAVLFPHIEKTLGIPKDRMYISYIDSSTDVVGYNGTTFHEIFGGPVLNKRAMESIVLEFKNVLIKNQSTTTVAFSCGLLGKPSDYLNPYVVRISLPLQ
****************ANFGKETGALVAKTLGKPENYVAVIVVPDVNLVFGGSDAPAAIASLMSIGKLGTAENKKHSAVLFPHIEKTLGIPKDRMYISYIDSSTDVVGYNGTTFHEIFGGPVLNKRAMESIVLEFKNVLIKNQSTTTVAFSCGLLGKPSDYLNPYVVRIS****
MPVFRIETNIPKEKIPANFGKETGALVAKTLGKPENYVAVIVVPDVNLVFGGSDAPAAIASLMSIGKLGTAENKKHSAVLFPHIEKTLGIPKDRMYISYIDSSTDVVGYNGTTFHEIFG********************************CGLLGKPSDYLNPYVVRISLPL*
MPVFRIETNIPKEKIPANFGKETGALVAKTLGKPENYVAVIVVPDVNLVFGGSDAPAAIASLMSIGKLGTAENKKHSAVLFPHIEKTLGIPKDRMYISYIDSSTDVVGYNGTTFHEIFGGPVLNKRAMESIVLEFKNVLIKNQSTTTVAFSCGLLGKPSDYLNPYVVRISLPLQ
MPVFRIETNIPKEKIPANFGKETGALVAKTLGKPENYVAVIVVPDVNLVFGGSDAPAAIASLMSIGKLGTAENKKHSAVLFPHIEKTLGIPKDRMYISYIDSSTDVVGYNGTTFHEIFGGPVLNKRAMESIVLEFKNVLIKNQSTTTVAFSCGLLGKPSDYLNPYVVRISLPLQ
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPVFRIETNIPKEKIPANFGKETGALVAKTLGKPENYVAVIVVPDVNLVFGGSDAPAAIASLMSIGKLGTAENKKHSAVLFPHIEKTLGIPKDRMYISYIDSSTDVVGYNGTTFHEIFGGPVLNKRAMESIVLEFKNVLIKNQSTTTVAFSCGLLGKPSDYLNPYVVRISLPLQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query174 2.2.26 [Sep-21-2011]
P81748114 Macrophage migration inhi N/A N/A 0.655 1.0 0.491 2e-27
P81529114 Macrophage migration inhi N/A N/A 0.655 1.0 0.508 3e-27
P80928115 Macrophage migration inhi yes N/A 0.655 0.991 0.438 3e-23
Q02960115 Macrophage migration inhi yes N/A 0.655 0.991 0.447 9e-23
Q1ZZU7115 Macrophage migration inhi N/A N/A 0.655 0.991 0.429 2e-22
P80177115 Macrophage migration inhi yes N/A 0.655 0.991 0.429 2e-22
Q6DN04115 Macrophage migration inhi yes N/A 0.655 0.991 0.438 2e-22
Q4R549115 Macrophage migration inhi N/A N/A 0.655 0.991 0.438 2e-22
P14174115 Macrophage migration inhi yes N/A 0.655 0.991 0.438 2e-22
P34884115 Macrophage migration inhi yes N/A 0.655 0.991 0.429 2e-22
>sp|P81748|MIFH_TRITR Macrophage migration inhibitory factor homolog OS=Trichuris trichiura PE=1 SV=2 Back     alignment and function desciption
 Score =  121 bits (304), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 75/114 (65%)

Query: 1   MPVFRIETNIPKEKIPANFGKETGALVAKTLGKPENYVAVIVVPDVNLVFGGSDAPAAIA 60
           MP+F   TN+P E I  +F K T  L+A  LGKPE+YVAV +     + FGG+DAPA   
Sbjct: 1   MPIFTFSTNVPSENISVDFLKSTSKLIAGMLGKPESYVAVHINGGQKITFGGTDAPAGFG 60

Query: 61  SLMSIGKLGTAENKKHSAVLFPHIEKTLGIPKDRMYISYIDSSTDVVGYNGTTF 114
            L+S+G +G  +N+ HSA LF H+   LGIP +RMYI+++D     VGYNG+TF
Sbjct: 61  QLLSLGGVGGEKNRSHSAKLFKHLTDGLGIPGNRMYINFVDMRGSDVGYNGSTF 114
Tautomerization of the methyl ester of L-dopachrome. Inhibits migration of human peripheral blood mononuclear cells.
Trichuris trichiura (taxid: 36087)
EC: 5EC: .EC: 3EC: .EC: 3EC: .EC: 1EC: 2
>sp|P81529|MIFH_TRISP Macrophage migration inhibitory factor homolog OS=Trichinella spiralis PE=1 SV=2 Back     alignment and function description
>sp|P80928|MIF_PIG Macrophage migration inhibitory factor OS=Sus scrofa GN=MIF PE=1 SV=3 Back     alignment and function description
>sp|Q02960|MIF_CHICK Macrophage migration inhibitory factor OS=Gallus gallus GN=MIF PE=2 SV=3 Back     alignment and function description
>sp|Q1ZZU7|MIF_SHEEP Macrophage migration inhibitory factor OS=Ovis aries GN=MIF PE=3 SV=1 Back     alignment and function description
>sp|P80177|MIF_BOVIN Macrophage migration inhibitory factor OS=Bos taurus GN=MIF PE=1 SV=6 Back     alignment and function description
>sp|Q6DN04|MIF_MACMU Macrophage migration inhibitory factor OS=Macaca mulatta GN=MIF PE=3 SV=4 Back     alignment and function description
>sp|Q4R549|MIF_MACFA Macrophage migration inhibitory factor OS=Macaca fascicularis GN=MIF PE=3 SV=3 Back     alignment and function description
>sp|P14174|MIF_HUMAN Macrophage migration inhibitory factor OS=Homo sapiens GN=MIF PE=1 SV=4 Back     alignment and function description
>sp|P34884|MIF_MOUSE Macrophage migration inhibitory factor OS=Mus musculus GN=Mif PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query174
389609061119 unknown unsecreted protein [Papilio xuth 0.683 1.0 0.571 3e-33
121543931121 macrophage migration inhibitory factor-l 0.683 0.983 0.554 1e-32
332374852119 unknown [Dendroctonus ponderosae] 0.683 1.0 0.563 1e-32
357623781119 macrophage migration inhibitory factor [ 0.683 1.0 0.571 2e-32
114051978119 macrophage migration inhibitory factor [ 0.683 1.0 0.579 2e-32
242247023119 macrophage migration inhibitory factor-l 0.683 1.0 0.546 9e-31
321474777119 hypothetical protein DAPPUDRAFT_308977 [ 0.683 1.0 0.546 5e-30
91084415119 PREDICTED: similar to macrophage migrati 0.683 1.0 0.504 2e-29
442752913115 Putative macrophage migration inhibitory 0.655 0.991 0.578 3e-29
49257069115 macrophage migration inhibitory factor [ 0.655 0.991 0.526 4e-29
>gi|389609061|dbj|BAM18142.1| unknown unsecreted protein [Papilio xuthus] Back     alignment and taxonomy information
 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 68/119 (57%), Positives = 87/119 (73%)

Query: 1   MPVFRIETNIPKEKIPANFGKETGALVAKTLGKPENYVAVIVVPDVNLVFGGSDAPAAIA 60
           MP FRIETN+PK KIP +F  +   ++A+ LGKPE Y  V ++PDV + FGGS  P AIA
Sbjct: 1   MPHFRIETNVPKGKIPQDFLTKAVPVLARALGKPEQYCVVSIIPDVPMSFGGSTDPCAIA 60

Query: 61  SLMSIGKLGTAENKKHSAVLFPHIEKTLGIPKDRMYISYIDSSTDVVGYNGTTFHEIFG 119
           +LMSIG LG  +NKKH+ VLF  +EK LG+P+DRMYI++ D  T  VG+ GTTFH +FG
Sbjct: 61  NLMSIGSLGVEQNKKHAKVLFELVEKELGVPQDRMYITFQDEPTGNVGFKGTTFHSLFG 119

Source: Papilio xuthus

Species: Papilio xuthus

Genus: Papilio

Family: Papilionidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|121543931|gb|ABM55630.1| macrophage migration inhibitory factor-like protein [Maconellicoccus hirsutus] Back     alignment and taxonomy information
>gi|332374852|gb|AEE62567.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|357623781|gb|EHJ74805.1| macrophage migration inhibitory factor [Danaus plexippus] Back     alignment and taxonomy information
>gi|114051978|ref|NP_001040199.1| macrophage migration inhibitory factor [Bombyx mori] gi|87248353|gb|ABD36229.1| macrophage migration inhibitory factor [Bombyx mori] Back     alignment and taxonomy information
>gi|242247023|ref|NP_001156107.1| macrophage migration inhibitory factor-like [Acyrthosiphon pisum] gi|239789832|dbj|BAH71515.1| ACYPI002465 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|321474777|gb|EFX85741.1| hypothetical protein DAPPUDRAFT_308977 [Daphnia pulex] Back     alignment and taxonomy information
>gi|91084415|ref|XP_967749.1| PREDICTED: similar to macrophage migration inhibitory factor [Tribolium castaneum] gi|270008846|gb|EFA05294.1| hypothetical protein TcasGA2_TC015451 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|442752913|gb|JAA68616.1| Putative macrophage migration inhibitory factor [Ixodes ricinus] Back     alignment and taxonomy information
>gi|49257069|dbj|BAD24819.1| macrophage migration inhibitory factor [Ascaris suum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query174
ZFIN|ZDB-GENE-080708-1115 mif "macrophage migration inhi 0.655 0.991 0.429 1.6e-22
UNIPROTKB|P80928115 MIF "Macrophage migration inhi 0.655 0.991 0.438 3.4e-22
UNIPROTKB|P14174115 MIF "Macrophage migration inhi 0.655 0.991 0.438 1.1e-21
UNIPROTKB|Q4R549115 MIF "Macrophage migration inhi 0.655 0.991 0.438 1.1e-21
UNIPROTKB|Q6DN04115 MIF "Macrophage migration inhi 0.655 0.991 0.438 1.1e-21
UNIPROTKB|Q02960115 MIF "Macrophage migration inhi 0.655 0.991 0.447 1.9e-21
MGI|MGI:96982115 Mif "macrophage migration inhi 0.655 0.991 0.429 2.4e-21
UNIPROTKB|P80177115 MIF "Macrophage migration inhi 0.655 0.991 0.429 3e-21
UNIPROTKB|Q1ZZU7115 MIF "Macrophage migration inhi 0.655 0.991 0.429 3e-21
RGD|621163115 Mif "macrophage migration inhi 0.655 0.991 0.429 3e-21
ZFIN|ZDB-GENE-080708-1 mif "macrophage migration inhibitory factor" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 261 (96.9 bits), Expect = 1.6e-22, P = 1.6e-22
 Identities = 49/114 (42%), Positives = 74/114 (64%)

Query:     1 MPVFRIETNIPKEKIPANFGKETGALVAKTLGKPENYVAVIVVPDVNLVFGGSDAPAAIA 60
             MP+F + TN+ K+ +PA    E    +AK +GKP+ Y+AV VVPD  ++FGG   P A+ 
Sbjct:     1 MPMFVVNTNVAKDSVPAELLSEATQELAKAMGKPQQYIAVQVVPDQMMMFGGKGDPCALC 60

Query:    61 SLMSIGKLGTAENKKHSAVLFPHIEKTLGIPKDRMYISYIDSSTDVVGYNGTTF 114
             SL SIGK+  A+NK++S +L   + K LG+  DR+YI+++D     V +N +TF
Sbjct:    61 SLTSIGKISGAQNKQYSKLLMGLLNKHLGVSADRIYINFVDMDPANVAWNNSTF 114
GO:0048839 "inner ear development" evidence=IGI
GO:0043066 "negative regulation of apoptotic process" evidence=IGI
GO:0048598 "embryonic morphogenesis" evidence=IMP
GO:0008283 "cell proliferation" evidence=IMP
UNIPROTKB|P80928 MIF "Macrophage migration inhibitory factor" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P14174 MIF "Macrophage migration inhibitory factor" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q4R549 MIF "Macrophage migration inhibitory factor" [Macaca fascicularis (taxid:9541)] Back     alignment and assigned GO terms
UNIPROTKB|Q6DN04 MIF "Macrophage migration inhibitory factor" [Macaca mulatta (taxid:9544)] Back     alignment and assigned GO terms
UNIPROTKB|Q02960 MIF "Macrophage migration inhibitory factor" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:96982 Mif "macrophage migration inhibitory factor" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P80177 MIF "Macrophage migration inhibitory factor" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q1ZZU7 MIF "Macrophage migration inhibitory factor" [Ovis aries (taxid:9940)] Back     alignment and assigned GO terms
RGD|621163 Mif "macrophage migration inhibitory factor (glycosylation-inhibiting factor)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6DN04MIF_MACMU5, ., 3, ., 3, ., 1, 20.43850.65510.9913yesN/A
P14174MIF_HUMAN5, ., 3, ., 3, ., 1, 20.43850.65510.9913yesN/A
P80928MIF_PIG5, ., 3, ., 3, ., 1, 20.43850.65510.9913yesN/A
Q02960MIF_CHICK5, ., 3, ., 3, ., 1, 20.44730.65510.9913yesN/A
P34884MIF_MOUSE5, ., 3, ., 3, ., 1, 20.42980.65510.9913yesN/A
A9JSE7MIF_XENTR5, ., 3, ., 3, ., 1, 20.39470.65510.9913yesN/A
P30904MIF_RAT5, ., 3, ., 3, ., 1, 20.42980.65510.9913yesN/A
Q18785MIF2_CAEELNo assigned EC number0.36200.66660.9666yesN/A
P80177MIF_BOVIN5, ., 3, ., 3, ., 1, 20.42980.65510.9913yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.3.3.120.824
3rd Layer5.3.30.766
3rd Layer5.3.2.10.824
3rd Layer5.3.20.766
3rd Layer4.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
pfam01187114 pfam01187, MIF, Macrophage migration inhibitory fa 3e-38
PTZ00397116 PTZ00397, PTZ00397, macrophage migration inhibitio 6e-14
PTZ00450113 PTZ00450, PTZ00450, macrophage migration inhibitor 2e-12
>gnl|CDD|201647 pfam01187, MIF, Macrophage migration inhibitory factor (MIF) Back     alignment and domain information 
 Score =  126 bits (318), Expect = 3e-38
 Identities = 53/113 (46%), Positives = 73/113 (64%)

Query: 2   PVFRIETNIPKEKIPANFGKETGALVAKTLGKPENYVAVIVVPDVNLVFGGSDAPAAIAS 61
           P+F ++TN+P   +P    K     +AK LGKPE  +AV +VP   +VFGGS  P A+ S
Sbjct: 1   PMFEVDTNLPANSVPDGLEKRLTQQLAKALGKPEQRIAVHIVPGQAMVFGGSTEPCAVCS 60

Query: 62  LMSIGKLGTAENKKHSAVLFPHIEKTLGIPKDRMYISYIDSSTDVVGYNGTTF 114
           L SIGK+G  +N+ HSA+L   + K L +PKDR+YI++ D     VG+NGTTF
Sbjct: 61  LKSIGKVGAEQNRSHSALLCKFLTKELSLPKDRIYINFFDLEAANVGFNGTTF 113

Length = 114
>gnl|CDD|240401 PTZ00397, PTZ00397, macrophage migration inhibition factor-like protein; Provisional Back     alignment and domain information
>gnl|CDD|185629 PTZ00450, PTZ00450, macrophage migration inhibitory factor-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 174
PF01187114 MIF: Macrophage migration inhibitory factor (MIF); 100.0
PTZ00450113 macrophage migration inhibitory factor-like protei 100.0
PTZ00397116 macrophage migration inhibition factor-like protei 100.0
KOG1759|consensus115 100.0
PF0136160 Tautomerase: Tautomerase enzyme; InterPro: IPR0043 99.25
PRK0196464 4-oxalocrotonate tautomerase; Provisional 99.25
TIGR0001363 taut 4-oxalocrotonate tautomerase family enzyme. 4 99.23
cd0049158 4Oxalocrotonate_Tautomerase 4-Oxalocrotonate Tauto 99.22
PRK0222061 4-oxalocrotonate tautomerase; Provisional 99.21
PRK0074562 4-oxalocrotonate tautomerase; Provisional 99.18
PF1455282 Tautomerase_2: Tautomerase enzyme; PDB: 2AAG_C 2AA 99.05
PRK0228960 4-oxalocrotonate tautomerase; Provisional 98.94
COG194269 Uncharacterized protein, 4-oxalocrotonate tautomer 98.91
cd00580113 CHMI 5-carboxymethyl-2-hydroxymuconate isomerase ( 98.61
PRK0127176 4-oxalocrotonate tautomerase; Provisional 98.57
PF08921108 DUF1904: Domain of unknown function (DUF1904); Int 98.47
PF14832136 Tautomerase_3: Putative oxalocrotonate tautomerase 98.46
PRK0196464 4-oxalocrotonate tautomerase; Provisional 98.39
PRK0074562 4-oxalocrotonate tautomerase; Provisional 98.36
PRK0222061 4-oxalocrotonate tautomerase; Provisional 98.26
PRK0228960 4-oxalocrotonate tautomerase; Provisional 98.25
COG194269 Uncharacterized protein, 4-oxalocrotonate tautomer 98.2
PRK15031126 5-carboxymethyl-2-hydroxymuconate delta-isomerase; 98.07
PF0136160 Tautomerase: Tautomerase enzyme; InterPro: IPR0043 97.93
TIGR0001363 taut 4-oxalocrotonate tautomerase family enzyme. 4 97.93
PRK0127176 4-oxalocrotonate tautomerase; Provisional 97.92
cd0049158 4Oxalocrotonate_Tautomerase 4-Oxalocrotonate Tauto 97.89
PF02962124 CHMI: 5-carboxymethyl-2-hydroxymuconate isomerase; 97.55
COG3232127 HpaF 5-carboxymethyl-2-hydroxymuconate isomerase [ 96.55
PTZ00397116 macrophage migration inhibition factor-like protei 96.48
PF1455282 Tautomerase_2: Tautomerase enzyme; PDB: 2AAG_C 2AA 95.48
PF14832136 Tautomerase_3: Putative oxalocrotonate tautomerase 95.44
PTZ00450113 macrophage migration inhibitory factor-like protei 87.6
PF01187114 MIF: Macrophage migration inhibitory factor (MIF); 84.38
TIGR02544193 III_secr_YscJ type III secretion apparatus lipopro 80.09
>PF01187 MIF: Macrophage migration inhibitory factor (MIF); InterPro: IPR001398 Macrophage migration inhibitory factor (MIF) is a key regulatory cytokine within innate and adaptive immune responses, capable of promoting and modulating the magnitude of the response [] Back     alignment and domain information 
Probab=100.00  E-value=1.4e-39  Score=242.34  Aligned_cols=114  Identities=48%  Similarity=0.762  Sum_probs=106.2

Q ss_pred             CeEEEEeCCCCCCchhhHHHHHHHHHHHHhCCCcceEEEEEeCCeeEEecCCCCceeEEEEEEeecCChHHHHHHHHHHH
Q psy2936           2 PVFRIETNIPKEKIPANFGKETGALVAKTLGKPENYVAVIVVPDVNLVFGGSDAPAAIASLMSIGKLGTAENKKHSAVLF   81 (174)
Q Consensus         2 P~i~i~TNv~~~~~~~~f~~~ls~~vaevlgKPe~~ImV~i~~~~~m~fgGs~~P~a~veI~sig~~~~e~n~~~s~aI~   81 (174)
                      |+|+|+||++.++++++|++++++++|+++||||+||||+++++++|+|||+++||||++|+++|++++++|++++++|+
T Consensus         1 P~~~i~TNv~~~~~~~~f~~~ls~~va~~lgKpe~~i~V~v~~~~~m~fgGs~~P~a~v~l~sig~~~~~~n~~~s~~i~   80 (114)
T PF01187_consen    1 PCLEIKTNVSASKVPDDFLKELSKLVAELLGKPESYIMVTVEDGQRMSFGGSDDPAAFVELKSIGGLDPEQNKKYSAAIT   80 (114)
T ss_dssp             -EEEEEESS-GGGSHTTHHHHHHHHHHHHHTSTGGGEEEEEEESTEEEETTB-SS-EEEEEEESSSSSHHHHHHHHHHHH
T ss_pred             CEEEEEcCCCchhchHHHHHHHHHHHHHHhCcchhhEEEEeeCCceEEECCCCCCEEEEEEEEccCCCHHHHHHHHHHHH
Confidence            99999999997778999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhhCCCCCcEEEEEEeCCCCCeeecCceec
Q psy2936          82 PHIEKTLGIPKDRMYISYIDSSTDVVGYNGTTFH  115 (174)
Q Consensus        82 ~~l~e~LGIp~dRiyI~f~d~~~~nwG~~G~T~~  115 (174)
                      ++++++||||++|+||.|+|+++++|||||+||+
T Consensus        81 ~~l~~~LgIp~~Riyi~f~d~~~~~~g~nG~tf~  114 (114)
T PF01187_consen   81 EFLEEELGIPPDRIYINFHDLPAWNVGWNGTTFA  114 (114)
T ss_dssp             HHHHHHHT--GGGEEEEEEEETGGGEEETTEESC
T ss_pred             HHHHHHhCCCcCceEEEEEECCHHHeeeCcEEcC
Confidence            9999999999999999999999999999999985

MIF is released from T-cells and macrophages, and acts within the neuroendocrine system. MIF is capable of tautomerase activity, although its biological function has not been fully characterised. It is induced by glucocorticoid and is capable of overriding the anti-inflammatory actions of glucocorticoid []. MIF regulates cytokine secretion and the expression of receptors involved in the immune response. It can be taken up into target cells in order to interact with intracellular signalling molecules, inhibiting p53 function, and/or activating components of the mitogen-activated protein kinase and Jun-activation domain-binding protein-1 (Jab-1) []. MIF has been linked to various inflammatory diseases, such as rheumatoid arthritis and atherosclerosis []. The MIF homologue D-dopachrome tautomerase (4.1.1.84 from EC) is involved in detoxification through the conversion of dopaminechrome (and possibly norepinephrinechrome), the toxic quinine product of the neurotransmitter dopamine (and norepinephrine), to an indole derivative that can serve as a precursor to neuromelanin [, ].; PDB: 1UIZ_C 3FWT_A 1HFO_F 2WKB_D 3RF4_B 2OS5_A 3RF5_A 2XCZ_A 3FWU_A 3B64_A ....
>PTZ00450 macrophage migration inhibitory factor-like protein; Provisional Back     alignment and domain information
>PTZ00397 macrophage migration inhibition factor-like protein; Provisional Back     alignment and domain information
>KOG1759|consensus Back     alignment and domain information
>PF01361 Tautomerase: Tautomerase enzyme; InterPro: IPR004370 4-Oxalocrotonate tautomerase (4-OT) catalyzes the isomerisation of beta,gamma-unsaturated enones to their alpha,beta-isomers Back     alignment and domain information
>PRK01964 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>TIGR00013 taut 4-oxalocrotonate tautomerase family enzyme Back     alignment and domain information
>cd00491 4Oxalocrotonate_Tautomerase 4-Oxalocrotonate Tautomerase: Catalyzes the isomerization of unsaturated ketones Back     alignment and domain information
>PRK02220 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>PRK00745 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>PF14552 Tautomerase_2: Tautomerase enzyme; PDB: 2AAG_C 2AAL_A 2AAJ_A 1MWW_C Back     alignment and domain information
>PRK02289 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>COG1942 Uncharacterized protein, 4-oxalocrotonate tautomerase homolog [General function prediction only] Back     alignment and domain information
>cd00580 CHMI 5-carboxymethyl-2-hydroxymuconate isomerase (CHMI) is a trimeric enzyme catalyzing the isomerization of the unsaturated ketone 5-(carboxymethyl)-2-hydroxymuconate to 5-(carboxymethyl)-2-oxo-3-hexene-1,6-dionate Back     alignment and domain information
>PRK01271 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>PF08921 DUF1904: Domain of unknown function (DUF1904); InterPro: IPR015017 This entry represents a family of hypothetical bacterial proteins Back     alignment and domain information
>PF14832 Tautomerase_3: Putative oxalocrotonate tautomerase enzyme; PDB: 3C6V_C 3N4D_I 3N4G_C 3N4H_A 2FLZ_C 3MF8_A 3MF7_A 2FLT_A Back     alignment and domain information
>PRK01964 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>PRK00745 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>PRK02220 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>PRK02289 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>COG1942 Uncharacterized protein, 4-oxalocrotonate tautomerase homolog [General function prediction only] Back     alignment and domain information
>PRK15031 5-carboxymethyl-2-hydroxymuconate delta-isomerase; Provisional Back     alignment and domain information
>PF01361 Tautomerase: Tautomerase enzyme; InterPro: IPR004370 4-Oxalocrotonate tautomerase (4-OT) catalyzes the isomerisation of beta,gamma-unsaturated enones to their alpha,beta-isomers Back     alignment and domain information
>TIGR00013 taut 4-oxalocrotonate tautomerase family enzyme Back     alignment and domain information
>PRK01271 4-oxalocrotonate tautomerase; Provisional Back     alignment and domain information
>cd00491 4Oxalocrotonate_Tautomerase 4-Oxalocrotonate Tautomerase: Catalyzes the isomerization of unsaturated ketones Back     alignment and domain information
>PF02962 CHMI: 5-carboxymethyl-2-hydroxymuconate isomerase; InterPro: IPR004220 5-carboxymethyl-2-hydroxymuconate isomerase transforms 5-carboxymethyl-2-hydroxy-muconic acid into 5-oxo-pent-3-ene-1,2,5-tricarboxylic acid during the third step of the homoprotocatechuate catabolic pathway [] Back     alignment and domain information
>COG3232 HpaF 5-carboxymethyl-2-hydroxymuconate isomerase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00397 macrophage migration inhibition factor-like protein; Provisional Back     alignment and domain information
>PF14552 Tautomerase_2: Tautomerase enzyme; PDB: 2AAG_C 2AAL_A 2AAJ_A 1MWW_C Back     alignment and domain information
>PF14832 Tautomerase_3: Putative oxalocrotonate tautomerase enzyme; PDB: 3C6V_C 3N4D_I 3N4G_C 3N4H_A 2FLZ_C 3MF8_A 3MF7_A 2FLT_A Back     alignment and domain information
>PTZ00450 macrophage migration inhibitory factor-like protein; Provisional Back     alignment and domain information
>PF01187 MIF: Macrophage migration inhibitory factor (MIF); InterPro: IPR001398 Macrophage migration inhibitory factor (MIF) is a key regulatory cytokine within innate and adaptive immune responses, capable of promoting and modulating the magnitude of the response [] Back     alignment and domain information
>TIGR02544 III_secr_YscJ type III secretion apparatus lipoprotein, YscJ/HrcJ family Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
1hfo_A113 The Structure Of The Macrophage Migration Inhibitor 7e-27
1mif_A115 Macrophage Migration Inhibitory Factor (Mif) Length 1e-23
3hof_A123 Structure Of Macrophage Migration Inhibitory Factor 2e-23
1gif_A115 Human Glycosylation-Inhibiting Factor Length = 115 2e-23
4etg_A114 Crystal Structure Of Mif L46g Mutant Length = 114 5e-23
4evg_A114 Crystal Structure Of Mif L46a Mutant Length = 114 6e-23
1gcz_A122 Macrophage Migration Inhibitory Factor (Mif) Comple 9e-23
4eui_A114 Crystal Structure Of Mif L46f Mutant Length = 114 9e-23
1ca7_A114 Macrophage Migration Inhibitory Factor (Mif) With H 1e-22
1mfi_A114 Crystal Structure Of Macrophage Migration Inhibitor 1e-22
1uiz_A115 Crystal Structure Of Macrophage Migration Inhibitor 1e-22
1fim_A114 Macrophage Migration Inhibitory Factor Length = 114 3e-22
1mff_A114 Macrophage Migration Inhibitory Factor Y95f Mutant 3e-22
1p1g_A114 Macrophage Migration Inhibitory Factor (Mif) With P 7e-22
1cgq_A115 Macrophage Migration Inhibitory Factor (Mif) With A 7e-22
2os5_A119 Macrophage Migration Inhibitory Factor From Ancylos 3e-18
3rf4_A116 Ancylostoma Ceylanicum Mif In Complex With Furosemi 2e-17
2xcz_A115 Crystal Structure Of Macrophage Migration Inhibitor 2e-15
1dpt_A117 D-Dopachrome Tautomerase Length = 117 3e-15
3ker_A117 D-Dopachrome Tautomerase (D-Dt) MACROPHAGE MIGRATIO 9e-14
3fwt_A133 Crystal Structure Of Leishmania Major Mif2 Length = 1e-09
4dh4_A114 Macrophage Migration Inhibitory Factor Toxoplasma G 2e-09
3fwu_A133 Crystal Structure Of Leishmania Major Mif1 Length = 1e-06
3b64_A112 Macrophage Migration Inhibitory Factor (Mif) From L 1e-06
3t5s_A135 Structure Of Macrophage Migration Inhibitory Factor 2e-06
2wkf_A125 Crystal Structure Of Macrophage Migration Inhibitor 4e-05
2wkf_B125 Crystal Structure Of Macrophage Migration Inhibitor 4e-05
3gac_A117 Structure Of Mif With Hpp Length = 117 5e-05
>pdb|1HFO|A Chain A, The Structure Of The Macrophage Migration Inhibitory Factor From Trichinella Spiralis. Length = 113 Back     alignment and structure 
Iteration: 1

 Score =  116 bits (290), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 56/113 (49%), Positives = 74/113 (65%)
Query: 2   PVFRIETNIPKEKIPANFGKETGALVAKTLGKPENYVAVIVVPDVNLVFGGSDAPAAIAS 61
           P+F + TNI    +P++F   T ALV   L KP +YVAV +  D  L FGGS  PAA  +
Sbjct: 1   PIFTLNTNIKATDVPSDFLSSTSALVGNILSKPGSYVAVHINTDQQLSFGGSTNPAAFGT 60
Query: 62  LMSIGKLGTAENKKHSAVLFPHIEKTLGIPKDRMYISYIDSSTDVVGYNGTTF 114
           LMSIG +  + N+ HSA LF H+   LGIPK+RMYI +++ + D VG+NGTTF
Sbjct: 61  LMSIGGIEPSRNRDHSAKLFDHLNTKLGIPKNRMYIHFVNLNGDDVGWNGTTF 113
>pdb|1MIF|A Chain A, Macrophage Migration Inhibitory Factor (Mif) Length = 115 Back     alignment and structure
>pdb|3HOF|A Chain A, Structure Of Macrophage Migration Inhibitory Factor (Mif) With Caffeic Acid At 1.9a Resolution Length = 123 Back     alignment and structure
>pdb|1GIF|A Chain A, Human Glycosylation-Inhibiting Factor Length = 115 Back     alignment and structure
>pdb|4ETG|A Chain A, Crystal Structure Of Mif L46g Mutant Length = 114 Back     alignment and structure
>pdb|4EVG|A Chain A, Crystal Structure Of Mif L46a Mutant Length = 114 Back     alignment and structure
>pdb|1GCZ|A Chain A, Macrophage Migration Inhibitory Factor (Mif) Complexed With Inhibitor. Length = 122 Back     alignment and structure
>pdb|4EUI|A Chain A, Crystal Structure Of Mif L46f Mutant Length = 114 Back     alignment and structure
>pdb|1CA7|A Chain A, Macrophage Migration Inhibitory Factor (Mif) With Hydroxphenylpyruvate Length = 114 Back     alignment and structure
>pdb|1MFI|A Chain A, Crystal Structure Of Macrophage Migration Inhibitory Factor Complexed With (E)-2-Fluoro-P-Hydroxycinnamate Length = 114 Back     alignment and structure
>pdb|1UIZ|A Chain A, Crystal Structure Of Macrophage Migration Inhibitory Factor From Xenopus Laevis. Length = 115 Back     alignment and structure
>pdb|1FIM|A Chain A, Macrophage Migration Inhibitory Factor Length = 114 Back     alignment and structure
>pdb|1MFF|A Chain A, Macrophage Migration Inhibitory Factor Y95f Mutant Length = 114 Back     alignment and structure
>pdb|1P1G|A Chain A, Macrophage Migration Inhibitory Factor (Mif) With Pro-1 Mutated To Gly-1 Length = 114 Back     alignment and structure
>pdb|1CGQ|A Chain A, Macrophage Migration Inhibitory Factor (Mif) With Alanine Inserted Between Pro-1 And Met-2 Length = 115 Back     alignment and structure
>pdb|2OS5|A Chain A, Macrophage Migration Inhibitory Factor From Ancylostoma Ceylanicum Length = 119 Back     alignment and structure
>pdb|3RF4|A Chain A, Ancylostoma Ceylanicum Mif In Complex With Furosemide Length = 116 Back     alignment and structure
>pdb|2XCZ|A Chain A, Crystal Structure Of Macrophage Migration Inhibitory Factor Homologue From Prochlorococcus Marinus Length = 115 Back     alignment and structure
>pdb|1DPT|A Chain A, D-Dopachrome Tautomerase Length = 117 Back     alignment and structure
>pdb|3KER|A Chain A, D-Dopachrome Tautomerase (D-Dt) MACROPHAGE MIGRATION INHIBITORY Factor 2 (Mif2) Complexed With Inhibitor 4-Ipp Length = 117 Back     alignment and structure
>pdb|3FWT|A Chain A, Crystal Structure Of Leishmania Major Mif2 Length = 133 Back     alignment and structure
>pdb|4DH4|A Chain A, Macrophage Migration Inhibitory Factor Toxoplasma Gondii Length = 114 Back     alignment and structure
>pdb|3FWU|A Chain A, Crystal Structure Of Leishmania Major Mif1 Length = 133 Back     alignment and structure
>pdb|3B64|A Chain A, Macrophage Migration Inhibitory Factor (Mif) From LEISHMANIA MAJOR Length = 112 Back     alignment and structure
>pdb|3T5S|A Chain A, Structure Of Macrophage Migration Inhibitory Factor From Giardia Lamblia Length = 135 Back     alignment and structure
>pdb|2WKF|A Chain A, Crystal Structure Of Macrophage Migration Inhibitory Factor From Plasmodium Falciparum Length = 125 Back     alignment and structure
>pdb|2WKF|B Chain B, Crystal Structure Of Macrophage Migration Inhibitory Factor From Plasmodium Falciparum Length = 125 Back     alignment and structure
>pdb|3GAC|A Chain A, Structure Of Mif With Hpp Length = 117 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query174
2os5_A119 Acemif; macrophage migration inhibitory factor, cy 7e-44
1uiz_A115 MIF, macrophage migration inhibitory factor; cytok 5e-42
3kan_A117 D-dopachrome tautomerase; immune response, cytokin 2e-41
2xcz_A115 Possible ATLS1-like light-inducible protein; cytok 2e-41
3djh_A114 Macrophage migration inhibitory factor; homotrimer 4e-41
1hfo_A113 Migration inhibitory factor; tautomerase; 1.65A {T 3e-40
2wkb_A125 Macrophage migration inhibitory factor; cytokine; 3e-40
3fwu_A133 Macrophage migration inhibitory factor-like protei 3e-40
3b64_A112 Macrophage migration inhibitory factor-like protei 5e-40
3fwt_A133 Macrophage migration inhibitory factor-like protei 8e-40
3t5s_A135 Gilaa.00834.A, macrophage migration inhibitory fac 5e-39
>2os5_A Acemif; macrophage migration inhibitory factor, cytokine, nematode,; 1.60A {Ancylostoma ceylanicum} PDB: 3rf4_A* 3rf5_A* Length = 119 Back     alignment and structure
 Score =  140 bits (354), Expect = 7e-44
 Identities = 41/117 (35%), Positives = 67/117 (57%)

Query: 1   MPVFRIETNIPKEKIPANFGKETGALVAKTLGKPENYVAVIVVPDVNLVFGGSDAPAAIA 60
           MP+ R+ TN+P + +PANF +    L+A+++ KP N +A+ V+    +  G S  P A+ 
Sbjct: 1   MPMVRVATNLPDKDVPANFEERLTDLLAESMNKPRNRIAIEVLAGQRITHGASRNPVAVI 60

Query: 61  SLMSIGKLGTAENKKHSAVLFPHIEKTLGIPKDRMYISYIDSSTDVVGYNGTTFHEI 117
            + SIG L   +N +H+  +    + TL +PKD++ I+Y D     VG+NGTT    
Sbjct: 61  KVESIGALSADDNIRHTQKITQFCQDTLKLPKDKVIITYFDLQPIHVGFNGTTVAAA 117
>1uiz_A MIF, macrophage migration inhibitory factor; cytokine, tautomerase; 2.50A {Xenopus laevis} SCOP: d.80.1.3 Length = 115 Back     alignment and structure
>3kan_A D-dopachrome tautomerase; immune response, cytokine, cytokine-inhibitor C; HET: RW1; 1.13A {Homo sapiens} PDB: 1dpt_A* 3ker_A* Length = 117 Back     alignment and structure
>2xcz_A Possible ATLS1-like light-inducible protein; cytokine, tautomerase, immune system, cyanobacterium; 1.64A {Prochlorococcus marinus} Length = 115 Back     alignment and structure
>3djh_A Macrophage migration inhibitory factor; homotrimer, cytokine, inflammatory response, isomerase, phosphoprotein; 1.25A {Homo sapiens} PDB: 1ca7_A* 1ljt_A* 2ooh_A* 2ooz_A* 3b9s_A* 2oow_A* 3ce4_A 3dji_A* 3ijg_A* 3ijj_A* 1gd0_A* 1gcz_A* 3jsf_A* 3jsg_A* 3jtu_A* 3l5p_A* 3l5r_A* 3l5s_A* 3l5t_A* 3l5u_A* ... Length = 114 Back     alignment and structure
>1hfo_A Migration inhibitory factor; tautomerase; 1.65A {Trichinella spiralis} SCOP: d.80.1.3 Length = 113 Back     alignment and structure
>2wkb_A Macrophage migration inhibitory factor; cytokine; HET: CME; 1.78A {Plasmodium berghei} PDB: 3gad_A 3gac_A 2wkf_A* Length = 125 Back     alignment and structure
>3fwu_A Macrophage migration inhibitory factor-like protein; homotrimer, tautomerase, cytokine; 1.80A {Leishmania major} Length = 133 Back     alignment and structure
>3b64_A Macrophage migration inhibitory factor-like protein; cytokine, MIF, LM1740MIF, lmmif, unknown function; 1.03A {Leishmania major} Length = 112 Back     alignment and structure
>3fwt_A Macrophage migration inhibitory factor-like protein; homotrimer, tautomerase, cytokine; 1.90A {Leishmania major} Length = 133 Back     alignment and structure
>3t5s_A Gilaa.00834.A, macrophage migration inhibitory factor; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Giardia lamblia} Length = 135 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query174
3djh_A114 Macrophage migration inhibitory factor; homotrimer 100.0
3kan_A117 D-dopachrome tautomerase; immune response, cytokin 100.0
4dh4_A114 MIF; trimer, isomerase; 1.82A {Toxoplasma gondii} 100.0
3t5s_A135 Gilaa.00834.A, macrophage migration inhibitory fac 100.0
3fwu_A133 Macrophage migration inhibitory factor-like protei 100.0
3fwt_A133 Macrophage migration inhibitory factor-like protei 100.0
1uiz_A115 MIF, macrophage migration inhibitory factor; cytok 100.0
2xcz_A115 Possible ATLS1-like light-inducible protein; cytok 100.0
2os5_A119 Acemif; macrophage migration inhibitory factor, cy 100.0
1hfo_A113 Migration inhibitory factor; tautomerase; 1.65A {T 100.0
2wkb_A125 Macrophage migration inhibitory factor; cytokine; 100.0
3b64_A112 Macrophage migration inhibitory factor-like protei 99.98
2aal_A131 Malonate semialdehyde decarboxylase; tautomerase s 99.95
1mww_A128 Hypothetical protein HI1388.1; structural genomics 99.92
3n4h_A148 Putative tautomerase; CG10062, CIS-3-chloroacrylic 99.85
3mlc_A136 FG41 malonate semialdehyde decarboxylase; tautomer 99.76
3c6v_A161 Probable tautomerase/dehalogenase AU4130; aspergil 99.65
3mf7_A149 CIS-3-chloroacrylic acid dehalogenase; beta-alpha- 99.57
2opa_A61 Probable tautomerase YWHB; homohexamer, 4-oxalocro 99.55
1otf_A62 4-oxalocrotonate tautomerase; isomerase; 1.90A {Ps 99.54
3abf_A64 4-oxalocrotonate tautomerase; isomerase; 1.94A {Th 99.48
1u9d_A122 Hypothetical protein VC0714; structural genomics, 99.43
2x4k_A63 4-oxalocrotonate tautomerase; isomerase; 1.10A {St 99.43
3m21_A67 Probable tautomerase HP_0924; 4-oxalocrotonate tau 99.43
3m20_A62 4-oxalocrotonate tautomerase, putative; DMPI, ther 99.39
3mb2_A72 4-oxalocrotonate tautomerase family enzyme - ALPH; 99.39
3ry0_A65 Putative tautomerase; oxalocrotonate tautomerase f 99.37
3ej9_A76 Alpha-subunit of trans-3-chloroacrylic acid dehal; 99.33
1gyx_A76 YDCE, B1461, hypothetical protein YDCE; tautomeras 98.99
3abf_A64 4-oxalocrotonate tautomerase; isomerase; 1.94A {Th 98.97
3e6q_A146 Putative 5-carboxymethyl-2-hydroxymuconate isomer; 98.97
3ej9_B70 Beta-subunit of trans-3-chloroacrylic acid dehalo; 98.88
1otg_A125 5-carboxymethyl-2-hydroxymuconate isomerase; 2.10A 98.86
2x4k_A63 4-oxalocrotonate tautomerase; isomerase; 1.10A {St 98.72
3mb2_A72 4-oxalocrotonate tautomerase family enzyme - ALPH; 98.59
3ej9_A76 Alpha-subunit of trans-3-chloroacrylic acid dehal; 98.29
3n4h_A148 Putative tautomerase; CG10062, CIS-3-chloroacrylic 98.26
2aal_A131 Malonate semialdehyde decarboxylase; tautomerase s 98.19
3mlc_A136 FG41 malonate semialdehyde decarboxylase; tautomer 98.16
3m20_A62 4-oxalocrotonate tautomerase, putative; DMPI, ther 98.14
3c6v_A161 Probable tautomerase/dehalogenase AU4130; aspergil 98.13
3mb2_B72 4-oxalocrotonate tautomerase family enzyme - beta; 98.04
3mf7_A149 CIS-3-chloroacrylic acid dehalogenase; beta-alpha- 97.99
3m21_A67 Probable tautomerase HP_0924; 4-oxalocrotonate tau 97.94
1mww_A128 Hypothetical protein HI1388.1; structural genomics 97.88
3ry0_A65 Putative tautomerase; oxalocrotonate tautomerase f 97.82
2opa_A61 Probable tautomerase YWHB; homohexamer, 4-oxalocro 97.82
1otf_A62 4-oxalocrotonate tautomerase; isomerase; 1.90A {Ps 97.75
2wkb_A125 Macrophage migration inhibitory factor; cytokine; 97.35
2xcz_A115 Possible ATLS1-like light-inducible protein; cytok 97.23
3b64_A112 Macrophage migration inhibitory factor-like protei 97.22
1hfo_A113 Migration inhibitory factor; tautomerase; 1.65A {T 97.1
3ej9_B70 Beta-subunit of trans-3-chloroacrylic acid dehalo; 97.03
1uiz_A115 MIF, macrophage migration inhibitory factor; cytok 96.95
2os5_A119 Acemif; macrophage migration inhibitory factor, cy 96.74
1gyx_A76 YDCE, B1461, hypothetical protein YDCE; tautomeras 96.55
1u9d_A122 Hypothetical protein VC0714; structural genomics, 96.29
3t5s_A135 Gilaa.00834.A, macrophage migration inhibitory fac 95.9
3fwu_A133 Macrophage migration inhibitory factor-like protei 95.83
3fwt_A133 Macrophage migration inhibitory factor-like protei 95.66
4dh4_A114 MIF; trimer, isomerase; 1.82A {Toxoplasma gondii} 95.29
3djh_A114 Macrophage migration inhibitory factor; homotrimer 94.54
3mb2_B72 4-oxalocrotonate tautomerase family enzyme - beta; 94.53
1otg_A125 5-carboxymethyl-2-hydroxymuconate isomerase; 2.10A 87.85
3kan_A117 D-dopachrome tautomerase; immune response, cytokin 87.76
>3djh_A Macrophage migration inhibitory factor; homotrimer, cytokine, inflammatory response, isomerase, phosphoprotein; 1.25A {Homo sapiens} SCOP: d.80.1.3 PDB: 1ca7_A* 1ljt_A* 2ooh_A* 2ooz_A* 3b9s_A* 2oow_A* 3ce4_A 3dji_A* 3ijg_A* 3ijj_A* 3smb_A* 3smc_A* 3u18_A* 4f2k_A* 1gd0_A* 1gcz_A* 3jsf_A* 3jsg_A* 3jtu_A* 3l5p_A* ... Back     alignment and structure
Probab=100.00  E-value=1.9e-39  Score=239.81  Aligned_cols=114  Identities=43%  Similarity=0.746  Sum_probs=111.3

Q ss_pred             CeEEEEeCCCCCCchhhHHHHHHHHHHHHhCCCcceEEEEEeCCeeEEecCCCCceeEEEEEEeecCChHHHHHHHHHHH
Q psy2936           2 PVFRIETNIPKEKIPANFGKETGALVAKTLGKPENYVAVIVVPDVNLVFGGSDAPAAIASLMSIGKLGTAENKKHSAVLF   81 (174)
Q Consensus         2 P~i~i~TNv~~~~~~~~f~~~ls~~vaevlgKPe~~ImV~i~~~~~m~fgGs~~P~a~veI~sig~~~~e~n~~~s~aI~   81 (174)
                      |+|+++||++.++++++|++++++++|+++||||+||||+++++++|+|||+++||||++|+++|++++++|++++++||
T Consensus         1 P~i~~~TNv~~~~~~~~~~~~ls~~~a~~lgKpe~~vmV~~~~~~~m~fgGs~~P~a~~~v~sig~~~~~~n~~~s~~i~   80 (114)
T 3djh_A            1 PMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLC   80 (114)
T ss_dssp             CEEEEEESSCGGGSCTTHHHHHHHHHHHHHCCCGGGCEEEEECSCEEEETTBCSSCEEEEEEESSCCSHHHHHHHHHHHH
T ss_pred             CEEEEEecCCcccccHHHHHHHHHHHHHHHCCCHHHeEEEEeCCceEEEcCcCCCEEEEEEEEccCCCHHHHHHHHHHHH
Confidence            99999999996667899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhhhCCCCCcEEEEEEeCCCCCeeecCceec
Q psy2936          82 PHIEKTLGIPKDRMYISYIDSSTDVVGYNGTTFH  115 (174)
Q Consensus        82 ~~l~e~LGIp~dRiyI~f~d~~~~nwG~~G~T~~  115 (174)
                      ++++++||||++|+||.|+|++++||||||+||+
T Consensus        81 ~~l~~~Lgi~~~riyI~f~d~~~~~~g~~G~tf~  114 (114)
T 3djh_A           81 GLLAERLRISPDRVYINYYDMNAANVGWNNSTFA  114 (114)
T ss_dssp             HHHHHHHCCCGGGEEEEEEECCGGGEEETTEECC
T ss_pred             HHHHHHhCcCcceEEEEEEECCHHHeeECCEECc
Confidence            9999999999999999999999999999999995
>3kan_A D-dopachrome tautomerase; immune response, cytokine, cytokine-inhibitor C; HET: RW1; 1.13A {Homo sapiens} SCOP: d.80.1.3 PDB: 1dpt_A* 3ker_A* Back     alignment and structure
>4dh4_A MIF; trimer, isomerase; 1.82A {Toxoplasma gondii} Back     alignment and structure
>3t5s_A Gilaa.00834.A, macrophage migration inhibitory factor; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Giardia lamblia} Back     alignment and structure
>3fwu_A Macrophage migration inhibitory factor-like protein; homotrimer, tautomerase, cytokine; 1.80A {Leishmania major} Back     alignment and structure
>3fwt_A Macrophage migration inhibitory factor-like protein; homotrimer, tautomerase, cytokine; 1.90A {Leishmania major} Back     alignment and structure
>1uiz_A MIF, macrophage migration inhibitory factor; cytokine, tautomerase; 2.50A {Xenopus laevis} SCOP: d.80.1.3 Back     alignment and structure
>2xcz_A Possible ATLS1-like light-inducible protein; cytokine, tautomerase, immune system, cyanobacterium; 1.64A {Prochlorococcus marinus} Back     alignment and structure
>2os5_A Acemif; macrophage migration inhibitory factor, cytokine, nematode,; 1.60A {Ancylostoma ceylanicum} PDB: 3rf4_A* 3rf5_A* Back     alignment and structure
>1hfo_A Migration inhibitory factor; tautomerase; 1.65A {Trichinella spiralis} SCOP: d.80.1.3 Back     alignment and structure
>2wkb_A Macrophage migration inhibitory factor; cytokine; HET: CME; 1.78A {Plasmodium berghei} PDB: 3gad_A 3gac_A 2wkf_A* Back     alignment and structure
>3b64_A Macrophage migration inhibitory factor-like protein; cytokine, MIF, LM1740MIF, lmmif, unknown function; 1.03A {Leishmania major} Back     alignment and structure
>2aal_A Malonate semialdehyde decarboxylase; tautomerase superfamily, beta-alpha-beta, homotrimeric, LYAS; 1.65A {Pseudomonas pavonaceae} SCOP: d.80.1.6 PDB: 2aag_A 2aaj_A Back     alignment and structure
>1mww_A Hypothetical protein HI1388.1; structural genomics, structure 2 function project, S2F, unknown function; HET: GLU; 2.08A {Haemophilus influenzae} SCOP: d.80.1.4 Back     alignment and structure
>3n4h_A Putative tautomerase; CG10062, CIS-3-chloroacrylic acid dehalogenase, tautomerase superfamily, beta-alpha-beta motif, hydrolase; HET: PR7; 2.02A {Corynebacterium glutamicum} PDB: 3n4d_A* 3n4g_A Back     alignment and structure
>3mlc_A FG41 malonate semialdehyde decarboxylase; tautomerase superfamily, malonate semialdehyde decarboxylase alpha-beta-motif; 2.22A {Coryneform bacterium} SCOP: d.80.1.0 PDB: 3mjz_A Back     alignment and structure
>3c6v_A Probable tautomerase/dehalogenase AU4130; aspergillus fumigatus trimeric thermophilic probable tautomerase/dehalogenase; HET: MSE; 1.90A {Aspergillus fumigatus AF293} Back     alignment and structure
>3mf7_A CIS-3-chloroacrylic acid dehalogenase; beta-alpha-beta motif, tautomerase, CIS-3-CHLO acid dehalogenase, isomerase, hydrolase; HET: PR4; 1.65A {Coryneform bacterium} PDB: 3mf8_A 2flt_A 2flz_A Back     alignment and structure
>2opa_A Probable tautomerase YWHB; homohexamer, 4-oxalocrotonate tautomerase, inhibitor, 2-FLUO hydroxycinnamate, isomerase; HET: FHC; 2.40A {Bacillus subtilis} PDB: 2op8_A* Back     alignment and structure
>1otf_A 4-oxalocrotonate tautomerase; isomerase; 1.90A {Pseudomonas SP} SCOP: d.80.1.1 PDB: 4otc_A 4ota_A 4otb_A 1bjp_A 2fm7_A Back     alignment and structure
>3abf_A 4-oxalocrotonate tautomerase; isomerase; 1.94A {Thermus thermophilus} Back     alignment and structure
>1u9d_A Hypothetical protein VC0714; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics; 1.70A {Vibrio cholerae o1 biovar eltor str} SCOP: d.80.1.5 Back     alignment and structure
>2x4k_A 4-oxalocrotonate tautomerase; isomerase; 1.10A {Staphylococcus aureus} Back     alignment and structure
>3m21_A Probable tautomerase HP_0924; 4-oxalocrotonate tautomerase, catalytic proline, hexamer, BE beta, isomerase; 1.90A {Helicobacter pylori} PDB: 2orm_A Back     alignment and structure
>3m20_A 4-oxalocrotonate tautomerase, putative; DMPI, thermophIle, beta-alpha-beta, catalytic proline, isomerase; 2.37A {Archaeoglobus fulgidus} Back     alignment and structure
>3mb2_A 4-oxalocrotonate tautomerase family enzyme - ALPH; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, hydrolase; 2.41A {Chloroflexus aurantiacus} Back     alignment and structure
>3ry0_A Putative tautomerase; oxalocrotonate tautomerase family, isomerase; 1.40A {Streptomyces achromogenes} Back     alignment and structure
>3ej9_A Alpha-subunit of trans-3-chloroacrylic acid dehal; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, isomerase, hydrolase; 1.50A {Pseudomonas pavonaceae} SCOP: d.80.1.1 PDB: 3ej3_A 1s0y_A 3ej7_A Back     alignment and structure
>1gyx_A YDCE, B1461, hypothetical protein YDCE; tautomerase, isomerase, complete proteo; HET: EPE; 1.35A {Escherichia coli} SCOP: d.80.1.1 PDB: 1gyj_A* 1gyy_A* Back     alignment and structure
>3abf_A 4-oxalocrotonate tautomerase; isomerase; 1.94A {Thermus thermophilus} Back     alignment and structure
>3e6q_A Putative 5-carboxymethyl-2-hydroxymuconate isomer; structural genomics, APC7683, isomerase, PSI-2, protein STRU initiative; HET: GOL IMD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3ej9_B Beta-subunit of trans-3-chloroacrylic acid dehalo; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, isomerase, hydrolase; 1.50A {Pseudomonas pavonaceae} SCOP: d.80.1.1 PDB: 3ej7_B 3ej3_B 1s0y_B Back     alignment and structure
>1otg_A 5-carboxymethyl-2-hydroxymuconate isomerase; 2.10A {Escherichia coli} SCOP: d.80.1.2 Back     alignment and structure
>2x4k_A 4-oxalocrotonate tautomerase; isomerase; 1.10A {Staphylococcus aureus} Back     alignment and structure
>3mb2_A 4-oxalocrotonate tautomerase family enzyme - ALPH; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, hydrolase; 2.41A {Chloroflexus aurantiacus} Back     alignment and structure
>3ej9_A Alpha-subunit of trans-3-chloroacrylic acid dehal; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, isomerase, hydrolase; 1.50A {Pseudomonas pavonaceae} SCOP: d.80.1.1 PDB: 3ej3_A 1s0y_A 3ej7_A Back     alignment and structure
>3n4h_A Putative tautomerase; CG10062, CIS-3-chloroacrylic acid dehalogenase, tautomerase superfamily, beta-alpha-beta motif, hydrolase; HET: PR7; 2.02A {Corynebacterium glutamicum} PDB: 3n4d_A* 3n4g_A Back     alignment and structure
>2aal_A Malonate semialdehyde decarboxylase; tautomerase superfamily, beta-alpha-beta, homotrimeric, LYAS; 1.65A {Pseudomonas pavonaceae} SCOP: d.80.1.6 PDB: 2aag_A 2aaj_A Back     alignment and structure
>3mlc_A FG41 malonate semialdehyde decarboxylase; tautomerase superfamily, malonate semialdehyde decarboxylase alpha-beta-motif; 2.22A {Coryneform bacterium} SCOP: d.80.1.0 PDB: 3mjz_A Back     alignment and structure
>3m20_A 4-oxalocrotonate tautomerase, putative; DMPI, thermophIle, beta-alpha-beta, catalytic proline, isomerase; 2.37A {Archaeoglobus fulgidus} Back     alignment and structure
>3c6v_A Probable tautomerase/dehalogenase AU4130; aspergillus fumigatus trimeric thermophilic probable tautomerase/dehalogenase; HET: MSE; 1.90A {Aspergillus fumigatus AF293} Back     alignment and structure
>3mb2_B 4-oxalocrotonate tautomerase family enzyme - beta; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, hydrolase; 2.41A {Chloroflexus aurantiacus} Back     alignment and structure
>3mf7_A CIS-3-chloroacrylic acid dehalogenase; beta-alpha-beta motif, tautomerase, CIS-3-CHLO acid dehalogenase, isomerase, hydrolase; HET: PR4; 1.65A {Coryneform bacterium} PDB: 3mf8_A 2flt_A 2flz_A Back     alignment and structure
>3m21_A Probable tautomerase HP_0924; 4-oxalocrotonate tautomerase, catalytic proline, hexamer, BE beta, isomerase; 1.90A {Helicobacter pylori} PDB: 2orm_A Back     alignment and structure
>1mww_A Hypothetical protein HI1388.1; structural genomics, structure 2 function project, S2F, unknown function; HET: GLU; 2.08A {Haemophilus influenzae} SCOP: d.80.1.4 Back     alignment and structure
>3ry0_A Putative tautomerase; oxalocrotonate tautomerase family, isomerase; 1.40A {Streptomyces achromogenes} Back     alignment and structure
>2opa_A Probable tautomerase YWHB; homohexamer, 4-oxalocrotonate tautomerase, inhibitor, 2-FLUO hydroxycinnamate, isomerase; HET: FHC; 2.40A {Bacillus subtilis} PDB: 2op8_A* Back     alignment and structure
>1otf_A 4-oxalocrotonate tautomerase; isomerase; 1.90A {Pseudomonas SP} SCOP: d.80.1.1 PDB: 4otc_A 4ota_A 4otb_A 1bjp_A 2fm7_A Back     alignment and structure
>2wkb_A Macrophage migration inhibitory factor; cytokine; HET: CME; 1.78A {Plasmodium berghei} PDB: 3gad_A 3gac_A 2wkf_A* Back     alignment and structure
>2xcz_A Possible ATLS1-like light-inducible protein; cytokine, tautomerase, immune system, cyanobacterium; 1.64A {Prochlorococcus marinus} Back     alignment and structure
>3b64_A Macrophage migration inhibitory factor-like protein; cytokine, MIF, LM1740MIF, lmmif, unknown function; 1.03A {Leishmania major} Back     alignment and structure
>1hfo_A Migration inhibitory factor; tautomerase; 1.65A {Trichinella spiralis} SCOP: d.80.1.3 Back     alignment and structure
>3ej9_B Beta-subunit of trans-3-chloroacrylic acid dehalo; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, isomerase, hydrolase; 1.50A {Pseudomonas pavonaceae} SCOP: d.80.1.1 PDB: 3ej7_B 3ej3_B 1s0y_B Back     alignment and structure
>1uiz_A MIF, macrophage migration inhibitory factor; cytokine, tautomerase; 2.50A {Xenopus laevis} SCOP: d.80.1.3 Back     alignment and structure
>2os5_A Acemif; macrophage migration inhibitory factor, cytokine, nematode,; 1.60A {Ancylostoma ceylanicum} PDB: 3rf4_A* 3rf5_A* Back     alignment and structure
>1gyx_A YDCE, B1461, hypothetical protein YDCE; tautomerase, isomerase, complete proteo; HET: EPE; 1.35A {Escherichia coli} SCOP: d.80.1.1 PDB: 1gyj_A* 1gyy_A* Back     alignment and structure
>1u9d_A Hypothetical protein VC0714; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics; 1.70A {Vibrio cholerae o1 biovar eltor str} SCOP: d.80.1.5 Back     alignment and structure
>3t5s_A Gilaa.00834.A, macrophage migration inhibitory factor; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.30A {Giardia lamblia} Back     alignment and structure
>3fwu_A Macrophage migration inhibitory factor-like protein; homotrimer, tautomerase, cytokine; 1.80A {Leishmania major} Back     alignment and structure
>3fwt_A Macrophage migration inhibitory factor-like protein; homotrimer, tautomerase, cytokine; 1.90A {Leishmania major} Back     alignment and structure
>4dh4_A MIF; trimer, isomerase; 1.82A {Toxoplasma gondii} Back     alignment and structure
>3djh_A Macrophage migration inhibitory factor; homotrimer, cytokine, inflammatory response, isomerase, phosphoprotein; 1.25A {Homo sapiens} SCOP: d.80.1.3 PDB: 1ca7_A* 1ljt_A* 2ooh_A* 2ooz_A* 3b9s_A* 2oow_A* 3ce4_A 3dji_A* 3ijg_A* 3ijj_A* 3smb_A* 3smc_A* 3u18_A* 4f2k_A* 1gd0_A* 1gcz_A* 3jsf_A* 3jsg_A* 3jtu_A* 3l5p_A* ... Back     alignment and structure
>3mb2_B 4-oxalocrotonate tautomerase family enzyme - beta; trans-3-chloroacrylic acid dehalogenase, CAAD, dehalogenase, hydrolase; 2.41A {Chloroflexus aurantiacus} Back     alignment and structure
>1otg_A 5-carboxymethyl-2-hydroxymuconate isomerase; 2.10A {Escherichia coli} SCOP: d.80.1.2 Back     alignment and structure
>3kan_A D-dopachrome tautomerase; immune response, cytokine, cytokine-inhibitor C; HET: RW1; 1.13A {Homo sapiens} SCOP: d.80.1.3 PDB: 1dpt_A* 3ker_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 174
d2gdga1114 d.80.1.3 (A:1-114) Microphage migration inhibition 2e-42
d1uiza_115 d.80.1.3 (A:) Microphage migration inhibition fact 2e-42
d1dpta_117 d.80.1.3 (A:) D-dopachrome tautomerase {Human (Hom 3e-42
d1hfoa_113 d.80.1.3 (A:) Microphage migration inhibition fact 2e-41
d1mwwa_120 d.80.1.4 (A:) Hypothetical protein HI1388.1 {Haemo 8e-15
>d2gdga1 d.80.1.3 (A:1-114) Microphage migration inhibition factor (MIF) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Tautomerase/MIF
superfamily: Tautomerase/MIF
family: MIF-related
domain: Microphage migration inhibition factor (MIF)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score =  135 bits (342), Expect = 2e-42
 Identities = 48/113 (42%), Positives = 71/113 (62%)

Query: 2   PVFRIETNIPKEKIPANFGKETGALVAKTLGKPENYVAVIVVPDVNLVFGGSDAPAAIAS 61
           P+F + TN+P+  +P  F  E    +A+  GKP  Y+AV VVPD  + F G++ P A+ S
Sbjct: 1   PMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTNDPCALCS 60

Query: 62  LMSIGKLGTAENKKHSAVLFPHIEKTLGIPKDRMYISYIDSSTDVVGYNGTTF 114
           L SIGK+G A+N+ +S +L   +   L I  DR+YI+Y D +   VG+NG+TF
Sbjct: 61  LHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTF 113
>d1uiza_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 115 Back     information, alignment and structure
>d1dpta_ d.80.1.3 (A:) D-dopachrome tautomerase {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1hfoa_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {Trichinella spiralis [TaxId: 6334]} Length = 113 Back     information, alignment and structure
>d1mwwa_ d.80.1.4 (A:) Hypothetical protein HI1388.1 {Haemophilus influenzae [TaxId: 727]} Length = 120 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query174
d1uiza_115 Microphage migration inhibition factor (MIF) {Afri 100.0
d2gdga1114 Microphage migration inhibition factor (MIF) {Mous 100.0
d1hfoa_113 Microphage migration inhibition factor (MIF) {Tric 100.0
d1dpta_117 D-dopachrome tautomerase {Human (Homo sapiens) [Ta 100.0
d1mwwa_120 Hypothetical protein HI1388.1 {Haemophilus influen 99.87
d2aala1129 Malonate semialdehyde decarboxylase, MSAD {Pseudom 99.75
d1otfa_59 4-oxalocrotonate tautomerase {Pseudomonas sp., Dmp 99.34
d1s0ya_62 Trans-3-chloroacrylic acid dehalogenase alpha-subu 99.31
d1gyxa_76 4-oxalocrotonate tautomerase homologue YdcE {Esche 98.68
d2aala1129 Malonate semialdehyde decarboxylase, MSAD {Pseudom 98.03
d1u9da_122 Hypothetical protein VC0714 {Vibrio cholerae [TaxI 97.98
d1otfa_59 4-oxalocrotonate tautomerase {Pseudomonas sp., Dmp 97.91
d1s0ya_62 Trans-3-chloroacrylic acid dehalogenase alpha-subu 97.73
d1mwwa_120 Hypothetical protein HI1388.1 {Haemophilus influen 97.34
d1gyxa_76 4-oxalocrotonate tautomerase homologue YdcE {Esche 97.1
d1otga_125 5-carboxymethyl-2-hydroxymuconate isomerase (CHMI) 97.09
d1s0yb_55 Trans-3-chloroacrylic acid dehalogenase beta-subun 92.98
d2gdga1114 Microphage migration inhibition factor (MIF) {Mous 90.0
d1hfoa_113 Microphage migration inhibition factor (MIF) {Tric 89.02
d1uiza_115 Microphage migration inhibition factor (MIF) {Afri 88.59
>d1uiza_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Tautomerase/MIF
superfamily: Tautomerase/MIF
family: MIF-related
domain: Microphage migration inhibition factor (MIF)
species: African clawed frog (Xenopus laevis) [TaxId: 8355]

Probab=100.00  E-value=7.3e-42  Score=252.44  Aligned_cols=115  Identities=42%  Similarity=0.743  Sum_probs=113.0

Q ss_pred             CCeEEEEeCCCCCCchhhHHHHHHHHHHHHhCCCcceEEEEEeCCeeEEecCCCCceeEEEEEEeecCChHHHHHHHHHH
Q psy2936           1 MPVFRIETNIPKEKIPANFGKETGALVAKTLGKPENYVAVIVVPDVNLVFGGSDAPAAIASLMSIGKLGTAENKKHSAVL   80 (174)
Q Consensus         1 MP~i~i~TNv~~~~~~~~f~~~ls~~vaevlgKPe~~ImV~i~~~~~m~fgGs~~P~a~veI~sig~~~~e~n~~~s~aI   80 (174)
                      ||+++|+||++.++++++|++++++++|+++||||+||||+++++++|+|||+++||||++|+++|++++++|++++++|
T Consensus         1 MP~i~i~TNv~~~~~~~~~~~~ls~~ia~~lgKpe~~vmv~v~~~~~m~fggs~~P~a~~~v~siG~l~~~~n~~~s~~i   80 (115)
T d1uiza_           1 MPVFTIRTNVCRDSVPDTLLSDLTKQLAKATGKPAEYIAIHIVPDQIMSFGDSTDPCAVCSLCSIGKIGGPQNKSYTKLL   80 (115)
T ss_dssp             CCEEEEEESSCGGGSCTTHHHHHHHHHHHHHTCCGGGCEEEEECSCEEEETTBCSSCEEEEEEESSCCSHHHHHHHHHHH
T ss_pred             CCeEEEEecCCchhChHHHHHHHHHHHHHHHCCCHHHEEEEEcCCceEEeCCCCCcEEEEEEEEEcCCChhhhHHHHHHH
Confidence            99999999999777899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhhCCCCCcEEEEEEeCCCCCeeecCceec
Q psy2936          81 FPHIEKTLGIPKDRMYISYIDSSTDVVGYNGTTFH  115 (174)
Q Consensus        81 ~~~l~e~LGIp~dRiyI~f~d~~~~nwG~~G~T~~  115 (174)
                      +++++++||||++|+||.|+|+++++|||||+||+
T Consensus        81 ~~~l~~~LgI~~~Riyi~f~d~~~~~~G~nG~TFA  115 (115)
T d1uiza_          81 CDILTKQLNIPANRVYINYYDLNAANVGWNGSTFA  115 (115)
T ss_dssp             HHHHHHHHCCCGGGEEEEEEECCGGGEEETTEECC
T ss_pred             HHHHHHHcCCCcceEEEEEEECCHHHeeECcEECC
Confidence            99999999999999999999999999999999996
>d2gdga1 d.80.1.3 (A:1-114) Microphage migration inhibition factor (MIF) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hfoa_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {Trichinella spiralis [TaxId: 6334]} Back     information, alignment and structure
>d1dpta_ d.80.1.3 (A:) D-dopachrome tautomerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mwwa_ d.80.1.4 (A:) Hypothetical protein HI1388.1 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2aala1 d.80.1.6 (A:1-129) Malonate semialdehyde decarboxylase, MSAD {Pseudomonas pavonaceae [TaxId: 47881]} Back     information, alignment and structure
>d1otfa_ d.80.1.1 (A:) 4-oxalocrotonate tautomerase {Pseudomonas sp., DmpI [TaxId: 306]} Back     information, alignment and structure
>d1s0ya_ d.80.1.1 (A:) Trans-3-chloroacrylic acid dehalogenase alpha-subunit, CaaD1 {Pseudomonas pavonaceae [TaxId: 47881]} Back     information, alignment and structure
>d1gyxa_ d.80.1.1 (A:) 4-oxalocrotonate tautomerase homologue YdcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2aala1 d.80.1.6 (A:1-129) Malonate semialdehyde decarboxylase, MSAD {Pseudomonas pavonaceae [TaxId: 47881]} Back     information, alignment and structure
>d1u9da_ d.80.1.5 (A:) Hypothetical protein VC0714 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1otfa_ d.80.1.1 (A:) 4-oxalocrotonate tautomerase {Pseudomonas sp., DmpI [TaxId: 306]} Back     information, alignment and structure
>d1s0ya_ d.80.1.1 (A:) Trans-3-chloroacrylic acid dehalogenase alpha-subunit, CaaD1 {Pseudomonas pavonaceae [TaxId: 47881]} Back     information, alignment and structure
>d1mwwa_ d.80.1.4 (A:) Hypothetical protein HI1388.1 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1gyxa_ d.80.1.1 (A:) 4-oxalocrotonate tautomerase homologue YdcE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1otga_ d.80.1.2 (A:) 5-carboxymethyl-2-hydroxymuconate isomerase (CHMI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1s0yb_ d.80.1.1 (B:) Trans-3-chloroacrylic acid dehalogenase beta-subunit, CaaD2 {Pseudomonas pavonaceae [TaxId: 47881]} Back     information, alignment and structure
>d2gdga1 d.80.1.3 (A:1-114) Microphage migration inhibition factor (MIF) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hfoa_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {Trichinella spiralis [TaxId: 6334]} Back     information, alignment and structure
>d1uiza_ d.80.1.3 (A:) Microphage migration inhibition factor (MIF) {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure