Psyllid ID: psy3020


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150
MTTYSCLSYLGRYKESISTYEEGLKLDPNNEQMKEAIKDVRNQEMNDMNRGDPFANLFSDPNIFVQLQLDPRTKPFLSDPSYVQMIKEIQKDPSLMTLEAKISLLKDKGNAALQANNFKEAIEAYSEAIKLDGTNHILFSNRSAAFAKAI
ccHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHcccccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHccc
ccHHHHHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccccccccHcccHHHHHHHHccccHHHHHccHHHHHHHHHHHHccHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHc
MTTYSCLSYLGRYKESISTYEeglkldpnneQMKEAIKDVRNQemndmnrgdpfanlfsdpnifvqlqldprtkpflsdpsYVQMIKEIQKDPSLMTLEAKISLLKDKGNAALQANNFKEAIEAYSEAIKLdgtnhilfsNRSAAFAKAI
mttysclsylgrYKESISTYeeglkldpnneQMKEAIKDVRNQEMNDMNRGDPFANLFSDPNIFVQLQLDPRTKPFLSDPSYVQMIKEIQKDPSLMTLEAKISLLKDKGNAALQANNFKEAIEAYSEAIKLDGTNHILFSNRSAAFAKAI
MTTYSCLSYLGRYKESISTYEEGLKLDPNNEQMKEAIKDVRNQEMNDMNRGDPFANLFSDPNIFVQLQLDPRTKPFLSDPSYVQMIKEIQKDPSLMTLEAKISLLKDKGNAALQANNFKEAIEAYSEAIKLDGTNHILFSNRSAAFAKAI
***YSCLSYLGRYKESI*************************************ANLFSDPNIFVQLQLDPRTKPFLSDPSYVQMIKEIQK**SLMTLEAKISLLKDKGNAALQANNFKEAIEAYSEAIKLDGTNHILFS**********
*TTYSCLSYLGRYKESISTYEEGLKLDPNNEQMKEAIKDVRNQEMNDMNRGDPFANLFSDPNIFV********************************LEAKISLLKDKGNAALQANNFKEAIEAYSEAIKLDGTNHILFSNRSAAFAKAI
MTTYSCLSYLGRYKESISTYEEGLKLDPNNEQMKEAIKDVRNQEMNDMNRGDPFANLFSDPNIFVQLQLDPRTKPFLSDPSYVQMIKEIQKDPSLMTLEAKISLLKDKGNAALQANNFKEAIEAYSEAIKLDGTNHILFSNRSAAFAKAI
MTTYSCLSYLGRYKESISTYEEGLKLDPNNEQMKEAIKDVRNQEMNDMNRGDPFANLFSDPNIFVQLQLDPRTKPFLSDPSYVQMIKEIQKDPSLMTLEAKISLLKDKGNAALQANNFKEAIEAYSEAIKLDGTNHILFSNRSAAFAKAI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTTYSCLSYLGRYKESISTYEEGLKLDPNNEQMKEAIKDVRNQEMNDMNRGDPFANLFSDPNIFVQLQLDPRTKPFLSDPSYVQMIKEIQKDPSLMTLEAKISLLKDKGNAALQANNFKEAIEAYSEAIKLDGTNHILFSNRSAAFAKAI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query150 2.2.26 [Sep-21-2011]
Q4R8N7 543 Stress-induced-phosphopro N/A N/A 0.913 0.252 0.292 5e-14
P31948 543 Stress-induced-phosphopro yes N/A 0.913 0.252 0.292 6e-14
O35814 543 Stress-induced-phosphopro yes N/A 0.9 0.248 0.300 9e-14
Q60864 543 Stress-induced-phosphopro yes N/A 0.9 0.248 0.300 1e-13
Q3ZBZ8 543 Stress-induced-phosphopro yes N/A 0.913 0.252 0.287 1e-13
O54981 543 Stress-induced-phosphopro yes N/A 0.9 0.248 0.295 5e-13
Q54DA8 564 Protein STIP1 homolog OS= yes N/A 0.606 0.161 0.358 6e-12
Q9USI5 591 Heat shock protein sti1 h yes N/A 0.633 0.160 0.326 5e-07
Q43468 569 Heat shock protein STI OS no N/A 0.193 0.050 0.55 1e-05
P15705 589 Heat shock protein STI1 O yes N/A 0.62 0.157 0.295 3e-05
>sp|Q4R8N7|STIP1_MACFA Stress-induced-phosphoprotein 1 OS=Macaca fascicularis GN=STIP1 PE=2 SV=1 Back     alignment and function desciption
 Score = 76.6 bits (187), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 57/195 (29%), Positives = 92/195 (47%), Gaps = 58/195 (29%)

Query: 5   SCLSYLGRYKESISTYEEGLKLDPNNEQMKEAIKDVRNQEMNDMNRGDPFANLFSDPNIF 64
           + L +L R++E+  TYEEGLK + NN Q+KE ++   N E     R   F N F+ PN++
Sbjct: 80  AALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQ---NMEARLAER--KFMNPFNMPNLY 134

Query: 65  VQLQLDPRTKPFLSDPSYVQMIKEIQ----------KDPSLMTL---------------- 98
            +L+ DPRT+  LSDP+Y ++I++++          +DP +MT                 
Sbjct: 135 QKLESDPRTRTLLSDPTYRELIEQLRNKPSDLGTKLQDPRIMTTLSVLLGVDLGSMDEEE 194

Query: 99  -------------------------EAKISLLKDK--GNAALQANNFKEAIEAYSEAIKL 131
                                    E K   LK+K  GN A +  +F  A++ Y +A +L
Sbjct: 195 EVATPPPPPPPKKETKPEPMEEDLPENKKQALKEKELGNDAYKKKDFDTALKHYDKAKEL 254

Query: 132 DGTNHILFSNRSAAF 146
           D TN    +N++A +
Sbjct: 255 DPTNMTYITNQAAVY 269




Mediates the association of the molecular chaperones HSC70 and HSP90 (HSPCA and HSPCB).
Macaca fascicularis (taxid: 9541)
>sp|P31948|STIP1_HUMAN Stress-induced-phosphoprotein 1 OS=Homo sapiens GN=STIP1 PE=1 SV=1 Back     alignment and function description
>sp|O35814|STIP1_RAT Stress-induced-phosphoprotein 1 OS=Rattus norvegicus GN=Stip1 PE=1 SV=1 Back     alignment and function description
>sp|Q60864|STIP1_MOUSE Stress-induced-phosphoprotein 1 OS=Mus musculus GN=Stip1 PE=1 SV=1 Back     alignment and function description
>sp|Q3ZBZ8|STIP1_BOVIN Stress-induced-phosphoprotein 1 OS=Bos taurus GN=STIP1 PE=2 SV=1 Back     alignment and function description
>sp|O54981|STIP1_CRIGR Stress-induced-phosphoprotein 1 OS=Cricetulus griseus GN=STIP1 PE=2 SV=1 Back     alignment and function description
>sp|Q54DA8|STIP1_DICDI Protein STIP1 homolog OS=Dictyostelium discoideum GN=sti1 PE=3 SV=1 Back     alignment and function description
>sp|Q9USI5|STI1_SCHPO Heat shock protein sti1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sti1 PE=3 SV=1 Back     alignment and function description
>sp|Q43468|STIP_SOYBN Heat shock protein STI OS=Glycine max GN=STI PE=2 SV=1 Back     alignment and function description
>sp|P15705|STI1_YEAST Heat shock protein STI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STI1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
332025474 512 Stress-induced-phosphoprotein 1 [Acromyr 0.586 0.171 0.436 1e-16
322786074 538 hypothetical protein SINV_09553 [Solenop 0.553 0.154 0.471 1e-16
270016347 365 hypothetical protein TcasGA2_TC002163 [T 0.913 0.375 0.287 4e-15
91094403 362 PREDICTED: similar to Stress-induced-pho 0.913 0.378 0.287 4e-15
409994629 552 heat shock 90/70 organizing protein [Fra 0.553 0.150 0.395 9e-14
432899790 542 PREDICTED: stress-induced-phosphoprotein 0.913 0.252 0.273 2e-13
116786888 568 unknown [Picea sitchensis] 0.586 0.154 0.393 2e-13
310693634 542 stress-induced phosphoprotein 1 [Miichth 0.9 0.249 0.295 3e-13
156552012 549 PREDICTED: stress-induced-phosphoprotein 0.62 0.169 0.378 5e-13
56090148 542 stress-induced-phosphoprotein 1 [Danio r 0.913 0.252 0.293 5e-13
>gi|332025474|gb|EGI65638.1| Stress-induced-phosphoprotein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
 Score = 91.3 bits (225), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 66/94 (70%), Gaps = 6/94 (6%)

Query: 5   SCLSYLGRYKESISTYEEGLKLDPNNEQMKEAIKDVRNQEMNDMNRGDPFANLFSDPNIF 64
           S L+YLGRY ESI  YE+GL+LDPNN Q++ ++ +VR Q      +     N F+ P+IF
Sbjct: 74  SALAYLGRYDESIRAYEKGLQLDPNNPQLRSSLAEVRAQ------KTAAVTNPFNSPDIF 127

Query: 65  VQLQLDPRTKPFLSDPSYVQMIKEIQKDPSLMTL 98
           ++L  DPRTK +LSDP Y+++++E++ +P  +++
Sbjct: 128 LKLASDPRTKGYLSDPEYMKLLQELRTNPQSLSI 161




Source: Acromyrmex echinatior

Species: Acromyrmex echinatior

Genus: Acromyrmex

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|322786074|gb|EFZ12685.1| hypothetical protein SINV_09553 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|270016347|gb|EFA12793.1| hypothetical protein TcasGA2_TC002163 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91094403|ref|XP_967038.1| PREDICTED: similar to Stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein), partial [Tribolium castaneum] Back     alignment and taxonomy information
>gi|409994629|gb|AFV50602.1| heat shock 90/70 organizing protein [Frankliniella occidentalis] gi|442769471|gb|AGC70809.1| heat shock 90/70 organizing protein [Frankliniella occidentalis] Back     alignment and taxonomy information
>gi|432899790|ref|XP_004076640.1| PREDICTED: stress-induced-phosphoprotein 1-like [Oryzias latipes] Back     alignment and taxonomy information
>gi|116786888|gb|ABK24283.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|310693634|gb|ADP05116.1| stress-induced phosphoprotein 1 [Miichthys miiuy] Back     alignment and taxonomy information
>gi|156552012|ref|XP_001603429.1| PREDICTED: stress-induced-phosphoprotein 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|56090148|ref|NP_001007767.1| stress-induced-phosphoprotein 1 [Danio rerio] gi|55715903|gb|AAH85642.1| Stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein) [Danio rerio] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query150
UNIPROTKB|Q3ZBZ8 543 STIP1 "Stress-induced-phosphop 0.566 0.156 0.411 2.7e-20
MGI|MGI:109130 543 Stip1 "stress-induced phosphop 0.566 0.156 0.422 3.5e-20
UNIPROTKB|P31948 543 STIP1 "Stress-induced-phosphop 0.566 0.156 0.411 3.5e-20
RGD|621599 543 Stip1 "stress-induced phosphop 0.566 0.156 0.422 3.5e-20
TAIR|locus:2034620 572 Hop1 "Hop1" [Arabidopsis thali 0.613 0.160 0.336 4e-19
ZFIN|ZDB-GENE-041121-17 542 stip1 "stress-induced-phosphop 0.566 0.156 0.366 1.1e-18
DICTYBASE|DDB_G0292404 564 sti1 "stress-induced-phosphopr 0.613 0.163 0.354 2.8e-17
TAIR|locus:2026197 571 Hop2 "Hop2" [Arabidopsis thali 0.593 0.155 0.333 4.9e-17
TAIR|locus:2139109 558 Hop3 "AT4G12400" [Arabidopsis 0.6 0.161 0.293 2.1e-16
CGD|CAL0002444 590 STI1 [Candida albicans (taxid: 0.573 0.145 0.325 1.8e-14
UNIPROTKB|Q3ZBZ8 STIP1 "Stress-induced-phosphoprotein 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 182 (69.1 bits), Expect = 2.7e-20, Sum P(2) = 2.7e-20
 Identities = 37/90 (41%), Positives = 59/90 (65%)

Query:     5 SCLSYLGRYKESISTYEEGLKLDPNNEQMKEAIKDVRNQEMNDMNRGDPFANLFSDPNIF 64
             + L +L R++E+  TYEEGLK + NN Q+KE ++   N E     R   F N F+ PN++
Sbjct:    80 AALEFLNRFEEAKQTYEEGLKHEANNPQLKEGLQ---NMEARLAER--KFMNPFNMPNLY 134

Query:    65 VQLQLDPRTKPFLSDPSYVQMIKEIQKDPS 94
              +L+ DPRTK  L+DP+Y ++I++++  PS
Sbjct:   135 QKLESDPRTKTLLADPTYRELIEQLRNKPS 164


GO:0005737 "cytoplasm" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
MGI|MGI:109130 Stip1 "stress-induced phosphoprotein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P31948 STIP1 "Stress-induced-phosphoprotein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|621599 Stip1 "stress-induced phosphoprotein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
TAIR|locus:2034620 Hop1 "Hop1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041121-17 stip1 "stress-induced-phosphoprotein 1 (Hsp70/Hsp90-organizing protein)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0292404 sti1 "stress-induced-phosphoprotein 1" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
TAIR|locus:2026197 Hop2 "Hop2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2139109 Hop3 "AT4G12400" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
CGD|CAL0002444 STI1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
pfam1341469 pfam13414, TPR_11, TPR repeat 6e-08
cd00189100 cd00189, TPR, Tetratricopeptide repeat domain; typ 5e-06
pfam0051534 pfam00515, TPR_1, Tetratricopeptide repeat 5e-04
smart0002834 smart00028, TPR, Tetratricopeptide repeats 8e-04
pfam0771934 pfam07719, TPR_2, Tetratricopeptide repeat 0.001
>gnl|CDD|222112 pfam13414, TPR_11, TPR repeat Back     alignment and domain information
 Score = 46.5 bits (111), Expect = 6e-08
 Identities = 18/45 (40%), Positives = 28/45 (62%)

Query: 104 LLKDKGNAALQANNFKEAIEAYSEAIKLDGTNHILFSNRSAAFAK 148
            LK+ GNA  +  ++ EAIEAY +A++LD  N   + N + A+ K
Sbjct: 5   ALKNLGNALFKLGDYDEAIEAYEKALELDPDNAEAYYNLALAYLK 49


Length = 69

>gnl|CDD|238112 cd00189, TPR, Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]- X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and Cdc27p components of the cyclosome/APC, the Pex5p/Pas10p receptor for peroxisomal targeting signals, the Tom70p co-receptor for mitochondrial targeting signals, Ser/Thr phosphatase 5C and the p110 subunit of O-GlcNAc transferase; three copies of the repeat are present here Back     alignment and domain information
>gnl|CDD|201277 pfam00515, TPR_1, Tetratricopeptide repeat Back     alignment and domain information
>gnl|CDD|197478 smart00028, TPR, Tetratricopeptide repeats Back     alignment and domain information
>gnl|CDD|191825 pfam07719, TPR_2, Tetratricopeptide repeat Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 150
PRK15359144 type III secretion system chaperone protein SscB; 99.74
KOG0553|consensus 304 99.7
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 99.64
KOG4626|consensus 966 99.64
KOG4626|consensus 966 99.63
KOG0548|consensus 539 99.59
TIGR00990 615 3a0801s09 mitochondrial precursor proteins import 99.56
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 99.56
KOG1126|consensus638 99.56
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 99.51
PRK11189 296 lipoprotein NlpI; Provisional 99.5
PRK10370198 formate-dependent nitrite reductase complex subuni 99.47
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.46
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.45
PRK15359144 type III secretion system chaperone protein SscB; 99.45
PRK11189296 lipoprotein NlpI; Provisional 99.43
PRK12370553 invasion protein regulator; Provisional 99.43
PRK10370198 formate-dependent nitrite reductase complex subuni 99.41
PRK12370553 invasion protein regulator; Provisional 99.41
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.41
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.4
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.35
PLN02789 320 farnesyltranstransferase 99.35
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.35
KOG0548|consensus539 99.35
PRK09782 987 bacteriophage N4 receptor, outer membrane subunit; 99.35
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 99.34
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.34
KOG0624|consensus 504 99.33
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.33
KOG1155|consensus559 99.32
KOG1125|consensus579 99.32
TIGR02552135 LcrH_SycD type III secretion low calcium response 99.31
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.31
TIGR02917899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.3
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 99.29
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 99.29
KOG1126|consensus638 99.28
KOG1155|consensus559 99.28
KOG0550|consensus 486 99.25
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 99.24
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 99.23
KOG2002|consensus 1018 99.23
KOG3060|consensus289 99.23
cd00189100 TPR Tetratricopeptide repeat domain; typically con 99.21
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 99.21
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 99.2
KOG0547|consensus606 99.2
PRK11788 389 tetratricopeptide repeat protein; Provisional 99.18
KOG2076|consensus 895 99.18
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 99.17
KOG1125|consensus579 99.17
KOG0547|consensus606 99.16
COG4235287 Cytochrome c biogenesis factor [Posttranslational 99.16
KOG0624|consensus 504 99.13
PRK11788 389 tetratricopeptide repeat protein; Provisional 99.12
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.12
PRK02603172 photosystem I assembly protein Ycf3; Provisional 99.1
KOG4162|consensus799 99.1
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 99.09
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 99.09
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 99.07
PRK14720 906 transcript cleavage factor/unknown domain fusion p 99.06
CHL00033168 ycf3 photosystem I assembly protein Ycf3 99.06
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 99.02
COG4783484 Putative Zn-dependent protease, contains TPR repea 99.02
PRK15179 694 Vi polysaccharide biosynthesis protein TviE; Provi 99.01
KOG1173|consensus 611 99.0
PLN02789320 farnesyltranstransferase 99.0
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.98
KOG3785|consensus 557 98.97
PRK10803263 tol-pal system protein YbgF; Provisional 98.97
PRK15331165 chaperone protein SicA; Provisional 98.97
KOG0550|consensus 486 98.96
KOG0543|consensus397 98.94
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 98.94
KOG4648|consensus 536 98.92
COG5010257 TadD Flp pilus assembly protein TadD, contains TPR 98.92
KOG1129|consensus478 98.91
PRK14574 822 hmsH outer membrane protein; Provisional 98.9
KOG2002|consensus 1018 98.9
PRK14574 822 hmsH outer membrane protein; Provisional 98.89
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.87
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.87
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 98.85
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.84
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.82
PF1342844 TPR_14: Tetratricopeptide repeat 98.8
cd05804 355 StaR_like StaR_like; a well-conserved protein foun 98.8
PF1342844 TPR_14: Tetratricopeptide repeat 98.8
KOG1156|consensus 700 98.78
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.77
KOG1128|consensus 777 98.74
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.73
KOG1156|consensus 700 98.72
PF06552186 TOM20_plant: Plant specific mitochondrial import r 98.7
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 98.69
KOG4162|consensus799 98.69
PF1337173 TPR_9: Tetratricopeptide repeat 98.67
KOG4340|consensus 459 98.67
KOG4642|consensus 284 98.65
KOG2076|consensus 895 98.65
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.65
CHL00033168 ycf3 photosystem I assembly protein Ycf3 98.64
KOG0553|consensus 304 98.64
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.64
TIGR00540409 hemY_coli hemY protein. This is an uncharacterized 98.63
KOG4555|consensus175 98.62
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 98.61
PRK02603172 photosystem I assembly protein Ycf3; Provisional 98.6
PRK14720 906 transcript cleavage factor/unknown domain fusion p 98.59
PRK11906458 transcriptional regulator; Provisional 98.58
KOG1173|consensus611 98.57
KOG4234|consensus271 98.57
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.57
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 98.55
PLN03098 453 LPA1 LOW PSII ACCUMULATION1; Provisional 98.53
PF09295 395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.52
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.5
KOG0543|consensus397 98.5
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 98.49
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 98.48
KOG1127|consensus 1238 98.47
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 98.46
KOG1174|consensus564 98.44
COG4235287 Cytochrome c biogenesis factor [Posttranslational 98.42
PRK10153517 DNA-binding transcriptional activator CadC; Provis 98.41
PF1337173 TPR_9: Tetratricopeptide repeat 98.41
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 98.41
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 98.4
PRK11906458 transcriptional regulator; Provisional 98.39
KOG4648|consensus 536 98.39
PF12688120 TPR_5: Tetratrico peptide repeat 98.39
KOG1129|consensus 478 98.37
PF13512142 TPR_18: Tetratricopeptide repeat 98.36
COG4783484 Putative Zn-dependent protease, contains TPR repea 98.35
PRK15331165 chaperone protein SicA; Provisional 98.34
KOG1840|consensus508 98.34
cd00189100 TPR Tetratricopeptide repeat domain; typically con 98.33
KOG1174|consensus 564 98.33
COG1729262 Uncharacterized protein conserved in bacteria [Fun 98.33
PRK10866243 outer membrane biogenesis protein BamD; Provisiona 98.3
TIGR00540 409 hemY_coli hemY protein. This is an uncharacterized 98.3
COG3063250 PilF Tfp pilus assembly protein PilF [Cell motilit 98.3
KOG0376|consensus 476 98.28
COG4785 297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 98.26
KOG1127|consensus 1238 98.25
KOG1128|consensus 777 98.24
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 98.22
PF13525203 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M 98.22
COG4700251 Uncharacterized protein conserved in bacteria cont 98.2
PF1343134 TPR_17: Tetratricopeptide repeat 98.19
KOG0495|consensus913 98.16
KOG2003|consensus 840 98.15
KOG1840|consensus 508 98.13
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 98.12
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 98.1
PF1343134 TPR_17: Tetratricopeptide repeat 98.09
PRK10747398 putative protoheme IX biogenesis protein; Provisio 98.05
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 98.04
KOG2003|consensus 840 98.01
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 98.0
COG2956 389 Predicted N-acetylglucosaminyl transferase [Carboh 98.0
COG4785297 NlpI Lipoprotein NlpI, contains TPR repeats [Gener 97.99
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.95
KOG0551|consensus 390 97.94
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.91
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.88
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 97.88
PF12569 517 NARP1: NMDA receptor-regulated protein 1 ; InterPr 97.88
KOG3060|consensus 289 97.82
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 97.8
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 97.77
KOG0495|consensus 913 97.75
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 97.74
COG2956389 Predicted N-acetylglucosaminyl transferase [Carboh 97.74
KOG2796|consensus366 97.71
KOG4234|consensus271 97.69
PF13512142 TPR_18: Tetratricopeptide repeat 97.68
KOG4642|consensus 284 97.67
KOG0545|consensus329 97.66
PRK10803263 tol-pal system protein YbgF; Provisional 97.66
PF12688120 TPR_5: Tetratrico peptide repeat 97.65
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 97.63
COG3118304 Thioredoxin domain-containing protein [Posttransla 97.61
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 97.6
KOG1308|consensus 377 97.54
KOG1130|consensus 639 97.51
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 97.5
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 97.47
PLN03077 857 Protein ECB2; Provisional 97.42
KOG2376|consensus 652 97.4
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.33
KOG4555|consensus175 97.33
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.31
KOG2376|consensus 652 97.29
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.28
PF10300 468 DUF3808: Protein of unknown function (DUF3808); In 97.2
PF06552 186 TOM20_plant: Plant specific mitochondrial import r 97.2
COG2976207 Uncharacterized protein conserved in bacteria [Fun 97.19
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 97.17
COG0457291 NrfG FOG: TPR repeat [General function prediction 97.15
PRK10941269 hypothetical protein; Provisional 97.05
COG4105254 ComL DNA uptake lipoprotein [General function pred 97.02
KOG2471|consensus 696 97.02
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 96.94
KOG1130|consensus 639 96.93
KOG0545|consensus329 96.88
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.87
KOG3081|consensus299 96.77
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.76
KOG3824|consensus 472 96.73
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 96.71
PLN03218 1060 maturation of RBCL 1; Provisional 96.71
PLN03218 1060 maturation of RBCL 1; Provisional 96.62
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 96.61
KOG2053|consensus 932 96.57
KOG2796|consensus366 96.55
PF02259352 FAT: FAT domain; InterPro: IPR003151 The FAT domai 96.54
PF1337442 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT 96.48
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 96.45
KOG0376|consensus 476 96.4
COG1729262 Uncharacterized protein conserved in bacteria [Fun 96.36
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 96.33
PLN03081 697 pentatricopeptide (PPR) repeat-containing protein; 96.32
KOG4507|consensus 886 96.29
KOG3824|consensus 472 96.27
PRK04841 903 transcriptional regulator MalT; Provisional 96.25
KOG3785|consensus 557 96.14
KOG4340|consensus 459 96.13
PF03704146 BTAD: Bacterial transcriptional activator domain; 96.13
PF04184 539 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for 96.09
PLN03077 857 Protein ECB2; Provisional 96.01
KOG0551|consensus 390 96.01
KOG1941|consensus 518 95.97
KOG2610|consensus 491 95.84
COG3071400 HemY Uncharacterized enzyme of heme biosynthesis [ 95.73
PF1456190 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S 95.68
PF13281374 DUF4071: Domain of unknown function (DUF4071) 95.62
PF1051638 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetrat 95.55
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 95.54
PF09986214 DUF2225: Uncharacterized protein conserved in bact 95.46
KOG3081|consensus299 95.45
COG4649221 Uncharacterized protein conserved in bacteria [Fun 95.44
PF0772036 TPR_3: Tetratricopeptide repeat; InterPro: IPR0117 95.33
PRK10941269 hypothetical protein; Provisional 95.32
KOG1915|consensus 677 95.17
KOG2610|consensus 491 95.14
COG4976 287 Predicted methyltransferase (contains TPR repeat) 94.94
KOG1310|consensus 758 94.84
PRK04841 903 transcriptional regulator MalT; Provisional 94.59
PF0772126 TPR_4: Tetratricopeptide repeat; InterPro: IPR0117 94.48
KOG2396|consensus 568 94.46
KOG3364|consensus149 94.44
PF05843 280 Suf: Suppressor of forked protein (Suf); InterPro: 94.38
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 94.24
KOG1915|consensus 677 94.21
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 94.12
KOG1586|consensus288 93.8
TIGR0350444 FimV_Cterm FimV C-terminal domain. This protein is 93.79
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 93.21
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 92.96
smart0038633 HAT HAT (Half-A-TPR) repeats. Present in several R 92.75
KOG1308|consensus377 92.42
KOG0530|consensus 318 92.37
PF07079549 DUF1347: Protein of unknown function (DUF1347); In 92.15
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 92.04
KOG3364|consensus149 91.87
COG4700251 Uncharacterized protein conserved in bacteria cont 91.81
COG2912269 Uncharacterized conserved protein [Function unknow 91.47
PHA02537230 M terminase endonuclease subunit; Provisional 91.33
PF12968144 DUF3856: Domain of Unknown Function (DUF3856); Int 91.21
COG3914 620 Spy Predicted O-linked N-acetylglucosamine transfe 91.06
KOG0529|consensus 421 90.65
PF0153531 PPR: PPR repeat; InterPro: IPR002885 This entry re 90.57
KOG2471|consensus 696 90.54
PF14863141 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB 90.4
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 90.32
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 90.24
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 90.16
PF04781111 DUF627: Protein of unknown function (DUF627); Inte 90.13
PF04910 360 Tcf25: Transcriptional repressor TCF25; InterPro: 90.09
KOG2053|consensus 932 90.06
COG4976 287 Predicted methyltransferase (contains TPR repeat) 89.94
COG3947361 Response regulator containing CheY-like receiver a 89.92
cd0268275 MIT_AAA_Arch MIT: domain contained within Microtub 89.77
PF1285434 PPR_1: PPR repeat 89.6
PF0421269 MIT: MIT (microtubule interacting and transport) d 88.99
PF08424 321 NRDE-2: NRDE-2, necessary for RNA interference; In 88.82
PF1286294 Apc5: Anaphase-promoting complex subunit 5 88.66
PF10300468 DUF3808: Protein of unknown function (DUF3808); In 88.53
PF0123931 PPTA: Protein prenyltransferase alpha subunit repe 88.45
PF1304150 PPR_2: PPR repeat family 88.42
KOG1550|consensus 552 88.19
PF1286294 Apc5: Anaphase-promoting complex subunit 5 88.07
TIGR0075635 PPR pentatricopeptide repeat domain (PPR motif). T 87.61
COG5191 435 Uncharacterized conserved protein, contains HAT (H 87.52
COG2912269 Uncharacterized conserved protein [Function unknow 87.46
PF1057980 Rapsyn_N: Rapsyn N-terminal myristoylation and lin 87.32
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 87.07
KOG4814|consensus 872 86.93
PF02064121 MAS20: MAS20 protein import receptor; InterPro: IP 86.59
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 85.81
KOG1070|consensus 1710 85.64
KOG1941|consensus 518 85.63
PF15015 569 NYD-SP12_N: Spermatogenesis-associated, N-terminal 85.48
KOG1070|consensus1710 85.48
KOG4507|consensus 886 84.53
PF10602177 RPN7: 26S proteasome subunit RPN7; InterPro: IPR01 84.29
KOG1585|consensus 308 84.26
PF09613160 HrpB1_HrpK: Bacterial type III secretion protein ( 84.1
KOG3616|consensus 1636 83.41
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 83.41
KOG0985|consensus 1666 83.05
PF0421269 MIT: MIT (microtubule interacting and transport) d 82.84
PF02064121 MAS20: MAS20 protein import receptor; InterPro: IP 82.7
cd0268075 MIT_calpain7_2 MIT: domain contained within Microt 82.63
KOG0546|consensus372 82.44
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 81.95
cd0268377 MIT_1 MIT: domain contained within Microtubule Int 81.91
KOG2300|consensus 629 81.43
TIGR02561153 HrpB1_HrpK type III secretion protein HrpB1/HrpK. 81.34
COG3629280 DnrI DNA-binding transcriptional activator of the 81.19
COG3118304 Thioredoxin domain-containing protein [Posttransla 81.09
smart0074577 MIT Microtubule Interacting and Trafficking molecu 80.92
cd0268176 MIT_calpain7_1 MIT: domain contained within Microt 80.66
cd0267875 MIT_VPS4 MIT: domain contained within Microtubule 80.51
PF1381234 PPR_3: Pentatricopeptide repeat domain 80.07
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
Probab=99.74  E-value=8.6e-17  Score=105.31  Aligned_cols=109  Identities=15%  Similarity=0.037  Sum_probs=100.2

Q ss_pred             hhhHHHHhhCCHHHHHHHHHHhhccCCCcHHHHHHHHHH-HhhhhccCCCCCchhhhhCChHHHHhhccCCCCCCCCCCh
Q psy3020           2 TTYSCLSYLGRYKESISTYEEGLKLDPNNEQMKEAIKDV-RNQEMNDMNRGDPFANLFSDPNIFVQLQLDPRTKPFLSDP   80 (150)
Q Consensus         2 ~lg~~~~~~~~~~~A~~~~~~aL~~~p~~~~a~~~l~~~-~~~g~~~~~~~~~~~~a~~~~~~~~~l~~~~~~~~~~~~~   80 (150)
                      ..|.++...|++++|+..|++++.++|++..++..+|.+ ..+|        .+.+|+  ..+.+++.++|++       
T Consensus        29 ~~g~~~~~~g~~~~A~~~~~~al~~~P~~~~a~~~lg~~~~~~g--------~~~~A~--~~y~~Al~l~p~~-------   91 (144)
T PRK15359         29 ASGYASWQEGDYSRAVIDFSWLVMAQPWSWRAHIALAGTWMMLK--------EYTTAI--NFYGHALMLDASH-------   91 (144)
T ss_pred             HHHHHHHHcCCHHHHHHHHHHHHHcCCCcHHHHHHHHHHHHHHh--------hHHHHH--HHHHHHHhcCCCC-------
Confidence            368899999999999999999999999999999999999 9999        667788  7888888888865       


Q ss_pred             HHHHHHHHHhcCcchhhhHHHhHHHHHHHHHHHHhcCHHHHHHHHHHHHhhcCCCcchhhcHHHHHHh
Q psy3020          81 SYVQMIKEIQKDPSLMTLEAKISLLKDKGNAALQANNFKEAIEAYSEAIKLDGTNHILFSNRSAAFAK  148 (150)
Q Consensus        81 ~~~~~~~~l~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~n~a~~~~~  148 (150)
                                           +.++.++|.++...|++++|+..|.++++++|+++..+.+++.+...
T Consensus        92 ---------------------~~a~~~lg~~l~~~g~~~eAi~~~~~Al~~~p~~~~~~~~~~~~~~~  138 (144)
T PRK15359         92 ---------------------PEPVYQTGVCLKMMGEPGLAREAFQTAIKMSYADASWSEIRQNAQIM  138 (144)
T ss_pred             ---------------------cHHHHHHHHHHHHcCCHHHHHHHHHHHHHhCCCChHHHHHHHHHHHH
Confidence                                 77899999999999999999999999999999999999999988754



>KOG0553|consensus Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>KOG4626|consensus Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG0548|consensus Back     alignment and domain information
>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG1126|consensus Back     alignment and domain information
>KOG1155|consensus Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>KOG1125|consensus Back     alignment and domain information
>KOG0547|consensus Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>PLN02789 farnesyltranstransferase Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>KOG2002|consensus Back     alignment and domain information
>PRK14574 hmsH outer membrane protein; Provisional Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1156|consensus Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>KOG0553|consensus Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG1173|consensus Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>KOG0543|consensus Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>KOG4648|consensus Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>KOG1129|consensus Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PRK15331 chaperone protein SicA; Provisional Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1174|consensus Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK10866 outer membrane biogenesis protein BamD; Provisional Back     alignment and domain information
>TIGR00540 hemY_coli hemY protein Back     alignment and domain information
>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>KOG1127|consensus Back     alignment and domain information
>KOG1128|consensus Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>KOG1840|consensus Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF13431 TPR_17: Tetratricopeptide repeat Back     alignment and domain information
>PRK10747 putative protoheme IX biogenesis protein; Provisional Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>KOG2003|consensus Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4785 NlpI Lipoprotein NlpI, contains TPR repeats [General function prediction only] Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>KOG0551|consensus Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala Back     alignment and domain information
>KOG3060|consensus Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG0495|consensus Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>KOG4234|consensus Back     alignment and domain information
>PF13512 TPR_18: Tetratricopeptide repeat Back     alignment and domain information
>KOG4642|consensus Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>PRK10803 tol-pal system protein YbgF; Provisional Back     alignment and domain information
>PF12688 TPR_5: Tetratrico peptide repeat Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>KOG1308|consensus Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>KOG4555|consensus Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2376|consensus Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF06552 TOM20_plant: Plant specific mitochondrial import receptor subunit TOM20; InterPro: IPR010547 This family consists of several plant specific mitochondrial import receptor subunit TOM20 (translocase of outer membrane 20 kDa subunit) proteins Back     alignment and domain information
>COG2976 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG0457 NrfG FOG: TPR repeat [General function prediction only] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>COG4105 ComL DNA uptake lipoprotein [General function prediction only] Back     alignment and domain information
>KOG2471|consensus Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>KOG1130|consensus Back     alignment and domain information
>KOG0545|consensus Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>KOG3824|consensus Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>KOG2796|consensus Back     alignment and domain information
>PF02259 FAT: FAT domain; InterPro: IPR003151 The FAT domain is a domain present in the PIK-related kinases Back     alignment and domain information
>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>KOG0376|consensus Back     alignment and domain information
>COG1729 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>KOG4507|consensus Back     alignment and domain information
>KOG3824|consensus Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>KOG3785|consensus Back     alignment and domain information
>KOG4340|consensus Back     alignment and domain information
>PF03704 BTAD: Bacterial transcriptional activator domain; InterPro: IPR005158 Found in the DNRI/REDD/AFSR family of regulators, this region of AFSR (P25941 from SWISSPROT) along with the C-terminal region is capable of independently directing actinorhodin production Back     alignment and domain information
>PF04184 ST7: ST7 protein; InterPro: IPR007311 The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumour suppressor gene Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>KOG0551|consensus Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF14561 TPR_20: Tetratricopeptide repeat; PDB: 3QOU_A 2R5S_A 3QDN_B Back     alignment and domain information
>PF13281 DUF4071: Domain of unknown function (DUF4071) Back     alignment and domain information
>PF10516 SHNi-TPR: SHNi-TPR; InterPro: IPR019544 The tetratrico peptide repeat region (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function Back     alignment and domain information
>KOG3081|consensus Back     alignment and domain information
>COG4649 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF07720 TPR_3: Tetratricopeptide repeat; InterPro: IPR011716 This entry includes tetratricopeptide-like repeats found in the LcrH/SycD-like chaperones [] Back     alignment and domain information
>PRK10941 hypothetical protein; Provisional Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>KOG2610|consensus Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF07721 TPR_4: Tetratricopeptide repeat; InterPro: IPR011717 This entry includes tetratricopeptide-like repeats not detected by the IPR001440 from INTERPRO, IPR013105 from INTERPRO and IPR011716 from INTERPRO models Back     alignment and domain information
>KOG2396|consensus Back     alignment and domain information
>KOG3364|consensus Back     alignment and domain information
>PF05843 Suf: Suppressor of forked protein (Suf); InterPro: IPR008847 This domain consists of several eukaryotic suppressor of forked (Suf) like proteins Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>KOG1915|consensus Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>KOG1586|consensus Back     alignment and domain information
>TIGR03504 FimV_Cterm FimV C-terminal domain Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>smart00386 HAT HAT (Half-A-TPR) repeats Back     alignment and domain information
>KOG1308|consensus Back     alignment and domain information
>KOG0530|consensus Back     alignment and domain information
>PF07079 DUF1347: Protein of unknown function (DUF1347); InterPro: IPR010764 This family consists of several hypothetical bacterial proteins of around 610 residues in length Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>KOG3364|consensus Back     alignment and domain information
>COG4700 Uncharacterized protein conserved in bacteria containing a divergent form of TPR repeats [Function unknown] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PHA02537 M terminase endonuclease subunit; Provisional Back     alignment and domain information
>PF12968 DUF3856: Domain of Unknown Function (DUF3856); InterPro: IPR024552 This domain of unknown function is found in a small group of tetratricopeptide-like proteins, which includes the uncharacterised protein Q8KAL8 from SWISSPROT Back     alignment and domain information
>COG3914 Spy Predicted O-linked N-acetylglucosamine transferase, SPINDLY family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0529|consensus Back     alignment and domain information
>PF01535 PPR: PPR repeat; InterPro: IPR002885 This entry represents the PPR repeat Back     alignment and domain information
>KOG2471|consensus Back     alignment and domain information
>PF14863 Alkyl_sulf_dimr: Alkyl sulfatase dimerisation; PDB: 2YHE_C 2CG2_A 2CG3_A 2CFU_A 2CFZ_A Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>PF04781 DUF627: Protein of unknown function (DUF627); InterPro: IPR006866 This domain represents the N-terminal region of several plant proteins of unknown function Back     alignment and domain information
>PF04910 Tcf25: Transcriptional repressor TCF25; InterPro: IPR006994 This entry appears to represent a novel family of basic helix-loop-helix (bHLH) proteins that control differentiation and development of a variety of organs [, ] Back     alignment and domain information
>KOG2053|consensus Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>cd02682 MIT_AAA_Arch MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF12854 PPR_1: PPR repeat Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>PF08424 NRDE-2: NRDE-2, necessary for RNA interference; InterPro: IPR013633 This is domain is found in eukaryotic proteins of unknown function Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans Back     alignment and domain information
>PF01239 PPTA: Protein prenyltransferase alpha subunit repeat; InterPro: IPR002088 Protein prenylation is the posttranslational attachment of either a farnesyl group or a geranylgeranyl group via a thioether linkage (-C-S-C-) to a cysteine at or near the carboxyl terminus of the protein Back     alignment and domain information
>PF13041 PPR_2: PPR repeat family Back     alignment and domain information
>KOG1550|consensus Back     alignment and domain information
>PF12862 Apc5: Anaphase-promoting complex subunit 5 Back     alignment and domain information
>TIGR00756 PPR pentatricopeptide repeat domain (PPR motif) Back     alignment and domain information
>COG5191 Uncharacterized conserved protein, contains HAT (Half-A-TPR) repeat [General function prediction only] Back     alignment and domain information
>COG2912 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG4814|consensus Back     alignment and domain information
>PF02064 MAS20: MAS20 protein import receptor; InterPro: IPR002056 Virtually all mitochondrial precursors are imported via the same mechanism []: precursors first bind to receptors on the mitochondrial surface, then insert into the translocation channel in the outer membrane Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>PF15015 NYD-SP12_N: Spermatogenesis-associated, N-terminal Back     alignment and domain information
>KOG1070|consensus Back     alignment and domain information
>KOG4507|consensus Back     alignment and domain information
>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome Back     alignment and domain information
>KOG1585|consensus Back     alignment and domain information
>PF09613 HrpB1_HrpK: Bacterial type III secretion protein (HrpB1_HrpK); InterPro: IPR013394 This family of proteins is encoded by genes found within type III secretion operons in a limited range of species including Xanthomonas, Ralstonia and Burkholderia Back     alignment and domain information
>KOG3616|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>KOG0985|consensus Back     alignment and domain information
>PF04212 MIT: MIT (microtubule interacting and transport) domain; InterPro: IPR007330 The MIT domain is found in vacuolar sorting proteins, spastin (probable ATPase involved in the assembly or function of nuclear protein complexes), and a sorting nexin, which may play a role in intracellular trafficking Back     alignment and domain information
>PF02064 MAS20: MAS20 protein import receptor; InterPro: IPR002056 Virtually all mitochondrial precursors are imported via the same mechanism []: precursors first bind to receptors on the mitochondrial surface, then insert into the translocation channel in the outer membrane Back     alignment and domain information
>cd02680 MIT_calpain7_2 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG0546|consensus Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>cd02683 MIT_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>KOG2300|consensus Back     alignment and domain information
>TIGR02561 HrpB1_HrpK type III secretion protein HrpB1/HrpK Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00745 MIT Microtubule Interacting and Trafficking molecule domain Back     alignment and domain information
>cd02681 MIT_calpain7_1 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>cd02678 MIT_VPS4 MIT: domain contained within Microtubule Interacting and Trafficking molecules Back     alignment and domain information
>PF13812 PPR_3: Pentatricopeptide repeat domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
1elw_A118 Crystal Structure Of The Tpr1 Domain Of Hop In Comp 1e-10
2vyi_A131 Crystal Structure Of The Tpr Domain Of Human Sgt Le 1e-04
2lni_A133 Solution Nmr Structure Of Stress-Induced-Phosphopro 3e-04
4gco_A126 Central Domain Of Stress-Induced Protein-1 (Sti-1) 8e-04
>pdb|1ELW|A Chain A, Crystal Structure Of The Tpr1 Domain Of Hop In Complex With A Hsc70 Peptide Length = 118 Back     alignment and structure

Iteration: 1

Score = 61.6 bits (148), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 28/48 (58%), Positives = 38/48 (79%) Query: 101 KISLLKDKGNAALQANNFKEAIEAYSEAIKLDGTNHILFSNRSAAFAK 148 +++ LK+KGN AL N +A++ YSEAIKLD NH+L+SNRSAA+AK Sbjct: 3 QVNELKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAK 50
>pdb|2VYI|A Chain A, Crystal Structure Of The Tpr Domain Of Human Sgt Length = 131 Back     alignment and structure
>pdb|2LNI|A Chain A, Solution Nmr Structure Of Stress-Induced-Phosphoprotein 1 Sti1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4403e Length = 133 Back     alignment and structure
>pdb|4GCO|A Chain A, Central Domain Of Stress-Induced Protein-1 (Sti-1) From C.Elegans Length = 126 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query150
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 2e-17
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 1e-07
3sz7_A 164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 5e-16
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 6e-05
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 5e-16
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 1e-06
3q49_B137 STIP1 homology and U box-containing protein 1; E3 4e-15
1a17_A 166 Serine/threonine protein phosphatase 5; hydrolase, 4e-15
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 1e-05
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 4e-15
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 3e-06
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 4e-15
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 2e-06
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 8e-15
2l6j_A111 TPR repeat-containing protein associated with HSP; 1e-14
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 2e-13
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 2e-13
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 5e-13
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 4e-05
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 2e-12
2llv_A71 Heat shock protein STI1; DP domain, alpha helix, c 2e-12
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 7e-12
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 5e-09
3uq3_A 258 Heat shock protein STI1; HSP90, peptide binding, c 1e-05
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-08
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 5e-08
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-07
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 9e-07
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 2e-05
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 3e-04
2gw1_A 514 Mitochondrial precursor proteins import receptor; 1e-08
2gw1_A 514 Mitochondrial precursor proteins import receptor; 8e-05
2gw1_A514 Mitochondrial precursor proteins import receptor; 1e-04
2gw1_A 514 Mitochondrial precursor proteins import receptor; 3e-04
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-08
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 2e-08
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 6e-07
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 9e-07
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 4e-05
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 5e-05
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 3e-08
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 6e-08
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 3e-04
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 3e-05
3u4t_A272 TPR repeat-containing protein; structural genomics 5e-05
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 6e-05
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 7e-05
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 9e-05
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 1e-04
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-04
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 8e-04
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
 Score = 72.2 bits (178), Expect = 2e-17
 Identities = 28/44 (63%), Positives = 35/44 (79%)

Query: 105 LKDKGNAALQANNFKEAIEAYSEAIKLDGTNHILFSNRSAAFAK 148
           LK+KGN AL   N  +A++ YSEAIKLD  NH+L+SNRSAA+AK
Sbjct: 7   LKEKGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAK 50


>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Length = 118 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Length = 164 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Length = 126 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Length = 137 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Length = 166 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Length = 131 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Length = 126 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Length = 111 Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Length = 281 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Length = 131 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 148 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Length = 127 Back     alignment and structure
>2llv_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Length = 477 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Length = 258 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Length = 514 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Length = 359 Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Length = 597 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Length = 537 Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Length = 368 Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Length = 272 Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Length = 365 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Length = 568 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Length = 336 Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Length = 198 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Length = 162 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Length = 388 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.86
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.83
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.81
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 99.78
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.77
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.77
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.77
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.76
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.76
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.75
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.74
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 99.73
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.73
2h6f_A 382 Protein farnesyltransferase/geranylgeranyltransfer 99.72
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.72
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.71
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.71
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 99.71
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.7
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.7
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.68
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 99.68
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 99.67
4i17_A228 Hypothetical protein; TPR repeats protein, structu 99.67
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.67
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 99.65
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 99.64
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 99.64
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 99.63
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.63
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.63
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.62
4eqf_A 365 PEX5-related protein; accessory protein, tetratric 99.62
3u4t_A 272 TPR repeat-containing protein; structural genomics 99.61
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.61
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.6
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.6
1w3b_A 388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.6
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.59
1fch_A 368 Peroxisomal targeting signal 1 receptor; protein-p 99.59
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 99.59
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.59
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.58
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 99.58
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 99.58
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 99.58
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.58
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 99.57
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.57
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 99.57
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 99.57
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 99.57
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.56
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 99.56
4eqf_A365 PEX5-related protein; accessory protein, tetratric 99.56
3u4t_A272 TPR repeat-containing protein; structural genomics 99.56
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.56
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.56
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 99.55
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.55
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 99.55
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 99.55
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.55
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 99.55
3k9i_A117 BH0479 protein; putative protein binding protein, 99.55
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.54
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.54
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 99.54
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 99.53
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.53
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 99.53
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.53
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 99.53
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 99.52
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.52
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 99.52
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 99.52
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.52
3ieg_A 359 DNAJ homolog subfamily C member 3; TPR motif, chap 99.51
3hym_B 330 Cell division cycle protein 16 homolog; APC, anaph 99.51
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.51
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 99.5
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.5
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.49
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.48
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 99.48
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 99.45
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 99.44
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.44
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 99.44
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.43
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 99.43
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 99.43
1xnf_A 275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 99.42
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 99.41
4g1t_A 472 Interferon-induced protein with tetratricopeptide 99.41
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 99.4
2xpi_A 597 Anaphase-promoting complex subunit CUT9; cell cycl 99.39
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.39
3fp2_A 537 TPR repeat-containing protein YHR117W; TOM71, mito 99.38
2gw1_A 514 Mitochondrial precursor proteins import receptor; 99.36
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 99.35
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.35
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 99.35
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.32
2l6j_A111 TPR repeat-containing protein associated with HSP; 99.31
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 99.3
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 99.29
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 99.29
2kat_A115 Uncharacterized protein; NESG, structure, structur 99.28
1qqe_A 292 Vesicular transport protein SEC17; helix-turn-heli 99.27
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.26
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 99.26
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 99.23
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.23
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 99.22
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.22
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 99.22
3q49_B137 STIP1 homology and U box-containing protein 1; E3 99.22
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.22
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.21
3ulq_A 383 Response regulator aspartate phosphatase F; tetrat 99.21
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 99.21
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 99.19
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 99.19
1ouv_A 273 Conserved hypothetical secreted protein; TPR repea 99.19
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.17
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 99.17
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 99.16
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 99.16
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 99.16
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 99.16
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 99.15
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 99.15
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 99.14
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 99.14
1dce_A 567 Protein (RAB geranylgeranyltransferase alpha subun 99.14
3dra_A 306 Protein farnesyltransferase/geranylgeranyltransfer 99.14
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 99.13
3dra_A306 Protein farnesyltransferase/geranylgeranyltransfer 99.13
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 99.13
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 99.11
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 99.1
3nf1_A 311 KLC 1, kinesin light chain 1; TPR, structural geno 99.09
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 99.09
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 99.08
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 99.08
2ifu_A 307 Gamma-SNAP; membrane fusion, snare complex disasse 99.08
3sf4_A 406 G-protein-signaling modulator 2; tetratricopeptide 99.07
4a1s_A 411 PINS, partner of inscuteable; cell cycle, LGN, mit 99.07
3q7a_A 349 Farnesyltransferase alpha subunit; protein prenylt 99.07
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.05
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 99.05
3rjv_A212 Putative SEL1 repeat protein; alpha-alpha superhel 99.04
3q15_A 378 PSP28, response regulator aspartate phosphatase H; 99.04
3dss_A 331 Geranylgeranyl transferase type-2 subunit alpha; p 99.04
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 99.04
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 99.03
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 99.02
3u3w_A293 Transcriptional activator PLCR protein; ternary co 99.01
3ro2_A 338 PINS homolog, G-protein-signaling modulator 2; TPR 99.0
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 98.99
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.99
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 98.99
3q7a_A349 Farnesyltransferase alpha subunit; protein prenylt 98.98
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 98.97
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.96
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 98.94
2r5s_A176 Uncharacterized protein VP0806; APC090868.1, vibri 98.94
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 98.93
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 98.91
3qou_A287 Protein YBBN; thioredoxin-like fold, tetratricopep 98.89
3k9i_A117 BH0479 protein; putative protein binding protein, 98.89
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 98.88
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.88
1zu2_A158 Mitochondrial import receptor subunit TOM20-3; TPR 98.87
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 98.86
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 98.85
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.82
2kat_A115 Uncharacterized protein; NESG, structure, structur 98.8
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 98.77
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 98.77
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.73
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 98.69
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 98.68
1pc2_A152 Mitochondria fission protein; unknown function; NM 98.67
2l6j_A111 TPR repeat-containing protein associated with HSP; 98.67
4f3v_A282 ESX-1 secretion system protein ECCA1; tetratricope 98.67
3e4b_A 452 ALGK; tetratricopeptide repeat, superhelix, algina 98.66
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 98.65
3e4b_A452 ALGK; tetratricopeptide repeat, superhelix, algina 98.63
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.62
2xm6_A490 Protein corresponding to locus C5321 from CFT073 s 98.61
1hz4_A 373 MALT regulatory protein; two-helix bundles, helix 98.6
2xm6_A 490 Protein corresponding to locus C5321 from CFT073 s 98.56
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 98.49
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.48
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 98.46
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.39
1klx_A138 Cysteine rich protein B; structural genomics, heli 98.38
3qww_A433 SET and MYND domain-containing protein 2; methyltr 98.35
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.34
3bee_A93 Putative YFRE protein; putaive YFRE protein, struc 98.29
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 98.28
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 98.21
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 98.18
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 98.12
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 98.04
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 98.01
1b89_A 449 Protein (clathrin heavy chain); triskelion, coated 97.99
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 97.91
3u64_A301 Protein TP_0956; tetratrico peptide repeat, protei 97.8
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 97.56
1pc2_A152 Mitochondria fission protein; unknown function; NM 97.5
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 97.1
3qww_A433 SET and MYND domain-containing protein 2; methyltr 97.04
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.86
3ly7_A372 Transcriptional activator CADC; alpha/beta domain, 96.83
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.82
1y8m_A144 FIS1; mitochondria, unknown function; NMR {Sacchar 96.67
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 96.54
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 96.39
4e6h_A 679 MRNA 3'-END-processing protein RNA14; HAT domain, 96.16
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 96.12
1zbp_A 273 Hypothetical protein VPA1032; alpha-beta protein, 95.85
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 95.39
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 94.62
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 93.6
3ffl_A167 Anaphase-promoting complex subunit 7; tetratricope 92.98
3txn_A 394 26S proteasome regulatory complex subunit P42B; PC 92.36
3ax2_A73 Mitochondrial import receptor subunit TOM20 homol; 92.33
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 91.99
3mkq_B177 Coatomer subunit alpha; beta-propeller, alpha-sole 91.9
4g26_A 501 Pentatricopeptide repeat-containing protein AT2G3 91.64
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 91.59
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 91.58
2uy1_A 493 Cleavage stimulation factor 77; RNA-binding protei 91.4
3ax2_A73 Mitochondrial import receptor subunit TOM20 homol; 90.9
1ya0_A 497 SMG-7 transcript variant 2; alpha-helical repeat, 90.75
4b4t_R 429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 89.79
2ff4_A388 Probable regulatory protein EMBR; winged-helix, te 89.54
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 88.58
1om2_A95 Protein (mitochondrial import receptor subunit TOM 88.26
3t5x_A 203 PCI domain-containing protein 2; PCI, mRNA nuclear 87.91
4a5x_A86 MITD1, MIT domain-containing protein 1; protein tr 87.54
1om2_A95 Protein (mitochondrial import receptor subunit TOM 87.36
4gns_B 754 Protein CSD3, chitin biosynthesis protein CHS6; FN 86.97
4b4t_P 445 26S proteasome regulatory subunit RPN5; hydrolase, 86.79
2w2u_A83 Hypothetical P60 katanin; hydrolase transport comp 86.25
2v6y_A83 AAA family ATPase, P60 katanin; MIT, VPS4, archaea 84.41
2llv_A71 Heat shock protein STI1; DP domain, alpha helix, c 83.75
2rpa_A78 Katanin P60 ATPase-containing subunit A1; AAA ATPa 82.36
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, te 81.9
2v6x_A85 Vacuolar protein sorting-associated protein 4; pro 81.61
2crb_A97 Nuclear receptor binding factor 2; NRBF-2, MIT dom 81.36
4h7y_A161 Dual specificity protein kinase TTK; mitotic check 80.85
1wfd_A93 Hypothetical protein 1500032H18; MIT domain, struc 80.22
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
Probab=99.86  E-value=6e-21  Score=121.22  Aligned_cols=107  Identities=18%  Similarity=0.238  Sum_probs=99.8

Q ss_pred             hhhHHHHhhCCHHHHHHHHHHhhccCCCcHHHHHHHHHH-HhhhhccCCCCCchhhhhCChHHHHhhccCCCCCCCCCCh
Q psy3020           2 TTYSCLSYLGRYKESISTYEEGLKLDPNNEQMKEAIKDV-RNQEMNDMNRGDPFANLFSDPNIFVQLQLDPRTKPFLSDP   80 (150)
Q Consensus         2 ~lg~~~~~~~~~~~A~~~~~~aL~~~p~~~~a~~~l~~~-~~~g~~~~~~~~~~~~a~~~~~~~~~l~~~~~~~~~~~~~   80 (150)
                      ..|.+|++.|+|++|+++|++||+++|+++.++..+|.+ ..+|        ++.+|+  ..+.+++.++|++       
T Consensus        18 ~~G~~~~~~g~~~~A~~~~~~al~~~p~~~~~~~~~~~~~~~~~--------~~~~A~--~~~~~al~~~p~~-------   80 (126)
T 4gco_A           18 NKGNEYFKKGDYPTAMRHYNEAVKRDPENAILYSNRAACLTKLM--------EFQRAL--DDCDTCIRLDSKF-------   80 (126)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHTT--------CHHHHH--HHHHHHHHHCTTC-------
T ss_pred             HHHHHHHHcCCHHHHHHHHHHHHHhCCCCHHHHHHHhhHHHhhc--------cHHHHH--HHHHHHHHhhhhh-------
Confidence            479999999999999999999999999999999999999 9999        778888  8888888888864       


Q ss_pred             HHHHHHHHHhcCcchhhhHHHhHHHHHHHHHHHHhcCHHHHHHHHHHHHhhcCCCcchhhcHHHHH
Q psy3020          81 SYVQMIKEIQKDPSLMTLEAKISLLKDKGNAALQANNFKEAIEAYSEAIKLDGTNHILFSNRSAAF  146 (150)
Q Consensus        81 ~~~~~~~~l~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~n~a~~~  146 (150)
                                           +.+|..+|.++...|++++|+++|+++++++|+++.++.+++.|+
T Consensus        81 ---------------------~~a~~~lg~~~~~~~~~~~A~~~~~~al~l~P~~~~a~~~l~~~l  125 (126)
T 4gco_A           81 ---------------------IKGYIRKAACLVAMREWSKAQRAYEDALQVDPSNEEAREGVRNCL  125 (126)
T ss_dssp             ---------------------HHHHHHHHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHC
T ss_pred             ---------------------hHHHHHHHHHHHHCCCHHHHHHHHHHHHHHCcCCHHHHHHHHHhc
Confidence                                 778999999999999999999999999999999999999998874



>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>3dra_A Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha; geranylgeranyltrasferase, ggtase, ggtase-I, PGGT, prenyltransferase, farnesyltransferase; HET: B3P GRG; 1.80A {Candida albicans} Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3dss_A Geranylgeranyl transferase type-2 subunit alpha; protein prenylation, metal-binding, prenyltransferase, zinc, phosphoprotein; 1.80A {Rattus norvegicus} PDB: 3dst_A* 3dsu_A* 3dsv_A* 3dsw_A* 3dsx_A* 3hxb_A* 3hxc_A* 3hxd_A* 3hxe_A* 3hxf_A* 3pz1_A* 3pz2_A* 3pz3_A* 3c72_A* 4gtv_A* 4gts_A* 4ehm_A* 4gtt_A* Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3q7a_A Farnesyltransferase alpha subunit; protein prenyltransferase, transferase-transferase inhibitor; HET: SUC 3FX FPP 778; 2.00A {Cryptococcus neoformans} PDB: 3q73_A* 3q78_A* 3q79_A* 3q75_A* 3q7f_A* 3sfx_A* 3sfy_A* Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1 Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli} Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A* Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>1y8m_A FIS1; mitochondria, unknown function; NMR {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>4e6h_A MRNA 3'-END-processing protein RNA14; HAT domain, heat repeat, CLP1, PCF11, structural protein; 2.30A {Kluyveromyces lactis} PDB: 4e85_A 4eba_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>1zbp_A Hypothetical protein VPA1032; alpha-beta protein, structural genomics, PSI, protein struct initiative; 2.40A {Vibrio parahaemolyticus} SCOP: e.61.1.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>3mkq_B Coatomer subunit alpha; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4g26_A Pentatricopeptide repeat-containing protein AT2G3 mitochondrial; metallonuclease, prorp, ribonuclease, PIN, tRNA processing, NYN domain; 1.75A {Arabidopsis thaliana} PDB: 4g23_A* 4g25_A 4g24_A Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>2uy1_A Cleavage stimulation factor 77; RNA-binding protein; 2.0A {Encephalitozoon cuniculi} PDB: 2uy1_B Back     alignment and structure
>3ax2_A Mitochondrial import receptor subunit TOM20 homol; protein-protein complex, membrane protein-transport protein; 1.90A {Rattus norvegicus} PDB: 2v1s_A 3awr_A 2v1t_A 3ax5_A 3ax3_A Back     alignment and structure
>1ya0_A SMG-7 transcript variant 2; alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3, signaling protein; 2.55A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure
>1om2_A Protein (mitochondrial import receptor subunit TOM20); mitochondrial protein import across outer membrane, receptor for presequences; NMR {Rattus norvegicus} SCOP: a.23.4.1 Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Back     alignment and structure
>4a5x_A MITD1, MIT domain-containing protein 1; protein transport, ESCRT, cytokinesis, midbody; HET: P15; 1.91A {Homo sapiens} Back     alignment and structure
>1om2_A Protein (mitochondrial import receptor subunit TOM20); mitochondrial protein import across outer membrane, receptor for presequences; NMR {Rattus norvegicus} SCOP: a.23.4.1 Back     alignment and structure
>4gns_B Protein CSD3, chitin biosynthesis protein CHS6; FN3, BRCT, tetratricopeptide repeat, cargo adaptor, transpor; HET: EPE; 2.75A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2w2u_A Hypothetical P60 katanin; hydrolase transport complex, nucleotide-binding, ESCRT, AAA-ATPase, cytokinesis, ATP-binding; 2.20A {Sulfolobus acidocaldarius} Back     alignment and structure
>2v6y_A AAA family ATPase, P60 katanin; MIT, VPS4, archaea, AAA-ATPase, ATP-binding, microtubule INT and trafficking domain, nucleotide-binding; HET: SRT; 2.40A {Sulfolobus solfataricus} PDB: 2v6y_B* Back     alignment and structure
>2llv_A Heat shock protein STI1; DP domain, alpha helix, chaperone; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2rpa_A Katanin P60 ATPase-containing subunit A1; AAA ATPase, ATP-binding, cell cycle, cell division, cytoplas hydrolase, microtubule; NMR {Mus musculus} Back     alignment and structure
>2ff4_A Probable regulatory protein EMBR; winged-helix, tetratricopeptide repeat, beta-sandwich, trans; HET: DNA TPO; 1.90A {Mycobacterium tuberculosis} SCOP: a.4.6.1 a.118.8.3 b.26.1.2 PDB: 2fez_A* Back     alignment and structure
>2v6x_A Vacuolar protein sorting-associated protein 4; protein transport, vacuole, endosome, transport, ESCRT-III, VPS2, VPS4, SKD1, VPS4B, VPS4A; 1.98A {Saccharomyces cerevisiae} Back     alignment and structure
>2crb_A Nuclear receptor binding factor 2; NRBF-2, MIT domain, helix bundle, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.7.16.1 Back     alignment and structure
>4h7y_A Dual specificity protein kinase TTK; mitotic checkpoint kinase, chromosome instability, cancer, tetratricopeptide repeat (TPR) motif; 1.80A {Homo sapiens} PDB: 4h7x_A Back     alignment and structure
>1wfd_A Hypothetical protein 1500032H18; MIT domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.7.14.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 150
d1w3ba_388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 6e-06
d1w3ba_ 388 a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, 0.001
d2c2la1 201 a.118.8.1 (A:24-224) STIP1 homology and U box-cont 4e-05
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 2e-04
d1elwa_117 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 0.002
d1fcha_ 323 a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting 4e-04
d1zbpa1 264 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {V 0.001
d1elra_128 a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9 0.002
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: O-GlcNAc transferase p110 subunit, OGT
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 42.4 bits (98), Expect = 6e-06
 Identities = 21/144 (14%), Positives = 46/144 (31%), Gaps = 3/144 (2%)

Query: 5   SCLSYLGRYKESISTYEEGLKLDPNNEQMKEAIKDVRNQEMNDMNRGDPFANLFSDPNIF 64
                 G    +I TY   ++L P+       + +   +E   +   +   N        
Sbjct: 245 CVYYEQGLIDLAIDTYRRAIELQPHFPDAYCNLANAL-KEKGSVAEAEDCYNTALRLCPT 303

Query: 65  VQLQLDPRTKPFLSDPSYVQMIKEIQKDPSLMTLEAKISLLKDKGNAALQANNFKEAIEA 124
               L+          +  + ++  +K  +L       +   +  +   Q    +EA+  
Sbjct: 304 HADSLNNLANIKREQGNIEEAVRLYRK--ALEVFPEFAAAHSNLASVLQQQGKLQEALMH 361

Query: 125 YSEAIKLDGTNHILFSNRSAAFAK 148
           Y EAI++  T    +SN      +
Sbjct: 362 YKEAIRISPTFADAYSNMGNTLKE 385


>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 201 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Length = 264 Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Length = 128 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query150
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.78
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 99.78
d1xnfa_ 259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.74
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 99.74
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.72
d2h6fa1 315 Protein farnesyltransferase alpha-subunit {Human ( 99.7
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 99.7
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.69
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.64
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.63
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.62
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.62
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.6
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.59
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 99.57
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.57
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 99.57
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 99.57
d1w3ba_ 388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 99.51
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 99.43
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 99.41
d1dcea1334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.41
d2c2la1 201 STIP1 homology and U box-containing protein 1, STU 99.31
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 99.27
d1dcea1 334 Rab geranylgeranyltransferase alpha-subunit, N-ter 99.26
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.25
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 99.18
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 99.17
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 99.16
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.16
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 99.12
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 99.1
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 99.08
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 99.06
d1ya0a1 497 SMG-7 {Human (Homo sapiens) [TaxId: 9606]} 99.03
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.95
d1zu2a1145 Mitochondrial import receptor subunit tom20-3 {Tha 98.9
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.87
d1hz4a_ 366 Transcription factor MalT domain III {Escherichia 98.8
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 98.68
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 98.65
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 98.51
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.48
d2ff4a2179 Probable regulatory protein EmbR, middle domain {M 98.42
d1hz4a_366 Transcription factor MalT domain III {Escherichia 98.29
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.28
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 98.27
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 98.25
d1zbpa1 264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 97.95
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 97.88
d1ouva_ 265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.83
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 97.33
d1ouva_265 Cysteine rich protein C (HcpC) {Helicobacter pylor 97.11
d1klxa_133 Cysteine rich protein B (HcpB) {Helicobacter pylor 96.92
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 92.49
d2crba183 Nuclear receptor binding factor 2, NRBF2, N-termin 91.11
d1wfda_93 Hypothetical protein 1500032H18Rik {Mouse (Mus mus 88.05
d1b89a_ 336 Clathrin heavy chain proximal leg segment {Cow (Bo 87.2
d1om2a_95 Mitochondrial import receptor subunit Tom20 {Rat ( 86.78
d1om2a_95 Mitochondrial import receptor subunit Tom20 {Rat ( 86.57
d2cfua2505 Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxI 81.33
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Hop
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.82  E-value=1.6e-19  Score=111.84  Aligned_cols=107  Identities=21%  Similarity=0.249  Sum_probs=99.7

Q ss_pred             hhHHHHhhCCHHHHHHHHHHhhccCCCcHHHHHHHHHH-HhhhhccCCCCCchhhhhCChHHHHhhccCCCCCCCCCChH
Q psy3020           3 TYSCLSYLGRYKESISTYEEGLKLDPNNEQMKEAIKDV-RNQEMNDMNRGDPFANLFSDPNIFVQLQLDPRTKPFLSDPS   81 (150)
Q Consensus         3 lg~~~~~~~~~~~A~~~~~~aL~~~p~~~~a~~~l~~~-~~~g~~~~~~~~~~~~a~~~~~~~~~l~~~~~~~~~~~~~~   81 (150)
                      .|..++..|+|++|+..|+++|+++|+++.++..+|.+ ..+|        ++.+|+  ..+.+++.++|++        
T Consensus         9 ~g~~~~~~g~~~eAi~~~~~al~~~p~~~~~~~~~a~~~~~~~--------~~~~A~--~~~~~al~~~p~~--------   70 (117)
T d1elwa_           9 KGNKALSVGNIDDALQCYSEAIKLDPHNHVLYSNRSAAYAKKG--------DYQKAY--EDGCKTVDLKPDW--------   70 (117)
T ss_dssp             HHHHHHHTTCHHHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHT--------CHHHHH--HHHHHHHHHCTTC--------
T ss_pred             HHHHHHHcCCHHHHHHHHHHHHhcCCcchhhhhcccccccccc--------cccccc--hhhhhHHHhccch--------
Confidence            58999999999999999999999999999999999999 9999        778888  8888888888864        


Q ss_pred             HHHHHHHHhcCcchhhhHHHhHHHHHHHHHHHHhcCHHHHHHHHHHHHhhcCCCcchhhcHHHHHH
Q psy3020          82 YVQMIKEIQKDPSLMTLEAKISLLKDKGNAALQANNFKEAIEAYSEAIKLDGTNHILFSNRSAAFA  147 (150)
Q Consensus        82 ~~~~~~~l~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~A~~~~~~al~~~p~~~~~~~n~a~~~~  147 (150)
                                          +.+|..+|.++..+|++++|+.+|+++++++|+++.++.+++.+..
T Consensus        71 --------------------~~~~~~~g~~~~~~~~~~~A~~~~~~a~~~~p~~~~~~~~l~~l~~  116 (117)
T d1elwa_          71 --------------------GKGYSRKAAALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEA  116 (117)
T ss_dssp             --------------------HHHHHHHHHHHHHTTCHHHHHHHHHHHHTTCTTCHHHHHHHHHHHH
T ss_pred             --------------------hhHHHHHHHHHHHccCHHHHHHHHHHHHHhCCCCHHHHHHHHHHhC
Confidence                                7789999999999999999999999999999999999999988754



>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crba1 a.7.16.1 (A:8-90) Nuclear receptor binding factor 2, NRBF2, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wfda_ a.7.14.1 (A:) Hypothetical protein 1500032H18Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1b89a_ a.118.1.3 (A:) Clathrin heavy chain proximal leg segment {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1om2a_ a.23.4.1 (A:) Mitochondrial import receptor subunit Tom20 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1om2a_ a.23.4.1 (A:) Mitochondrial import receptor subunit Tom20 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2cfua2 d.157.1.13 (A:20-524) Alkylsulfatase SdsA1 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure