Psyllid ID: psy307


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------102
MLELQDYGGSSSESDAESQTLHLKPIESCAFSVAKSLSVCATPAVIPKVMESSNLTDVNTKEITKNLRYEELYAPEYGPVNPFLTQQQRADKNTLSGFVEQAHINSFQFENQRRTFASYGYALDPSSEVESKVIGASTSGDKNKTVFESTSKRPLDKRKRNRNDCPEDIEGFLGPFENQRRTFASYGYALDPSSEVESKVIGASMSGDKNKTVFESTSKRPLDKRKRNRNDCPEDIEGFLGPWGGYTDEEKVSRPNEAQAAELEEYLAKKQKKGKQSEEKPLEEKTILHIKDPTDYQGRSFLHPPHDVGTNLRSDTPPDRCFLPKTQVHTWEGHTKGISAIRWFPKSAHLLLSCSMDCRVKLWEVYKERRCVRTYYGHRQAVRDICFNNTGTNFISAIRWFPKSAHLLLSCSMDCRVKLWEVYKEHRCVRTYYGHRQAVRDICFNNTGTNFISAGYDRYLKLWDTESGECISRFTSRKVAYCVKFHPDEDKQHLDIPVDMKYIADPTMHSMPAVTSSPNNKWLACQSMDNKILIFSALNRFKLNRKKTFEGHMVAGYACSLDFSPDMSYLISGDADGKCYIWDWKTTKLFKKWKAHDGVCISTLWHPHEPSKVVTAGWDAATAKVQDANIVKIAVEMEKQVPQLYQFNQTLTLSSIIQEICSGWSLSDSEQYALQFSETNNKNYITEKNRNEIKNGSVLRLAFSASKTADDILSKLSDKNASLEEKTAAEFYCICIVLLNKTWKEMRATTEDFVKVFSVVREQITRALSSQPASLDKFRANISRLTYSEITNLWQQERTSREEWESHAKPIVELKELITPEIVDLIQQQRLGYLVEGTRFTKYSSRGQVVLENSCRADEHECPFGRTSVELVKHLCEILRIGDAPSEQGVNYHPMFFTHDHPFEEFYCICIVLLNKTWKEMRATTEDFVKVVLENSCRADEHECPFGRTSVELVKHLCEILRIGDAPSEQGVNYHPMFFTHDHPFEEFYCICIVLLNKTWKEMRATTEDFVKCKSSPAL
cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccHHHcccccccccccccHHHHHccccccccEEccccccHHHHHHHHHHHHHcccccccccccccccccccccccccccEEcccccccHHHHHccccccccccccccccHHHHHHcccccccccccccHHccccccccccccccccccccccccHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccEEEEEccccccEEEEEEEcccccccccccccccccEEcccccEEEcccccccEEEEEEcccccEEEEEEcccccEEEEEcccccEEEEEcccccccEEEEEEcccccccccEEEcccccccEEEEEEccccEEEEEcccccEEEEEcccccccEEEEEEcccccEEEEEEccccEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEccccEEEEEccccccccEEEEcccccEEEEEEccccEEEEEcccccEEcccccEEcccccccEEEEEEcccccEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEEcccccccEEEEEccccEEEEEcccccEEEEEccccccEEEcccccEEEEEEccccEEEEEccccccEEEEEEEccccEEEEcccccEEEEccEEEEEEEcccccccEEEEEccccEEEEEcccccEEEEEEEEEcccccEEEEEEccccEEEEcccccEEEEcccccccHHHcccEEEEEcccccEEccccccccHHHHccccHHHHHHHHHcccHHHHHHHHHHccEEEEcEEEEEEccccEEEEEcccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEEEEHHHHHHHHHcHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEEEEHHHHHHHHHcccccccccccccc
ccHHHcccccccccccccccccccccccccccHcHHHHHcccccccccccccccccccccEEEEccccHHHHccccccccccccHHHHHcccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccEEEEccccccccccEcccccccccccccccEEEEcccccccccHccccccccEEEcccccccccccccccccccccEEEcccccHHHHHcccccccEEEEEEcccccEEEEEccccccEEEEEEcccccEEEEcccccEEEEcccEEEEEccccccEEEEEEccccccEEEEEccccEEEEEEEcccccEEEEEEcccccEEEEEEcccccEEEEccccccccccEEEEEccccEEEEEEccccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEcccccEEEEEccccEEEEEEcccccEEEEEEEEccccccEEEEEEEEcccccEEEEcccccEEEEEEcccccEEEEEEcccccEEEEEEccccccEEEEEEccccEEEEEEcccccEEEEEccccccEEcccccEEEEcccccEEEEEEcccccEEEEEEEccccEEEEEEcccccEEEEEEcccccEEEEcccccEEEEEEcccccEEEEcccccEEEEEEEcccccEEEEccccEEEEEEcccccEEEEEcccccccccccccccccccccEEEEEcccccccHHHcccccccHHHHHHccHHHHHHHHHHcccccccccEEEEEccccEEEEEcccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccHHcccccccccc
mlelqdyggsssesdaesqtlhlkpiesCAFSVAKslsvcatpavipkvmessnltdvntkEITKNLryeelyapeygpvnpfltqqqraDKNTLSGFVEQAHINSFQFENQRRTFAsygyaldpsseveskvigastsgdknktvfestskrpldkrkrnrndcpediegflgpfenqRRTFAsygyaldpsseveskvigasmsgdknktvfestskrpldkrkrnrndcpediegflgpwggytdeekvsrpnEAQAAELEEYLAKKQKkgkqseekpleektilhikdptdyqgrsflhpphdvgtnlrsdtppdrcflpktqvhtweghtkgisairwfpkSAHLLLSCSMDCRVKLWEVYKERRCVRTYYGHRQAVRDICFNNTGTNFISAIRWFPKSAHLLLSCSMDCRVKLWEVYKEHRCVRTYYGHRQAVRDICfnntgtnfisaGYDRYLKLWdtesgecisrftsrkvaycvkfhpdedkqhldipvdmkyiadptmhsmpavtsspnnkwlACQSMDNKILIFSALNRFKlnrkktfeghmvagyacsldfspdmsylisgdadgkcyiwdwKTTKLFKKwkahdgvcistlwhphepskvvtAGWDAATAKVQDANIVKIAVEMEKQVPQLYQFNQTLTLSSIIQEIcsgwslsdsEQYALQFSETNNknyiteknrneikngsVLRLAFSASKTADDILSKLSDKNASLEEKTAAEFYCICIVLLNKTWKEMRATTEDFVKVFSVVREQITRAlssqpaslDKFRANISRLTYSEITNLWQQERTSREEWESHAKPIVELKELITPEIVDLIQQQRLGylvegtrftkyssrgqvvlenscradehecpfgrTSVELVKHLCEILrigdapseqgvnyhpmffthdhpfeEFYCICIVLLNKTWKEMRATTEDFVKVVLEnscradehecpfgrTSVELVKHLCEILrigdapseqgvnyhpmffthdhpfeEFYCICIVLLNKTWKEMRATTEDfvkcksspal
mlelqdyggsssesdaesQTLHLKPIESCAFSVAKSLSVCATPavipkvmessnltdvntkEITKNLRYEELYAPEYGPVNPFLTQQQRADKNTLSGFVEQAHINSFQFENQRRTFASYGYALDPSSEVESKVIgastsgdknktvfestskrpldkrkrnrndcpediegflgpfenqRRTFASYGYALDPSSEVESKVIGasmsgdknktvfestskrpldkrkrnrndcpediegflgpwggytDEEKVSRPNEAQAAELEEYLAKkqkkgkqseekpleektilhikdptdyqgrSFLHPPHDVGTNLRSDTPPDRCFLPKTQVHTWEGHTKGISAIRWFPKSAHLLLSCSMDCRVKLWEVYKERRCVRtyyghrqavrdiCFNNTGTNFISAIRWFPKSAHLLLSCSMDCRVKLWEVYKEHRCVRTYYGHRQAVRDICFNNTGTNFISAGYDRYLKLWDTESGECISRFTSRKVAYCVKFhpdedkqhldiPVDMKYIADPTMHSMPAVTSSPNNKWLACQSMDNKILIFSALNRFKLNRKKTFEGHMVAGYACSLDFSPDMSYLISGDADGKCYIWDWKTTKLFKKWKAHDGVCISTLWHPHEPSKVVTAGWDAATAKVQDANIVKIAVEMEKQVPQLYQFNQTLTLSSIIQEICSGWSLSDSEQYALQFSETNnknyiteknrneikngSVLRLAFSASKTADDILSKLSDKNASLEEKTAAEFYCICIVLLNKTWKEMRATTEDFVKVFSVVREQItralssqpasldkFRANISRLTYSEITNLWQQERTSREEWESHAKPIVELKELITPEIVDLIQQQRLGYLVEGTRFTKYSSRGQVVLENSCRADEHECPFGRTSVELVKHLCEILRIGDAPSEQGVNYHPMFFTHDHPFEEFYCICIVLLNKTWKEMRATTEDFVKVVLENSCRadehecpfgRTSVELVKHLCEILRIGDAPSEQGVNYHPMFFTHDHPFEEFYCICIVLLNKTWKEMRATtedfvkcksspal
MLELQDYGGSSSESDAESQTLHLKPIESCAFSVAKSLSVCATPAVIPKVMESSNLTDVNTKEITKNLRYEELYAPEYGPVNPFLTQQQRADKNTLSGFVEQAHINSFQFENQRRTFASYGYALDPSSEVESKVIGASTSGDKNKTVFESTSKRPLDKRKRNRNDCPEDIEGFLGPFENQRRTFASYGYALDPSSEVESKVIGASMSGDKNKTVFESTSKRPLDKRKRNRNDCPEDIEGFLGPWGGYTDEEKVSRPNeaqaaeleeylakkqkkgkqseekPLEEKTILHIKDPTDYQGRSFLHPPHDVGTNLRSDTPPDRCFLPKTQVHTWEGHTKGISAIRWFPKSAHLLLSCSMDCRVKLWEVYKERRCVRTYYGHRQAVRDICFNNTGTNFISAIRWFPKSAHLLLSCSMDCRVKLWEVYKEHRCVRTYYGHRQAVRDICFNNTGTNFISAGYDRYLKLWDTESGECISRFTSRKVAYCVKFHPDEDKQHLDIPVDMKYIADPTMHSMPAVTSSPNNKWLACQSMDNKILIFSALNRFKLNRKKTFEGHMVAGYACSLDFSPDMSYLISGDADGKCYIWDWKTTKLFKKWKAHDGVCISTLWHPHEPSKVVTAGWDAATAKVQDANIVKIAVEMEKQVPQLYQFNQTLTLSSIIQEICSGWSLSDSEQYALQFSETNNKNYITEKNRNEIKNGSVLRLAFSASKTADDILSKLSDKNASLEEKTAAEFYCICIVLLNKTWKEMRATTEDFVKVFSVVREQITRALSSQPASLDKFRANISRLTYSEITNLWQQERTSREEWESHAKPIVELKELITPEIVDLIQQQRLGYLVEGTRFTKYSSRGQVVLENSCRADEHECPFGRTSVELVKHLCEILRIGDAPSEQGVNYHPMFFTHDHPFEEFYCICIVLLNKTWKEMRATTEDFVKVVLENSCRADEHECPFGRTSVELVKHLCEILRIGDAPSEQGVNYHPMFFTHDHPFEEFYCICIVLLNKTWKEMRATTEDFVKCKSSPAL
**********************LKPIESCAFSVAKSLSVCATPAVIPKVMESSNLTDVNTKEITKNLRYEELYAPEYGPVNPFLTQQ*****NTLSGFVEQAHINSFQFENQRRTFASYGYAL************************************************FLGPFE**RRTFASYGYA************************************************GFLGPWGGY*************************************************************************RCFLPKTQVHTWEGHTKGISAIRWFPKSAHLLLSCSMDCRVKLWEVYKERRCVRTYYGHRQAVRDICFNNTGTNFISAIRWFPKSAHLLLSCSMDCRVKLWEVYKEHRCVRTYYGHRQAVRDICFNNTGTNFISAGYDRYLKLWDTESGECISRFTSRKVAYCVKFHPDEDKQHLDIPVDMKYIADP*************NKWLACQSMDNKILIFSALNRFKLNRKKTFEGHMVAGYACSLDFSPDMSYLISGDADGKCYIWDWKTTKLFKKWKAHDGVCISTLWHPHEPSKVVTAGWDAATAKVQDANIVKIAVEMEKQVPQLYQFNQTLTLSSIIQEICSGWSLSDSEQYALQFSETNNKNYIT**********SVLRLAF***********************TAAEFYCICIVLLNKTWKEMRATTEDFVKVFSVVREQITRALS***ASLDKFRANISRLTYSEITNLWQQE******WESHAKPIVELKELITPEIVDLIQQQRLGYLVEGTRFTKYSSRGQVVLENSCRADEHECPFGRTSVELVKHLCEILRIGDAPSEQGVNYHPMFFTHDHPFEEFYCICIVLLNKTWKEMRATTEDFVKVVLENSCRADEHECPFGRTSVELVKHLCEILRIGDAPSEQGVNYHPMFFTHDHPFEEFYCICIVLLNKTWKEMRATTEDFV********
***************************************CATPAVI**************KEITKNLRYEELYAPEYGPVN**************SGFVEQAHINSFQFENQRRTFASYGYALDPSS*******************************************GFLGPFENQRRTFASYGYA**************************************************LGPWGG***********************************PLEEKTILHIKDPTDYQGRSFLHPPHDV****RSDTPPDRCFLPKTQVHTWEGHTKGISAIRWFPKSAHLLLSCSMDCRVKLWEVYKERRCVRTYYGHRQAVRDICFNNTGTNFISAIRWFPKSAHLLLSCSMDCRVKLWEVYKEHRCVRTYYGHRQAVRDICFNNTGTNFISAGYDRYLKLWDTESGECISRFTSRKVAYCVKFHPDEDKQHLDIPVDMKYIADPTMHSMPAVTSSPNNKWLACQSMDNKILIFSALNRFKLNRKKTFEGHMVAGYACSLDFSPDMSYLISGDADGKCYIWDWKTTKLFKKWKAHDGVCISTLWHPHEPSKVVTAGWDAATAKVQDANIVKIAVEMEKQVPQLYQFNQTLTLSSIIQEICSGWSLSDSEQYALQFSETNNKNYITEKNRNEIKNGSVLRLAFSASKTADDILSKLSDKNASLEEKTAAEFYCICIVLLNKTWKEMRATTEDFVKVFSVVREQITRALSSQPASLDKFRANISRLTYSEITNLWQQERTSREEWESHAKPIVELKELITPEIV*LIQQQRLGYLVEGTRFTKYSSRGQVVLENSCRADEHECPFGRTSVELVKHLCEILRIGDAPSEQGVNYHPMFFTHDHPFEEFYCICIVLLNKTWKEMRATTEDFVKVVLENSCRADEHECPFGRTSVELVKHLCEILRIGDAPSEQGVNYHPMFFTHDHPFEEFYCICIVLLNKTWKEMRATTEDFVKCKSS***
********************LHLKPIESCAFSVAKSLSVCATPAVIPKVMESSNLTDVNTKEITKNLRYEELYAPEYGPVNPFLTQQQRADKNTLSGFVEQAHINSFQFENQRRTFASYGYALDPSSEVESKVIGASTSGDKNKTVFESTSKRPLDKRKRNRNDCPEDIEGFLGPFENQRRTFASYGYALDPSSEVESKVIGASMSGDKNKTVFESTSKRPLDKRKRNRNDCPEDIEGFLGPWGGYTDEEKVSRPNEAQAAELEEYL**************LEEKTILHIKDPTDYQGRSFLHPPHDVGTNLRSDTPPDRCFLPKTQVHTWEGHTKGISAIRWFPKSAHLLLSCSMDCRVKLWEVYKERRCVRTYYGHRQAVRDICFNNTGTNFISAIRWFPKSAHLLLSCSMDCRVKLWEVYKEHRCVRTYYGHRQAVRDICFNNTGTNFISAGYDRYLKLWDTESGECISRFTSRKVAYCVKFHPDEDKQHLDIPVDMKYIADPTMHSMPAVTSSPNNKWLACQSMDNKILIFSALNRFKLNRKKTFEGHMVAGYACSLDFSPDMSYLISGDADGKCYIWDWKTTKLFKKWKAHDGVCISTLWHPHEPSKVVTAGWDAATAKVQDANIVKIAVEMEKQVPQLYQFNQTLTLSSIIQEICSGWSLSDSEQYALQFSETNNKNYITEKNRNEIKNGSVLRLAFSASKTADDILSKLSDKNASLEEKTAAEFYCICIVLLNKTWKEMRATTEDFVKVFSVVREQITRALSSQPASLDKFRANISRLTYSEITNLWQ**********SHAKPIVELKELITPEIVDLIQQQRLGYLVEGTRFTKYSSRGQVVLENSCRADEHECPFGRTSVELVKHLCEILRIGDAPSEQGVNYHPMFFTHDHPFEEFYCICIVLLNKTWKEMRATTEDFVKVVLENSCRADEHECPFGRTSVELVKHLCEILRIGDAPSEQGVNYHPMFFTHDHPFEEFYCICIVLLNKTWKEMRATTED**********
*******************************SVAKSLSVCATPAVIPKVMESSNLTDVNTKEITKNLRYEELYAPEYGPVNPFLTQQQRADKNTLSGFVEQAHINSFQFENQRRTFASYGYALDPSSEVESKVIGASTSGDKNKTVFESTSKRPLDKRKRNRNDCPEDIEGFLGPFENQRRTFASYGYALDPSSEVESKVIGASMSGDKNKTVFESTSKRP*******RNDCPEDIEGFLGPWGGYT********NEAQAAELEEYLAKKQKKGKQSEEKPLEEKTILHIKDPTDYQGRSFLHPPHDVGTNLRSDTPPDRCFLPKTQVHTWEGHTKGISAIRWFPKSAHLLLSCSMDCRVKLWEVYKERRCVRTYYGHRQAVRDICFNNTGTNFISAIRWFPKSAHLLLSCSMDCRVKLWEVYKEHRCVRTYYGHRQAVRDICFNNTGTNFISAGYDRYLKLWDTESGECISRFTSRKVAYCVKFHPDEDKQHLDIPVDMKYIADPTMHSMPAVTSSPNNKWLACQSMDNKILIFSALNRFKLNRKKTFEGHMVAGYACSLDFSPDMSYLISGDADGKCYIWDWKTTKLFKKWKAHDGVCISTLWHPHEPSKVVTAGWDAATAKVQDANIVKIAVEMEKQVPQLYQFNQTLTLSSIIQEICSGWSLSDSEQYALQFSETNNKNYITEKNRNEIKNGSVLRLAFSASKTADDILSKLSDKNASLEEKTAAEFYCICIVLLNKTWKEMRATTEDFVKVFSVVREQITRALSSQPASLDKFRANISRLTYSEITNLWQQERTSREEWESHAKPIVELKELITPEIVDLIQQQRLGYLVEGTRFTKYSSRGQVVLENSCRADEHECPFGRTSVELVKHLCEILRIGDAPSEQGVNYHPMFFTHDHPFEEFYCICIVLLNKTWKEMRATTEDFVKVVLENSCRADEHECPFGRTSVELVKHLCEILRIGDAPSEQGVNYHPMFFTHDHPFEEFYCICIVLLNKTWKEMRATTEDFVKCKS****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLELQDYGGSSSESDAESQTLHLKPIESCAFSVAKSLSVCATPAVIPKVMESSNLTDVNTKEITKNLRYEELYAPEYGPVNPFLTQQQRADKNTLSGFVEQAHINSFQFENQRRTFASYGYALDPSSEVESKVIGASTSGDKNKTVFESTSKRPLDKRKRNRNDCPEDIEGFLGPFENQRRTFASYGYALDPSSEVESKVIGASMSGDKNKTVFESTSKRPLDKRKRNRNDCPEDIEGFLGPWGGYTDEEKVSRPNEAQxxxxxxxxxxxxxxxxxxxxxPLEEKTILHIKDPTDYQGRSFLHPPHDVGTNLRSDTPPDRCFLPKTQVHTWEGHTKGISAIRWFPKSAHLLLSCSMDCRVKLWEVYKERRCVRTYYGHRQAVRDICFNNTGTNFISAIRWFPKSAHLLLSCSMDCRVKLWEVYKEHRCVRTYYGHRQAVRDICFNNTGTNFISAGYDRYLKLWDTESGECISRFTSRKVAYCVKFHPDEDKQHLDIPVDMKYIADPTMHSMPAVTSSPNNKWLACQSMDNKILIFSALNRFKLNRKKTFEGHMVAGYACSLDFSPDMSYLISGDADGKCYIWDWKTTKLFKKWKAHDGVCISTLWHPHEPSKVVTAGWDAATAKVQDANIVKIAVEMEKQVPQLYQFNQTLTLSSIIQEICSGWSLSDSEQYALQFSETNNKNYITEKNRNEIKNGSVLRLAFSASKTADDILSKLSDKNASLEEKTAAEFYCICIVLLNKTWKEMRATTEDFVKVFSVVREQITRALSSQPASLDKFRANISRLTYSEITNLWQQERTSREEWESHAKPIVELKELITPEIVDLIQQQRLGYLVEGTRFTKYSSRGQVVLENSCRADEHECPFGRTSVELVKHLCEILRIGDAPSEQGVNYHPMFFTHDHPFEEFYCICIVLLNKTWKEMRATTEDFVKVVLENSCRADEHECPFGRTSVELVKHLCEILRIGDAPSEQGVNYHPMFFTHDHPFEEFYCICIVLLNKTWKEMRATTEDFVKCKSSPAL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1019 2.2.26 [Sep-21-2011]
O60508579 Pre-mRNA-processing facto yes N/A 0.427 0.753 0.535 1e-143
Q9DC48579 Pre-mRNA-processing facto yes N/A 0.427 0.753 0.533 1e-143
O43071558 Pre-mRNA-processing facto yes N/A 0.489 0.894 0.294 3e-71
P40968455 Pre-mRNA-processing facto yes N/A 0.374 0.839 0.277 1e-50
Q92556727 Engulfment and cell motil no N/A 0.117 0.165 0.557 2e-33
Q8BPU7727 Engulfment and cell motil no N/A 0.117 0.165 0.557 2e-33
Q8BHL5732 Engulfment and cell motil no N/A 0.112 0.157 0.598 3e-31
Q96JJ3720 Engulfment and cell motil no N/A 0.112 0.159 0.598 3e-31
A4FUD6720 Engulfment and cell motil no N/A 0.112 0.159 0.598 3e-31
Q5RCC1720 Engulfment and cell motil no N/A 0.112 0.159 0.598 3e-31
>sp|O60508|PRP17_HUMAN Pre-mRNA-processing factor 17 OS=Homo sapiens GN=CDC40 PE=1 SV=1 Back     alignment and function desciption
 Score =  509 bits (1312), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 255/476 (53%), Positives = 326/476 (68%), Gaps = 40/476 (8%)

Query: 166 PEDIEGFLGPFENQRRTFASYGYALDPS---SEVESKVIGASMSGDKNK--TVFESTSKR 220
           P  I  F+  FE QRRTFA+YGYALDPS    +V +K IG+    +KN+  TVFE+  K+
Sbjct: 117 PAHINDFM--FEQQRRTFATYGYALDPSLDNHQVSAKYIGSVEEAEKNQGLTVFETGQKK 174

Query: 221 PLDKRKRNRNDCPEDIEGFLGPWGGYTDEEKVSRPNEAQAAELEEYLAKKQKKGKQSEEK 280
              ++K   ND   +I+GFLGPW  Y DE+ V++P+E +  EL+E  AK+QKKGKQ EEK
Sbjct: 175 TEKRKKFKENDA-SNIDGFLGPWAKYVDEKDVAKPSEEEQKELDEITAKRQKKGKQEEEK 233

Query: 281 PLEEKTILHIKDPTDYQGRSFLHPPHDVGTNLRSDTPPDRCFLPKTQVHTWEGHTKGISA 340
           P EEKTILH+K+  DYQGRS+LH P DVG NLRS  PP++C+LPK Q+H W GHTKG+SA
Sbjct: 234 PGEEKTILHVKEMYDYQGRSYLHIPQDVGVNLRSTMPPEKCYLPKKQIHVWSGHTKGVSA 293

Query: 341 IRWFPKSAHLLLSCSMDCRVKLWEVYKERRCVRTYYGHRQAVRDICFNNTGTNFISAIRW 400
           +R FP S HLLLSCSMDC++KLWEVY ERRC+RT+ GH +AVRDICFN  GT F+SA   
Sbjct: 294 VRLFPLSGHLLLSCSMDCKIKLWEVYGERRCLRTFIGHSKAVRDICFNTAGTQFLSA--- 350

Query: 401 FPKSAHLLLSCSMDCRVKLWEVYKEHRCVRTYYGHRQAVRDICFN---NTGTNFISAGYD 457
                      + D  +KLW+  +  +C+ + + +R+    + FN   +    F++   D
Sbjct: 351 -----------AYDRYLKLWDT-ETGQCI-SRFTNRKVPYCVKFNPDEDKQNLFVAGMSD 397

Query: 458 RYLKLWDTESGECISRFTSRKVAYCVKFHPDEDKQHL-------------DIPVDMKYIA 504
           + +  WD  SGE +  +     A       DE+++ +             DIPVD KYIA
Sbjct: 398 KKIVQWDIRSGEIVQEYDRHLGAVNTIVFVDENRRFVSTSDDKSLRVWEWDIPVDFKYIA 457

Query: 505 DPTMHSMPAVTSSPNNKWLACQSMDNKILIFSALNRFKLNRKKTFEGHMVAGYACSLDFS 564
           +P+MHSMPAVT SPN KWLACQSMDN+ILIF A NRF+LN+KK F+GHMVAGYAC +DFS
Sbjct: 458 EPSMHSMPAVTLSPNGKWLACQSMDNQILIFGAQNRFRLNKKKIFKGHMVAGYACQVDFS 517

Query: 565 PDMSYLISGDADGKCYIWDWKTTKLFKKWKAHDGVCISTLWHPHEPSKVVTAGWDA 620
           PDMSY+ISGD +GK  IWDWKTTKL+ ++KAHD VCI  +WHPHE SKV+T GWD 
Sbjct: 518 PDMSYVISGDGNGKLNIWDWKTTKLYSRFKAHDKVCIGAVWHPHETSKVITCGWDG 573




Associates with the spliceosome late in the splicing pathway and may function in the second step of pre-mRNA splicing.
Homo sapiens (taxid: 9606)
>sp|Q9DC48|PRP17_MOUSE Pre-mRNA-processing factor 17 OS=Mus musculus GN=Cdc40 PE=1 SV=1 Back     alignment and function description
>sp|O43071|PRP17_SCHPO Pre-mRNA-processing factor 17 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp17 PE=1 SV=1 Back     alignment and function description
>sp|P40968|PRP17_YEAST Pre-mRNA-processing factor 17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC40 PE=1 SV=2 Back     alignment and function description
>sp|Q92556|ELMO1_HUMAN Engulfment and cell motility protein 1 OS=Homo sapiens GN=ELMO1 PE=1 SV=2 Back     alignment and function description
>sp|Q8BPU7|ELMO1_MOUSE Engulfment and cell motility protein 1 OS=Mus musculus GN=Elmo1 PE=1 SV=2 Back     alignment and function description
>sp|Q8BHL5|ELMO2_MOUSE Engulfment and cell motility protein 2 OS=Mus musculus GN=Elmo2 PE=1 SV=1 Back     alignment and function description
>sp|Q96JJ3|ELMO2_HUMAN Engulfment and cell motility protein 2 OS=Homo sapiens GN=ELMO2 PE=1 SV=2 Back     alignment and function description
>sp|A4FUD6|ELMO2_BOVIN Engulfment and cell motility protein 2 OS=Bos taurus GN=ELMO2 PE=2 SV=1 Back     alignment and function description
>sp|Q5RCC1|ELMO2_PONAB Engulfment and cell motility protein 2 OS=Pongo abelii GN=ELMO2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1019
156551023587 PREDICTED: pre-mRNA-processing factor 17 0.421 0.730 0.638 1e-165
21355805576 CG6015 [Drosophila melanogaster] gi|7300 0.522 0.923 0.490 1e-165
383865872583 PREDICTED: pre-mRNA-processing factor 17 0.421 0.735 0.631 1e-164
91091570562 PREDICTED: similar to pre-mRNA-processin 0.442 0.802 0.584 1e-164
195330909576 GM23670 [Drosophila sechellia] gi|194121 0.522 0.923 0.489 1e-164
195572766576 GD18480 [Drosophila simulans] gi|1942002 0.522 0.923 0.489 1e-164
194911327575 GG12541 [Drosophila erecta] gi|190656968 0.522 0.925 0.493 1e-164
332017047563 Pre-mRNA-processing factor 17 [Acromyrme 0.421 0.761 0.633 1e-164
195502464579 GE24061 [Drosophila yakuba] gi|194184336 0.522 0.918 0.487 1e-164
380011695578 PREDICTED: pre-mRNA-processing factor 17 0.421 0.742 0.631 1e-164
>gi|156551023|ref|XP_001601045.1| PREDICTED: pre-mRNA-processing factor 17-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  588 bits (1517), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 298/467 (63%), Positives = 347/467 (74%), Gaps = 38/467 (8%)

Query: 176 FENQRRTFASYGYALDPS---SEVESKV-IGASMSGDK--NKTVFESTSKRPLDKRKRNR 229
           FENQRRTFASYGYALDP+   S  E KV IGA  + ++   KTVFE+T+ RP DKRKRNR
Sbjct: 131 FENQRRTFASYGYALDPTVDGSAEEGKVLIGALEAAEETGGKTVFENTAIRPADKRKRNR 190

Query: 230 NDCPEDIEGFLGPWGGYTDEEKVSRPNEAQAAELEEYLAKKQKKGKQSEEKPLEEKTILH 289
           ND P DI GFLGPWGG+ DE++V +P++ +AAELEE LAK+ K+GKQ+++KPLEEKT+LH
Sbjct: 191 NDDPTDITGFLGPWGGFVDEKRVIKPSDEEAAELEEILAKRNKRGKQTDDKPLEEKTVLH 250

Query: 290 IKDPTDYQGRSFLHPPHDVGTNLRSDTPPDRCFLPKTQVHTWEGHTKGISAIRWFPKSAH 349
           IKD  DYQGRSFLH P DVG NLRSD+PP+RCFLPK Q+HTWEGHTKGIS IRWFP +AH
Sbjct: 251 IKDSVDYQGRSFLHAPQDVGVNLRSDSPPERCFLPKAQIHTWEGHTKGISQIRWFPVTAH 310

Query: 350 LLLSCSMDCRVKLWEVYKERRCVRTYYGHRQAVRDICFNNTGTNFISAIRWFPKSAHLLL 409
           LLLSCSMDCRVKLWEVYKERRC+RTYYGHRQAVRD+ F+N G  F+SA            
Sbjct: 311 LLLSCSMDCRVKLWEVYKERRCIRTYYGHRQAVRDVSFDNDGKKFLSA------------ 358

Query: 410 SCSMDCRVKLWEVYKEHRCVRTYYGHRQAVRDICFNNTGTN---FISAGYDRYLKLWDTE 466
               D  VKLW+  +   CV + +  R+      FN        F++   D+ +  WD  
Sbjct: 359 --GYDRYVKLWDT-ETGACV-SRFTSRKVPYCAKFNPDPDKQHLFVAGTSDKKIICWDIR 414

Query: 467 SGECISRFTSRKVAYCVKFHPDEDKQHL-------------DIPVDMKYIADPTMHSMPA 513
           SGE I  +     A       DE+++ +             DIPVDMKYIADPTMHSMPA
Sbjct: 415 SGEIIQEYDRHLGAVNTITFVDENRRFVTTSDDKSLRVWEWDIPVDMKYIADPTMHSMPA 474

Query: 514 VTSSPNNKWLACQSMDNKILIFSALNRFKLNRKKTFEGHMVAGYACSLDFSPDMSYLISG 573
           VT SPN KWLACQSMDNKI+IFSALNRFK+NRKKTF GHMVAGYAC +DFSPDMSYL+SG
Sbjct: 475 VTPSPNQKWLACQSMDNKIVIFSALNRFKMNRKKTFTGHMVAGYACGIDFSPDMSYLVSG 534

Query: 574 DADGKCYIWDWKTTKLFKKWKAHDGVCISTLWHPHEPSKVVTAGWDA 620
           DADGKCY+WDWKTTKL+KKWKAHD VCISTLWHPHEPS++ TAGWD 
Sbjct: 535 DADGKCYVWDWKTTKLYKKWKAHDNVCISTLWHPHEPSRLATAGWDG 581




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|21355805|ref|NP_651005.1| CG6015 [Drosophila melanogaster] gi|7300806|gb|AAF55949.1| CG6015 [Drosophila melanogaster] gi|17862316|gb|AAL39635.1| LD21931p [Drosophila melanogaster] gi|220946744|gb|ACL85915.1| CG6015-PA [synthetic construct] Back     alignment and taxonomy information
>gi|383865872|ref|XP_003708396.1| PREDICTED: pre-mRNA-processing factor 17-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|91091570|ref|XP_967396.1| PREDICTED: similar to pre-mRNA-processing factor 17 [Tribolium castaneum] gi|270001029|gb|EEZ97476.1| hypothetical protein TcasGA2_TC011310 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195330909|ref|XP_002032145.1| GM23670 [Drosophila sechellia] gi|194121088|gb|EDW43131.1| GM23670 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|195572766|ref|XP_002104366.1| GD18480 [Drosophila simulans] gi|194200293|gb|EDX13869.1| GD18480 [Drosophila simulans] Back     alignment and taxonomy information
>gi|194911327|ref|XP_001982330.1| GG12541 [Drosophila erecta] gi|190656968|gb|EDV54200.1| GG12541 [Drosophila erecta] Back     alignment and taxonomy information
>gi|332017047|gb|EGI57846.1| Pre-mRNA-processing factor 17 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|195502464|ref|XP_002098235.1| GE24061 [Drosophila yakuba] gi|194184336|gb|EDW97947.1| GE24061 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|380011695|ref|XP_003689933.1| PREDICTED: pre-mRNA-processing factor 17-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1019
FB|FBgn0038927576 CG6015 [Drosophila melanogaste 0.416 0.736 0.561 1.6e-134
UNIPROTKB|F1NQ45580 CDC40 "Uncharacterized protein 0.426 0.75 0.511 1.5e-124
ZFIN|ZDB-GENE-050116-3578 cdc40 "cell division cycle 40 0.426 0.752 0.518 6.3e-124
UNIPROTKB|F1RSY9579 CDC40 "Uncharacterized protein 0.426 0.751 0.507 1.7e-123
UNIPROTKB|E2RSW2663 CDC40 "Uncharacterized protein 0.426 0.656 0.507 1.7e-123
UNIPROTKB|F1MBS9579 CDC40 "Uncharacterized protein 0.426 0.751 0.507 1.7e-123
UNIPROTKB|O60508579 CDC40 "Pre-mRNA-processing fac 0.426 0.751 0.509 2.1e-123
MGI|MGI:1918963579 Cdc40 "cell division cycle 40" 0.426 0.751 0.507 2.7e-123
UNIPROTKB|F1LMQ0447 Cdc40 "Protein Cdc40" [Rattus 0.410 0.935 0.502 5.4e-118
RGD|1307063444 Cdc40 "cell division cycle 40" 0.408 0.936 0.504 1.4e-117
FB|FBgn0038927 CG6015 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1318 (469.0 bits), Expect = 1.6e-134, P = 1.6e-134
 Identities = 262/467 (56%), Positives = 314/467 (67%)

Query:   176 FENQRRTFASYGYALDPSSEVESKVIGASMSGD-------KNKTVFESTSKRPLDKRKRN 228
             FENQRRTF +YGYALDPS  V+ +  G S  GD         KTVFE    + L  RK+ 
Sbjct:   123 FENQRRTFHTYGYALDPS--VDDQADGQSFVGDLQSAYDDNGKTVFEPPKAKKL--RKQE 178

Query:   229 RNDCPEDIEGFLGPWGGYTDEEKVSRPNXXXXXXXXXXXXXXXXXXXXXXXXPLEEKTIL 288
             +ND PEDIEGFLGPWG + +E  V++PN                        PLEEK+ L
Sbjct:   179 KNDNPEDIEGFLGPWGKFENEVSVAKPNEQERAELDELLSKRHKRGRIPEDKPLEEKSTL 238

Query:   289 HIKDPTDYQGRSFLHPPHDVGTNLRSDTPPDRCFLPKTQVHTWEGHTKGISAIRWFPKSA 348
             HIKD  DYQGRS+LH PHD+G NLRS+ PP +CFLPK  +HTW GH KGIS+IRWFPK+A
Sbjct:   239 HIKDAYDYQGRSYLHAPHDLGVNLRSNAPPTKCFLPKAHIHTWSGHNKGISSIRWFPKTA 298

Query:   349 HLLLSCSMDCRVKLWEVYKERRCVRTYYGHRQAVRDICFNNTGTNFISAIRWFPKSAHLL 408
             HLLLS SMDCRVKLWEVY ERRC+RT+ GHRQA++DI +NN GTNF+SA           
Sbjct:   299 HLLLSGSMDCRVKLWEVYGERRCIRTFSGHRQAIKDIAWNNRGTNFLSA----------- 347

Query:   409 LSCSMDCRVKLWEVYKEHRCVRTYYGHRQAVRDICFNNTGTN---FISAGYDRYLKLWDT 465
                S D  +KLW+   E   V + +  R+    + F+   +    F++   D+ +  WDT
Sbjct:   348 ---SYDRYIKLWDA--ETGDVVSRFTTRKMPFCVKFHPDNSKQHLFVAGTSDKKIICWDT 402

Query:   466 ESGECISRFTSRKVAYC-VKFHPD--------EDKQ----HLDIPVDMKYIADPTMHSMP 512
              SG+ +  +     +   + F  D        +DK       DIPVDMKYIADPTMHSMP
Sbjct:   403 RSGDIVQEYDRHLGSVSTITFVDDNRRFVTTSDDKSMRIWEWDIPVDMKYIADPTMHSMP 462

Query:   513 AVTSSPNNKWLACQSMDNKILIFSALNRFKLNRKKTFEGHMVAGYACSLDFSPDMSYLIS 572
             AVT +PN KW+ACQS+DNKI+IFSALNRFK+NRKKTF GHMV+GYAC LDFSPDMSYL+S
Sbjct:   463 AVTLAPNGKWMACQSLDNKIVIFSALNRFKMNRKKTFTGHMVSGYACQLDFSPDMSYLVS 522

Query:   573 GDADGKCYIWDWKTTKLFKKWKAHDGVCISTLWHPHEPSKVVTAGWD 619
             GD DGKCYIWDWKTTK++KKW+AHDGVCIS LWHPHE SKVVTAGWD
Sbjct:   523 GDGDGKCYIWDWKTTKMYKKWQAHDGVCISALWHPHEASKVVTAGWD 569


GO:0000398 "mRNA splicing, via spliceosome" evidence=IC;ISS
GO:0005681 "spliceosomal complex" evidence=ISS
GO:0071013 "catalytic step 2 spliceosome" evidence=IDA
GO:0071011 "precatalytic spliceosome" evidence=IDA
UNIPROTKB|F1NQ45 CDC40 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050116-3 cdc40 "cell division cycle 40 homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1RSY9 CDC40 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSW2 CDC40 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MBS9 CDC40 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O60508 CDC40 "Pre-mRNA-processing factor 17" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1918963 Cdc40 "cell division cycle 40" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1LMQ0 Cdc40 "Protein Cdc40" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1307063 Cdc40 "cell division cycle 40" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9DC48PRP17_MOUSENo assigned EC number0.53360.42780.7530yesN/A
O60508PRP17_HUMANNo assigned EC number0.53570.42780.7530yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1019
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 4e-47
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 2e-27
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 8e-27
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 4e-26
pfam04727170 pfam04727, ELMO_CED12, ELMO/CED-12 family 1e-25
pfam04727170 pfam04727, ELMO_CED12, ELMO/CED-12 family 3e-25
COG2319466 COG2319, COG2319, FOG: WD40 repeat [General functi 2e-24
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 3e-23
cd00200289 cd00200, WD40, WD40 domain, found in a number of e 5e-12
smart0032040 smart00320, WD40, WD40 repeats 5e-08
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-07
smart0032040 smart00320, WD40, WD40 repeats 1e-06
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 2e-06
smart0032040 smart00320, WD40, WD40 repeats 7e-06
cd13359126 cd13359, PH_ELMO1_CED-12, Engulfment and cell moti 9e-06
pfam04727170 pfam04727, ELMO_CED12, ELMO/CED-12 family 1e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 1e-05
smart0032040 smart00320, WD40, WD40 repeats 2e-05
pfam0040039 pfam00400, WD40, WD domain, G-beta repeat 2e-05
PTZ00420568 PTZ00420, PTZ00420, coronin; Provisional 2e-04
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
 Score =  169 bits (431), Expect = 4e-47
 Identities = 83/313 (26%), Positives = 128/313 (40%), Gaps = 38/313 (12%)

Query: 328 VHTWEGHTKGISAIRWFPKSAHLLLSCSMDCRVKLWEVYKERRCVRTYYGHRQAVRDICF 387
             T +GHT G++ + + P    LL + S D  +K+W+  +    +RT  GH   VRD+  
Sbjct: 2   RRTLKGHTGGVTCVAFSPDG-KLLATGSGDGTIKVWD-LETGELLRTLKGHTGPVRDV-- 57

Query: 388 NNTGTNFISAIRWFPKSAHLLLSCSMDCRVKLWEVYKEHRCVRTYYGHRQAVRDICFNNT 447
                               L S S D  ++LW++     CVRT  GH   V  + F+  
Sbjct: 58  -----------AASADG-TYLASGSSDKTIRLWDLETG-ECVRTLTGHTSYVSSVAFSPD 104

Query: 448 GTNFISAGYDRYLKLWDTESGECISRFTS-RKVAYCVKFHPDE--------DKQHL--DI 496
           G    S+  D+ +K+WD E+G+C++           V F PD         D      D+
Sbjct: 105 GRILSSSSRDKTIKVWDVETGKCLTTLRGHTDWVNSVAFSPDGTFVASSSQDGTIKLWDL 164

Query: 497 PVDMKYIADPTMHSMP--AVTSSPNNKWLACQSMDNKILIFSALNRFKLNRKKTFEGHMV 554
               K +A  T H+    +V  SP+ + L   S D  I ++       L    T  GH  
Sbjct: 165 -RTGKCVATLTGHTGEVNSVAFSPDGEKLLSSSSDGTIKLWDLSTGKCL---GTLRGH-- 218

Query: 555 AGYACSLDFSPDMSYLISGDADGKCYIWDWKTTKLFKKWKAHDGVCISTLWHPHEPSKVV 614
                S+ FSPD   L SG  DG   +WD +T +  +    H     S  W P +  ++ 
Sbjct: 219 ENGVNSVAFSPDGYLLASGSEDGTIRVWDLRTGECVQTLSGHTNSVTSLAWSP-DGKRLA 277

Query: 615 TAGWDAATAKVQD 627
           +   D  T ++ D
Sbjct: 278 SGSAD-GTIRIWD 289


Length = 289

>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|218231 pfam04727, ELMO_CED12, ELMO/CED-12 family Back     alignment and domain information
>gnl|CDD|218231 pfam04727, ELMO_CED12, ELMO/CED-12 family Back     alignment and domain information
>gnl|CDD|225201 COG2319, COG2319, FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|238121 cd00200, WD40, WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and bottom surface of the propeller are proposed to coordinate interactions with other proteins and/or small ligands; 7 copies of the repeat are present in this alignment Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|241513 cd13359, PH_ELMO1_CED-12, Engulfment and cell motility protein 1 pleckstrin homology (PH) domain Back     alignment and domain information
>gnl|CDD|218231 pfam04727, ELMO_CED12, ELMO/CED-12 family Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|197651 smart00320, WD40, WD40 repeats Back     alignment and domain information
>gnl|CDD|201208 pfam00400, WD40, WD domain, G-beta repeat Back     alignment and domain information
>gnl|CDD|240412 PTZ00420, PTZ00420, coronin; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1019
KOG0282|consensus503 100.0
KOG2999|consensus 713 100.0
KOG0271|consensus480 100.0
KOG0271|consensus480 100.0
KOG0272|consensus459 100.0
KOG2998|consensus302 100.0
PF04727170 ELMO_CED12: ELMO/CED-12 family; InterPro: IPR00681 100.0
KOG0272|consensus459 100.0
KOG0286|consensus343 100.0
KOG0279|consensus315 100.0
KOG0319|consensus775 100.0
KOG0318|consensus603 100.0
KOG0279|consensus315 100.0
KOG0315|consensus311 100.0
KOG0286|consensus343 100.0
KOG0263|consensus707 100.0
KOG0295|consensus406 99.98
KOG0265|consensus338 99.98
KOG0284|consensus464 99.97
KOG0293|consensus519 99.97
KOG0263|consensus707 99.97
KOG0273|consensus524 99.97
KOG0284|consensus464 99.97
KOG0266|consensus456 99.97
KOG0291|consensus893 99.97
KOG0645|consensus312 99.97
KOG0295|consensus406 99.97
KOG0281|consensus499 99.97
KOG0285|consensus460 99.97
KOG0273|consensus524 99.97
KOG0318|consensus603 99.97
KOG0313|consensus423 99.97
KOG0292|consensus 1202 99.97
KOG0306|consensus888 99.97
KOG0291|consensus893 99.97
KOG0306|consensus888 99.97
KOG0296|consensus399 99.97
KOG0285|consensus460 99.96
KOG0316|consensus307 99.96
KOG0315|consensus311 99.96
KOG0319|consensus775 99.96
KOG0266|consensus456 99.96
KOG0282|consensus503 99.96
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.96
KOG0645|consensus312 99.96
PLN00181793 protein SPA1-RELATED; Provisional 99.96
KOG0276|consensus 794 99.96
PLN00181793 protein SPA1-RELATED; Provisional 99.95
KOG0281|consensus499 99.95
KOG0275|consensus508 99.95
KOG0772|consensus641 99.95
KOG0288|consensus459 99.95
KOG0278|consensus334 99.95
KOG0276|consensus 794 99.94
KOG0277|consensus311 99.94
KOG1446|consensus311 99.94
PTZ00421493 coronin; Provisional 99.94
KOG0308|consensus735 99.94
KOG0292|consensus 1202 99.94
KOG0296|consensus399 99.94
PTZ00420568 coronin; Provisional 99.94
KOG0647|consensus347 99.94
KOG0973|consensus 942 99.94
KOG0274|consensus537 99.94
KOG0265|consensus338 99.94
KOG0772|consensus641 99.93
KOG0640|consensus430 99.93
KOG0283|consensus712 99.93
KOG0313|consensus423 99.93
KOG0293|consensus519 99.93
KOG0643|consensus327 99.93
KOG1407|consensus313 99.92
KOG0973|consensus 942 99.92
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 99.92
KOG0275|consensus508 99.92
KOG0283|consensus712 99.92
KOG0643|consensus327 99.92
KOG0268|consensus433 99.92
KOG0641|consensus350 99.92
KOG0310|consensus487 99.92
KOG0640|consensus430 99.91
KOG0299|consensus479 99.91
KOG0294|consensus362 99.91
KOG0264|consensus422 99.91
KOG0305|consensus484 99.91
KOG0316|consensus307 99.91
KOG0301|consensus745 99.91
PTZ00420568 coronin; Provisional 99.9
KOG0308|consensus735 99.9
KOG0278|consensus334 99.9
KOG0277|consensus311 99.9
KOG1063|consensus764 99.9
PTZ00421493 coronin; Provisional 99.9
KOG0321|consensus720 99.9
KOG0274|consensus537 99.89
KOG0300|consensus481 99.89
KOG0289|consensus506 99.89
KOG0288|consensus459 99.89
KOG1332|consensus299 99.89
KOG1408|consensus1080 99.89
KOG0289|consensus506 99.89
KOG1332|consensus299 99.89
KOG1539|consensus910 99.89
KOG2096|consensus420 99.88
KOG0310|consensus487 99.88
KOG1407|consensus313 99.88
KOG0646|consensus476 99.88
KOG0650|consensus733 99.88
KOG1036|consensus323 99.88
KOG0305|consensus484 99.87
KOG0269|consensus839 99.87
KOG0300|consensus481 99.87
KOG0301|consensus 745 99.87
KOG0294|consensus362 99.87
KOG0641|consensus350 99.86
KOG0267|consensus 825 99.86
KOG0268|consensus433 99.86
KOG0264|consensus422 99.86
KOG4283|consensus397 99.86
KOG2445|consensus361 99.86
KOG0639|consensus705 99.85
KOG4283|consensus397 99.85
KOG0269|consensus 839 99.85
KOG1274|consensus 933 99.85
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.84
KOG0302|consensus440 99.84
KOG1446|consensus311 99.83
KOG0299|consensus479 99.83
KOG2055|consensus514 99.83
KOG1539|consensus910 99.83
KOG2048|consensus691 99.83
KOG0267|consensus 825 99.83
KOG2106|consensus626 99.83
KOG2096|consensus420 99.82
KOG1445|consensus 1012 99.81
KOG0639|consensus705 99.81
KOG1034|consensus385 99.8
KOG1274|consensus 933 99.8
KOG0302|consensus440 99.8
KOG1273|consensus405 99.8
KOG2055|consensus514 99.8
KOG2048|consensus691 99.8
KOG1273|consensus405 99.79
KOG2106|consensus626 99.79
KOG1036|consensus323 99.78
KOG4328|consensus498 99.78
KOG0307|consensus 1049 99.78
KOG0270|consensus463 99.77
KOG0646|consensus476 99.77
KOG1063|consensus764 99.77
KOG0642|consensus577 99.76
KOG0647|consensus347 99.76
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 99.76
KOG0270|consensus463 99.76
KOG2445|consensus361 99.76
KOG1009|consensus434 99.76
KOG4378|consensus673 99.75
KOG0303|consensus472 99.74
KOG1408|consensus1080 99.74
COG2319466 FOG: WD40 repeat [General function prediction only 99.73
KOG0650|consensus733 99.72
KOG1007|consensus370 99.71
KOG2919|consensus406 99.71
KOG4328|consensus498 99.71
KOG0322|consensus323 99.7
KOG0321|consensus720 99.7
KOG0649|consensus325 99.7
KOG1034|consensus385 99.69
KOG0642|consensus577 99.69
KOG1334|consensus559 99.68
KOG4378|consensus673 99.68
KOG0307|consensus 1049 99.68
KOG1188|consensus376 99.67
KOG0644|consensus 1113 99.67
KOG1009|consensus434 99.66
KOG1538|consensus 1081 99.66
KOG1517|consensus1387 99.66
KOG1963|consensus792 99.66
KOG4227|consensus609 99.66
COG2319466 FOG: WD40 repeat [General function prediction only 99.64
KOG1538|consensus 1081 99.64
KOG1517|consensus1387 99.64
KOG0290|consensus364 99.63
PRK11028330 6-phosphogluconolactonase; Provisional 99.62
KOG2999|consensus713 99.61
KOG2919|consensus406 99.61
KOG0303|consensus472 99.6
KOG0290|consensus364 99.59
PRK01742429 tolB translocation protein TolB; Provisional 99.58
KOG1007|consensus370 99.57
KOG1240|consensus1431 99.57
KOG1310|consensus758 99.56
KOG1523|consensus361 99.54
KOG1587|consensus555 99.54
KOG0771|consensus398 99.54
KOG1445|consensus1012 99.54
KOG1524|consensus737 99.54
KOG0649|consensus325 99.53
KOG1524|consensus737 99.5
KOG1310|consensus758 99.5
KOG4497|consensus447 99.49
KOG1188|consensus376 99.49
KOG1240|consensus1431 99.45
KOG1963|consensus792 99.45
KOG0322|consensus323 99.44
KOG0644|consensus 1113 99.42
KOG0771|consensus398 99.42
KOG1587|consensus555 99.41
KOG2321|consensus703 99.41
PRK01742429 tolB translocation protein TolB; Provisional 99.4
PF11841160 DUF3361: Domain of unknown function (DUF3361) 99.4
KOG4497|consensus447 99.39
PRK11028330 6-phosphogluconolactonase; Provisional 99.37
PRK02889427 tolB translocation protein TolB; Provisional 99.36
KOG2139|consensus445 99.36
KOG4227|consensus609 99.35
KOG1523|consensus361 99.32
PRK03629429 tolB translocation protein TolB; Provisional 99.32
KOG2110|consensus391 99.32
KOG2394|consensus636 99.3
PRK05137435 tolB translocation protein TolB; Provisional 99.29
PRK04922433 tolB translocation protein TolB; Provisional 99.29
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.28
KOG1272|consensus545 99.28
KOG2111|consensus346 99.27
KOG3881|consensus412 99.26
KOG2394|consensus636 99.26
KOG2110|consensus391 99.25
KOG2111|consensus346 99.25
KOG0974|consensus 967 99.24
KOG1354|consensus433 99.22
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.21
PRK02889427 tolB translocation protein TolB; Provisional 99.21
PF08662194 eIF2A: Eukaryotic translation initiation factor eI 99.2
PRK05137435 tolB translocation protein TolB; Provisional 99.15
KOG1334|consensus559 99.15
KOG3881|consensus412 99.14
PRK03629429 tolB translocation protein TolB; Provisional 99.12
PRK04922433 tolB translocation protein TolB; Provisional 99.12
KOG2139|consensus445 99.1
KOG1272|consensus545 99.09
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 99.07
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 99.06
KOG1064|consensus2439 99.06
KOG2315|consensus566 99.06
KOG1354|consensus433 99.05
PRK04792448 tolB translocation protein TolB; Provisional 99.05
KOG1409|consensus404 99.04
KOG2315|consensus566 99.04
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 99.03
KOG2041|consensus 1189 99.02
PRK00178430 tolB translocation protein TolB; Provisional 99.0
PRK01029428 tolB translocation protein TolB; Provisional 99.0
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 98.99
KOG4547|consensus541 98.98
PRK01029428 tolB translocation protein TolB; Provisional 98.98
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 98.97
KOG0974|consensus 967 98.96
KOG4547|consensus541 98.96
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.94
KOG4190|consensus1034 98.92
KOG2321|consensus703 98.9
KOG2314|consensus698 98.86
KOG0309|consensus 1081 98.83
KOG0309|consensus 1081 98.83
PRK00178430 tolB translocation protein TolB; Provisional 98.83
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.81
KOG4190|consensus1034 98.81
KOG0280|consensus339 98.77
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 98.76
PRK04792448 tolB translocation protein TolB; Provisional 98.74
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.72
KOG0280|consensus339 98.7
PLN029191057 haloacid dehalogenase-like hydrolase family protei 98.7
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.69
PF04762 928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.67
KOG1064|consensus2439 98.66
KOG4532|consensus344 98.64
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.61
KOG3914|consensus390 98.6
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.6
COG4946668 Uncharacterized protein related to the periplasmic 98.57
KOG1409|consensus404 98.56
KOG1832|consensus1516 98.53
KOG2041|consensus 1189 98.52
COG2706346 3-carboxymuconate cyclase [Carbohydrate transport 98.52
COG5170460 CDC55 Serine/threonine protein phosphatase 2A, reg 98.51
PRK04043419 tolB translocation protein TolB; Provisional 98.5
KOG1275|consensus 1118 98.49
KOG4532|consensus344 98.48
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 98.47
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 98.44
COG5354561 Uncharacterized protein, contains Trp-Asp (WD) rep 98.42
KOG2695|consensus425 98.38
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 98.37
KOG1912|consensus 1062 98.35
KOG2314|consensus698 98.33
COG4946668 Uncharacterized protein related to the periplasmic 98.3
KOG2066|consensus 846 98.27
PRK04043419 tolB translocation protein TolB; Provisional 98.26
PF04762928 IKI3: IKI3 family; InterPro: IPR006849 Members of 98.25
KOG0882|consensus558 98.24
KOG4714|consensus319 98.23
KOG3914|consensus390 98.23
KOG1912|consensus 1062 98.19
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.19
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 98.15
PF0040039 WD40: WD domain, G-beta repeat; InterPro: IPR01978 98.14
KOG4714|consensus319 98.07
KOG1832|consensus1516 98.01
KOG2695|consensus425 98.0
KOG2114|consensus 933 97.98
KOG1645|consensus463 97.97
PF07433305 DUF1513: Protein of unknown function (DUF1513); In 97.94
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.93
KOG2114|consensus 933 97.92
KOG0882|consensus558 97.89
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.85
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.85
KOG2066|consensus 846 97.84
KOG1920|consensus 1265 97.82
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.77
KOG1008|consensus783 97.74
PF15492282 Nbas_N: Neuroblastoma-amplified sequence, N termin 97.72
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.66
PF11768545 DUF3312: Protein of unknown function (DUF3312); In 97.64
KOG1008|consensus 783 97.63
KOG3617|consensus 1416 97.62
KOG1920|consensus 1265 97.53
KOG1275|consensus 1118 97.5
KOG3617|consensus 1416 97.45
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 97.43
KOG1645|consensus463 97.35
PRK02888635 nitrous-oxide reductase; Validated 97.33
KOG4649|consensus354 97.31
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.24
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.19
PF06977248 SdiA-regulated: SdiA-regulated; InterPro: IPR00972 97.19
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 97.15
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 97.06
COG3490366 Uncharacterized protein conserved in bacteria [Fun 97.05
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 97.04
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 97.02
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.97
KOG3621|consensus726 96.88
PRK02888635 nitrous-oxide reductase; Validated 96.88
COG3391381 Uncharacterized conserved protein [Function unknow 96.86
COG3391381 Uncharacterized conserved protein [Function unknow 96.85
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 96.73
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.67
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 96.67
PF08553794 VID27: VID27 cytoplasmic protein; InterPro: IPR013 96.58
smart0032040 WD40 WD40 repeats. Note that these repeats are per 96.58
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.56
KOG4649|consensus354 96.55
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.52
KOG3621|consensus 726 96.51
PF04053443 Coatomer_WDAD: Coatomer WD associated region ; Int 96.48
COG0823425 TolB Periplasmic component of the Tol biopolymer t 96.35
KOG2395|consensus644 96.23
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 96.22
KOG4640|consensus665 96.18
PF00930353 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-termin 96.11
COG3386307 Gluconolactonase [Carbohydrate transport and metab 96.09
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 96.07
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 96.05
KOG1897|consensus1096 96.03
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 95.99
KOG4640|consensus665 95.98
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 95.87
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 95.72
KOG2079|consensus 1206 95.55
KOG2395|consensus644 95.38
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 95.34
PRK13616591 lipoprotein LpqB; Provisional 95.14
KOG2079|consensus 1206 95.06
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 95.04
PRK13616591 lipoprotein LpqB; Provisional 94.81
PF05694461 SBP56: 56kDa selenium binding protein (SBP56); Int 94.8
COG3204316 Uncharacterized protein conserved in bacteria [Fun 94.78
KOG2444|consensus238 94.76
COG3386307 Gluconolactonase [Carbohydrate transport and metab 94.71
PF08596395 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; 94.61
PF14583386 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C 94.57
PF00780275 CNH: CNH domain; InterPro: IPR001180 Based on sequ 94.45
cd00216488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 94.4
PF14783111 BBS2_Mid: Ciliary BBSome complex subunit 2, middle 94.39
PF15390671 DUF4613: Domain of unknown function (DUF4613) 94.32
PF04841410 Vps16_N: Vps16, N-terminal region; InterPro: IPR00 93.92
KOG4441|consensus571 93.38
COG3204316 Uncharacterized protein conserved in bacteria [Fun 93.26
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 93.23
TIGR03118336 PEPCTERM_chp_1 conserved hypothetical protein TIGR 93.16
COG3490366 Uncharacterized protein conserved in bacteria [Fun 93.09
KOG4499|consensus310 93.0
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 92.48
COG3823262 Glutamine cyclotransferase [Posttranslational modi 92.37
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 92.31
TIGR03075527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 91.98
KOG2444|consensus238 91.84
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 91.71
KOG1916|consensus 1283 91.38
PHA02713557 hypothetical protein; Provisional 90.97
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 90.68
TIGR03074764 PQQ_membr_DH membrane-bound PQQ-dependent dehydrog 90.21
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 90.06
PF15390671 DUF4613: Domain of unknown function (DUF4613) 89.89
PF14761215 HPS3_N: Hermansky-Pudlak syndrome 3 89.73
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 89.32
PF1289447 Apc4_WD40: Anaphase-promoting complex subunit 4 WD 89.3
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 89.09
PF12234631 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR0 88.99
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 88.61
KOG2280|consensus 829 88.31
PF13449326 Phytase-like: Esterase-like activity of phytase 88.05
PF10647253 Gmad1: Lipoprotein LpqB beta-propeller domain; Int 87.33
KOG1897|consensus1096 87.05
PHA02713557 hypothetical protein; Provisional 86.92
KOG4499|consensus310 86.47
PF14655415 RAB3GAP2_N: Rab3 GTPase-activating protein regulat 85.93
COG5167776 VID27 Protein involved in vacuole import and degra 85.71
COG5167776 VID27 Protein involved in vacuole import and degra 85.43
PF1031343 DUF2415: Uncharacterised protein domain (DUF2415); 84.95
PRK10115686 protease 2; Provisional 84.82
TIGR02604367 Piru_Ver_Nterm putative membrane-bound dehydrogena 84.22
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 83.99
COG5290 1243 IkappaB kinase complex, IKAP component [Transcript 83.84
PF07995331 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: 83.71
PF08728717 CRT10: CRT10; InterPro: IPR014839 CRT10 is a trans 83.51
KOG2247|consensus615 83.51
KOG4460|consensus741 83.34
KOG4441|consensus571 83.1
PHA03098534 kelch-like protein; Provisional 82.75
PF14727418 PHTB1_N: PTHB1 N-terminus 82.45
PF11715547 Nup160: Nucleoporin Nup120/160; InterPro: IPR02171 81.34
>KOG0282|consensus Back     alignment and domain information
Probab=100.00  E-value=4.7e-71  Score=594.92  Aligned_cols=457  Identities=45%  Similarity=0.811  Sum_probs=407.9

Q ss_pred             cCCcccccc-cccccccCCCCceeeeCcccccccCCCCCCCCCCcchhhhccccccccceeeeccChhhhhhhcccceec
Q psy307           41 ATPAVIPKV-MESSNLTDVNTKEITKNLRYEELYAPEYGPVNPFLTQQQRADKNTLSGFVEQAHINSFQFENQRRTFASY  119 (1019)
Q Consensus        41 ~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  119 (1019)
                      .+|+|..+. +.+...+||+++|+.|||+|++||+|+.||+|||++.++                               
T Consensus        29 ~~~aV~~~~~~~~v~~~dp~~ke~~~np~~~~l~~p~~Gp~n~f~s~q~-------------------------------   77 (503)
T KOG0282|consen   29 IVTAVESKSAIRQVAIVDPKTKEIKSNPKFDQLFKPESGPVNHFKSEQQ-------------------------------   77 (503)
T ss_pred             cchhhccccccccccccCCcchhhccCCchhhhcccccCCCCcchhhhh-------------------------------
Confidence            344577776 778899999999999999999999999999999999887                               


Q ss_pred             ccccCCCCcccccccccCcCCCCCcccccccCCCcccccccCCCCCCCcccccCCccccccccccccccccCCCcccccc
Q psy307          120 GYALDPSSEVESKVIGASTSGDKNKTVFESTSKRPLDKRKRNRNDCPEDIEGFLGPFENQRRTFASYGYALDPSSEVESK  199 (1019)
Q Consensus       120 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~q~~~~~~~g~~~~p~~~~~~~  199 (1019)
                                 ..+||+.+.                                                            
T Consensus        78 -----------~~~vg~~~~------------------------------------------------------------   86 (503)
T KOG0282|consen   78 -----------TRFVGDVKK------------------------------------------------------------   86 (503)
T ss_pred             -----------hhhccchhh------------------------------------------------------------
Confidence                       113344333                                                            


Q ss_pred             eecccccCCCCcceeccCCCCcccccccccCCCCCccCCCcCCCCccccccccCCCChhhHHHHHHHHHHHhhccccc--
Q psy307          200 VIGASMSGDKNKTVFESTSKRPLDKRKRNRNDCPEDIEGFLGPWGGYTDEEKVSRPNEAQAAELEEYLAKKQKKGKQS--  277 (1019)
Q Consensus       200 ~~~~~~~~~~~~~~~~~~~~~~~~k~kr~~~~~~~~~~~~~g~w~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--  277 (1019)
                           ++.+.|.++|+.+. +..++|||++++|+++++|+.|||++|.+|..+.++++++..++|++..++++++++.  
T Consensus        87 -----ae~~~g~t~fe~~~-k~~~~Rk~~~~dd~~~idg~~gpWsr~~dE~~vak~~~~~~~~~de~~~k~~e~~~~~e~  160 (503)
T KOG0282|consen   87 -----AEAEKGVSLFESKK-KGGEQRKRVGNDDSADIDGYSGPWSRYVDEKTVAKPTPEEQKQMDEIVKKRQEKKKEKED  160 (503)
T ss_pred             -----hhcccCceeecccc-cccchhhhccCCChhhccCCCCCcccccccccccCCCcchhhhhhhhhhhhhhhcccccc
Confidence                 34456777877755 5677888899999999999999999999999999999999999999888777764433  


Q ss_pred             cCCcccccceecccCCCCCCCCeeeeCCCCCceeeecCCCCCCccCCccceeeeccCCCCeEEEEEcCCCCcEEEEeeCC
Q psy307          278 EEKPLEEKTILHIKDPTDYQGRSFLHPPHDVGTNLRSDTPPDRCFLPKTQVHTWEGHTKGISAIRWFPKSAHLLLSCSMD  357 (1019)
Q Consensus       278 ~~~~~~~~~~~~~~~~~~~~gr~~~~~~~D~~v~lw~~~~~~~~~lp~~~i~~l~gH~~~V~~i~fspd~g~lLaSgs~D  357 (1019)
                      ++..-++.+++|+++.++|+||.+++.|.|..|+++    +.+|++|++.+++|.||+.+|+++.|+|..+++|++|+.|
T Consensus       161 ~~~~~ee~s~~h~k~~~dyq~r~~l~~P~dv~vnlR----~~rc~~Pkk~~~~~~gH~kgvsai~~fp~~~hLlLS~gmD  236 (503)
T KOG0282|consen  161 SEHMAEESSTLHGKSLFDYQGRSYLQKPKDVGVNLR----EERCYLPKKLSHNLSGHTKGVSAIQWFPKKGHLLLSGGMD  236 (503)
T ss_pred             ccccccccccccccchhhccccccccCCcccCCccc----cceeeccHhheeeccCCccccchhhhccceeeEEEecCCC
Confidence            344567889999999999999999999999999998    6789999999999999999999999999889999999999


Q ss_pred             CeEEEEecCCCcEEEEEecccCccEeEEEEcCCCCceeEEEeecCCCCcEEEEEeCCCcEEEEEccCCCeEEEEEccccc
Q psy307          358 CRVKLWEVYKERRCVRTYYGHRQAVRDICFNNTGTNFISAIRWFPKSAHLLLSCSMDCRVKLWEVYKEHRCVRTYYGHRQ  437 (1019)
Q Consensus       358 g~I~IWdl~~~~~~~~~~~gh~~~V~~i~fspdg~~~vs~i~~~p~~~~~L~sgs~Dg~I~IWDl~~~~~~~~~l~~H~~  437 (1019)
                      +.|+||+++..++|++++.||..+|.+++|+++|              ..++|+|.|+.|++||+ .+++++..+. -..
T Consensus       237 ~~vklW~vy~~~~~lrtf~gH~k~Vrd~~~s~~g--------------~~fLS~sfD~~lKlwDt-ETG~~~~~f~-~~~  300 (503)
T KOG0282|consen  237 GLVKLWNVYDDRRCLRTFKGHRKPVRDASFNNCG--------------TSFLSASFDRFLKLWDT-ETGQVLSRFH-LDK  300 (503)
T ss_pred             ceEEEEEEecCcceehhhhcchhhhhhhhccccC--------------Ceeeeeecceeeeeecc-ccceEEEEEe-cCC
Confidence            9999999999999999999999999999999999              68999999999999999 6666666653 234


Q ss_pred             cEeEEEEecCC-CEEEEEEcCCeEEEEECCCCceEEEEecC-CceEEEEEecCCCeeee------------ccCCCceee
Q psy307          438 AVRDICFNNTG-TNFISAGYDRYLKLWDTESGECISRFTSR-KVAYCVKFHPDEDKQHL------------DIPVDMKYI  503 (1019)
Q Consensus       438 ~V~sl~fspdg-~~l~S~s~Dg~I~lWDl~t~~~i~~~~~~-~~v~~v~~~p~~~~~~~------------~~~~~~~~i  503 (1019)
                      .+.|+.|+|++ +.|++|+.|+.|+.||+++++.++.+..+ ..+..+.|-+++...+.            .+++.++.+
T Consensus       301 ~~~cvkf~pd~~n~fl~G~sd~ki~~wDiRs~kvvqeYd~hLg~i~~i~F~~~g~rFissSDdks~riWe~~~~v~ik~i  380 (503)
T KOG0282|consen  301 VPTCVKFHPDNQNIFLVGGSDKKIRQWDIRSGKVVQEYDRHLGAILDITFVDEGRRFISSSDDKSVRIWENRIPVPIKNI  380 (503)
T ss_pred             CceeeecCCCCCcEEEEecCCCcEEEEeccchHHHHHHHhhhhheeeeEEccCCceEeeeccCccEEEEEcCCCccchhh
Confidence            57889999999 78999999999999999999988777655 66778888877765443            677888899


Q ss_pred             eCCCCCcccEEEEcCCCCEEEEEecCCeEEEEEccCcccccceeEEeccccccceEEEEEcCCCCEEEEEeCCCeEEEEe
Q psy307          504 ADPTMHSMPAVTSSPNNKWLACQSMDNKILIFSALNRFKLNRKKTFEGHMVAGYACSLDFSPDMSYLISGDADGKCYIWD  583 (1019)
Q Consensus       504 ~~~~~~~i~~v~~spdg~~Lasgs~Dg~I~iwd~~~~~~~~~~~~l~gh~~~~~V~~v~fspdg~~Lasgs~DG~I~IWD  583 (1019)
                      ..+.++.++++..+|+++++++.+.|+.|.+|.+...++++..+.+.||..+|+.+.+.|||||++|++|+.||.+.+||
T Consensus       381 ~~~~~hsmP~~~~~P~~~~~~aQs~dN~i~ifs~~~~~r~nkkK~feGh~vaGys~~v~fSpDG~~l~SGdsdG~v~~wd  460 (503)
T KOG0282|consen  381 ADPEMHTMPCLTLHPNGKWFAAQSMDNYIAIFSTVPPFRLNKKKRFEGHSVAGYSCQVDFSPDGRTLCSGDSDGKVNFWD  460 (503)
T ss_pred             cchhhccCcceecCCCCCeehhhccCceEEEEecccccccCHhhhhcceeccCceeeEEEcCCCCeEEeecCCccEEEee
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeeeeeccCCCEEEEEEcCCCCcEEEEEeCCCcEEEE
Q psy307          584 WKTTKLFKKWKAHDGVCISTLWHPHEPSKVVTAGWDAATAKV  625 (1019)
Q Consensus       584 l~t~~~l~~l~~h~~~V~sl~~sp~~~~~l~s~s~Dg~I~iw  625 (1019)
                      +++.+++..+++|+++|+.+.|||..++.|||||+||.|++|
T Consensus       461 wkt~kl~~~lkah~~~ci~v~wHP~e~Skvat~~w~G~Ikiw  502 (503)
T KOG0282|consen  461 WKTTKLVSKLKAHDQPCIGVDWHPVEPSKVATCGWDGLIKIW  502 (503)
T ss_pred             chhhhhhhccccCCcceEEEEecCCCcceeEecccCceeEec
Confidence            999999999999999999999999999999999999999887



>KOG2999|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0271|consensus Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG2998|consensus Back     alignment and domain information
>PF04727 ELMO_CED12: ELMO/CED-12 family; InterPro: IPR006816 This entry represents the ELMO (EnguLfment and Cell MOtility) domain, which is found in a number of eukaryotic proteins involved in the cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility, including CED-12, ELMO-1 and ELMO-2 Back     alignment and domain information
>KOG0272|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0279|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0286|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0263|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0284|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>KOG0295|consensus Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0273|consensus Back     alignment and domain information
>KOG0318|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>KOG0306|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>KOG0285|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>KOG0319|consensus Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>KOG0282|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0645|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>KOG0281|consensus Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0276|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0292|consensus Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0265|consensus Back     alignment and domain information
>KOG0772|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0313|consensus Back     alignment and domain information
>KOG0293|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0973|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>KOG0275|consensus Back     alignment and domain information
>KOG0283|consensus Back     alignment and domain information
>KOG0643|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG0640|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0308|consensus Back     alignment and domain information
>KOG0278|consensus Back     alignment and domain information
>KOG0277|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0274|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG0288|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>KOG1407|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG0305|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0300|consensus Back     alignment and domain information
>KOG0301|consensus Back     alignment and domain information
>KOG0294|consensus Back     alignment and domain information
>KOG0641|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG0268|consensus Back     alignment and domain information
>KOG0264|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG4283|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG1446|consensus Back     alignment and domain information
>KOG0299|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG1539|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG0267|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG2096|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG0639|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG1274|consensus Back     alignment and domain information
>KOG0302|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>KOG2048|consensus Back     alignment and domain information
>KOG1273|consensus Back     alignment and domain information
>KOG2106|consensus Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG1063|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG0647|consensus Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>KOG0270|consensus Back     alignment and domain information
>KOG2445|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG1408|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG0650|consensus Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG4328|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG0321|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1034|consensus Back     alignment and domain information
>KOG0642|consensus Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG4378|consensus Back     alignment and domain information
>KOG0307|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG1009|consensus Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>COG2319 FOG: WD40 repeat [General function prediction only] Back     alignment and domain information
>KOG1538|consensus Back     alignment and domain information
>KOG1517|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2999|consensus Back     alignment and domain information
>KOG2919|consensus Back     alignment and domain information
>KOG0303|consensus Back     alignment and domain information
>KOG0290|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1007|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG1445|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>KOG1524|consensus Back     alignment and domain information
>KOG1310|consensus Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>KOG1188|consensus Back     alignment and domain information
>KOG1240|consensus Back     alignment and domain information
>KOG1963|consensus Back     alignment and domain information
>KOG0322|consensus Back     alignment and domain information
>KOG0644|consensus Back     alignment and domain information
>KOG0771|consensus Back     alignment and domain information
>KOG1587|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PRK01742 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF11841 DUF3361: Domain of unknown function (DUF3361) Back     alignment and domain information
>KOG4497|consensus Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG4227|consensus Back     alignment and domain information
>KOG1523|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>KOG2394|consensus Back     alignment and domain information
>KOG2110|consensus Back     alignment and domain information
>KOG2111|consensus Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF08662 eIF2A: Eukaryotic translation initiation factor eIF2A; InterPro: IPR013979 This entry contains beta propellor domains found in eukaryotic translation initiation factors and TolB domain-containing proteins Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1334|consensus Back     alignment and domain information
>KOG3881|consensus Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG2139|consensus Back     alignment and domain information
>KOG1272|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>KOG1354|consensus Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG2315|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>PRK01029 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>KOG0974|consensus Back     alignment and domain information
>KOG4547|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG4190|consensus Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>KOG0280|consensus Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG1064|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG1409|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG2041|consensus Back     alignment and domain information
>COG2706 3-carboxymuconate cyclase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG5170 CDC55 Serine/threonine protein phosphatase 2A, regulatory subunit [Signal transduction mechanisms] Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG4532|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG5354 Uncharacterized protein, contains Trp-Asp (WD) repeat [General function prediction only] Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF04762 IKI3: IKI3 family; InterPro: IPR006849 Members of this family are components of the elongator multi-subunit component of a novel RNA polymerase II holoenzyme for transcriptional elongation [] Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG3914|consensus Back     alignment and domain information
>KOG1912|consensus Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF00400 WD40: WD domain, G-beta repeat; InterPro: IPR019781 WD-40 repeats (also known as WD or beta-transducin repeats) are short ~40 amino acid motifs, often terminating in a Trp-Asp (W-D) dipeptide Back     alignment and domain information
>KOG4714|consensus Back     alignment and domain information
>KOG1832|consensus Back     alignment and domain information
>KOG2695|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PF07433 DUF1513: Protein of unknown function (DUF1513); InterPro: IPR008311 There are currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG0882|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>PF15492 Nbas_N: Neuroblastoma-amplified sequence, N terminal Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>PF11768 DUF3312: Protein of unknown function (DUF3312); InterPro: IPR024511 This is a eukaryotic family of uncharacterised proteins that contain WD40 repeats Back     alignment and domain information
>KOG1008|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>KOG1920|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG3617|consensus Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF06977 SdiA-regulated: SdiA-regulated; InterPro: IPR009722 This entry represents a conserved region approximately 100 residues long within a number of hypothetical bacterial proteins that may be regulated by SdiA, a member of the LuxR family of transcriptional regulators [] Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PRK02888 nitrous-oxide reductase; Validated Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3391 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF08553 VID27: VID27 cytoplasmic protein; InterPro: IPR013863 This entry represents fungal and plant proteins and contains many hypothetical proteins Back     alignment and domain information
>smart00320 WD40 WD40 repeats Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG4649|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG3621|consensus Back     alignment and domain information
>PF04053 Coatomer_WDAD: Coatomer WD associated region ; InterPro: IPR006692 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>COG0823 TolB Periplasmic component of the Tol biopolymer transport system [Intracellular trafficking and secretion] Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>PF00930 DPPIV_N: Dipeptidyl peptidase IV (DPP IV) N-terminal region; InterPro: IPR002469 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information
>KOG4640|consensus Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>KOG2395|consensus Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>KOG2079|consensus Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PRK13616 lipoprotein LpqB; Provisional Back     alignment and domain information
>PF05694 SBP56: 56kDa selenium binding protein (SBP56); InterPro: IPR008826 This family consists of several eukaryotic selenium binding proteins as well as three sequences from archaea Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>COG3386 Gluconolactonase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF08596 Lgl_C: Lethal giant larvae(Lgl) like, C-terminal; InterPro: IPR013905 The Lethal giant larvae (Lgl) tumour suppressor protein is conserved from yeast to mammals Back     alignment and domain information
>PF14583 Pectate_lyase22: Oligogalacturonate lyase; PDB: 3C5M_C 3PE7_A Back     alignment and domain information
>PF00780 CNH: CNH domain; InterPro: IPR001180 Based on sequence similarities a domain of homology has been identified in the following proteins []: Citron and Citron kinase Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PF14783 BBS2_Mid: Ciliary BBSome complex subunit 2, middle region Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF04841 Vps16_N: Vps16, N-terminal region; InterPro: IPR006926 This protein forms part of the Class C vacuolar protein sorting (Vps) complex Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>COG3204 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>TIGR03118 PEPCTERM_chp_1 conserved hypothetical protein TIGR03118 Back     alignment and domain information
>COG3490 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>COG3823 Glutamine cyclotransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG2444|consensus Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG1916|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR03074 PQQ_membr_DH membrane-bound PQQ-dependent dehydrogenase, glucose/quinate/shikimate family Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>PF15390 DUF4613: Domain of unknown function (DUF4613) Back     alignment and domain information
>PF14761 HPS3_N: Hermansky-Pudlak syndrome 3 Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF12894 Apc4_WD40: Anaphase-promoting complex subunit 4 WD40 domain Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF12234 Rav1p_C: RAVE protein 1 C terminal; InterPro: IPR022033 This domain family is found in eukaryotes, and is typically between 621 and 644 amino acids in length Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>KOG2280|consensus Back     alignment and domain information
>PF13449 Phytase-like: Esterase-like activity of phytase Back     alignment and domain information
>PF10647 Gmad1: Lipoprotein LpqB beta-propeller domain; InterPro: IPR018910 The Gmad1 domain is found associated with IPR019606 from INTERPRO, in bacterial spore formation Back     alignment and domain information
>KOG1897|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4499|consensus Back     alignment and domain information
>PF14655 RAB3GAP2_N: Rab3 GTPase-activating protein regulatory subunit N-terminus Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5167 VID27 Protein involved in vacuole import and degradation [Intracellular trafficking and secretion] Back     alignment and domain information
>PF10313 DUF2415: Uncharacterised protein domain (DUF2415); InterPro: IPR019417 This entry represents a short (30 residues) domain of unknown function found in a family of fungal proteins Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>TIGR02604 Piru_Ver_Nterm putative membrane-bound dehydrogenase domain Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>COG5290 IkappaB kinase complex, IKAP component [Transcription] Back     alignment and domain information
>PF07995 GSDH: Glucose / Sorbosone dehydrogenase; InterPro: IPR012938 Proteins containing this domain are thought to be glucose/sorbosone dehydrogenases Back     alignment and domain information
>PF08728 CRT10: CRT10; InterPro: IPR014839 CRT10 is a transcriptional regulator of ribonucleotide reductase (RNR) genes [] Back     alignment and domain information
>KOG2247|consensus Back     alignment and domain information
>KOG4460|consensus Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PF14727 PHTB1_N: PTHB1 N-terminus Back     alignment and domain information
>PF11715 Nup160: Nucleoporin Nup120/160; InterPro: IPR021717 Nup120 is conserved from fungi to plants to humans, and is homologous with the Nup160 of vertebrates Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1019
2gnq_A336 Structure Of Wdr5 Length = 336 8e-24
2xl2_A334 Wdr5 In Complex With An Rbbp5 Peptide Recruited To 9e-24
3emh_A318 Structural Basis Of Wdr5-Mll Interaction Length = 3 2e-23
4a7j_A318 Symmetric Dimethylation Of H3 Arginine 2 Is A Novel 2e-23
2h9l_A329 Wdr5delta23 Length = 329 2e-23
2h68_A312 Histone H3 Recognition And Presentation By The Wdr5 3e-23
2h13_A317 Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length 3e-23
2h9m_A313 Wdr5 In Complex With Unmodified H3k4 Peptide Length 3e-23
3psl_A318 Fine-Tuning The Stimulation Of Mll1 Methyltransfera 3e-23
3n0d_A315 Crystal Structure Of Wdr5 Mutant (W330f) Length = 3 3e-23
3smr_A312 Crystal Structure Of Human Wd Repeat Domain 5 With 3e-23
3n0e_A315 Crystal Structure Of Wdr5 Mutant (W330y) Length = 3 3e-23
2g9a_A311 Structural Basis For The Specific Recognition Of Me 3e-23
2g99_A308 Structural Basis For The Specific Recognition Of Me 4e-23
3mxx_A315 Crystal Structure Of Wdr5 Mutant (S62a) Length = 31 4e-23
2co0_A315 Wdr5 And Unmodified Histone H3 Complex At 2.25 Angs 4e-23
2cnx_A315 Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2. 4e-23
1vyh_C410 Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 4e-17
3dm0_A694 Maltose Binding Protein Fusion With Rack1 From A. T 8e-13
2ymu_A577 Structure Of A Highly Repetitive Propeller Structur 7e-12
2xzm_R343 Crystal Structure Of The Eukaryotic 40s Ribosomal S 7e-10
2ovp_B445 Structure Of The Skp1-Fbw7 Complex Length = 445 9e-10
4aow_A340 Crystal Structure Of The Human Rack1 Protein At A R 1e-09
2zkq_a317 Structure Of A Mammalian Ribosomal 40s Subunit With 2e-09
3zey_7318 High-resolution Cryo-electron Microscopy Structure 5e-09
3zey_7318 High-resolution Cryo-electron Microscopy Structure 5e-05
3ow8_A321 Crystal Structure Of The Wd Repeat-Containing Prote 1e-08
3fm0_A345 Crystal Structure Of Wd40 Protein Ciao1 Length = 34 2e-08
1trj_A314 Homology Model Of Yeast Rack1 Protein Fitted Into 1 2e-08
3acp_A417 Crystal Structure Of Yeast Rpn14, A Chaperone Of Th 2e-08
3vl1_A420 Crystal Structure Of Yeast Rpn14 Length = 420 2e-08
3rfh_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 4e-08
3jyv_R313 Structure Of The 40s Rrna And Proteins And PE TRNA 4e-08
3rfg_A319 Crystal Structure Of The Yeast Rack1 Dimer In Space 4e-08
3izb_a319 Localization Of The Small Subunit Ribosomal Protein 4e-08
3frx_A319 Crystal Structure Of The Yeast Orthologue Of Rack1, 1e-07
2pbi_B354 The Multifunctional Nature Of Gbeta5RGS9 REVEALED F 1e-07
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 1e-06
1erj_A393 Crystal Structure Of The C-Terminal Wd40 Domain Of 6e-04
3mkq_A814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 3e-06
3mkq_A 814 Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subco 2e-05
3iza_B1263 Structure Of An Apoptosome-Procaspase-9 Card Comple 3e-06
2hes_X330 Cytosolic Iron-sulphur Assembly Protein- 1 Length = 4e-06
3iz6_a380 Localization Of The Small Subunit Ribosomal Protein 4e-06
4a11_B408 Structure Of The Hsddb1-Hscsa Complex Length = 408 5e-06
2ynp_A604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 6e-06
2ynp_A604 Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 6e-05
3a98_B203 Crystal Structure Of The Complex Of The Interacting 7e-06
2vsz_A149 Crystal Structure Of The Elmo1 Ph Domain Length = 1 7e-06
2xyi_A430 Crystal Structure Of Nurf55 In Complex With A H4 Pe 2e-05
3c99_A432 Structural Basis Of Histone H4 Recognition By P55 L 2e-05
3zwl_B369 Structure Of Eukaryotic Translation Initiation Fact 2e-05
2yba_A422 Crystal Structure Of Nurf55 In Complex With Histone 2e-05
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 2e-05
2yno_A310 Yeast Betaprime Cop 1-304h6 Length = 310 6e-05
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 2e-05
2ynn_A304 Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 6e-05
3shf_A1256 Crystal Structure Of The R265s Mutant Of Full-Lengt 2e-05
3sn6_B351 Crystal Structure Of The Beta2 Adrenergic Receptor- 2e-05
2bcj_B340 Crystal Structure Of G Protein-coupled Receptor Kin 2e-05
1gg2_B340 G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Bet 2e-05
1got_B340 Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimer 3e-05
1a0r_B340 Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA- 3e-05
3sfz_A1249 Crystal Structure Of Full-Length Murine Apaf-1 Leng 3e-05
3gfc_A425 Crystal Structure Of Histone-Binding Protein Rbbp4 4e-05
2aq5_A402 Crystal Structure Of Murine Coronin-1 Length = 402 1e-04
2aq5_A402 Crystal Structure Of Murine Coronin-1 Length = 402 5e-04
3cfs_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 2e-04
3jpx_A402 Eed: A Novel Histone Trimethyllysine Binder Within 3e-04
2b4e_A402 Crystal Structure Of Murine Coronin-1: Monoclinic F 4e-04
3cfv_B414 Structural Basis Of The Interaction Of Rbap46RBAP48 4e-04
2qxv_A361 Structural Basis Of Ezh2 Recognition By Eed Length 4e-04
3iiy_A365 Crystal Structure Of Eed In Complex With A Trimethy 5e-04
3jzn_A366 Structure Of Eed In Apo Form Length = 366 5e-04
3iiw_A365 Crystal Structure Of Eed In Complex With A Trimethy 5e-04
1p22_A435 Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex 5e-04
2pm9_A416 Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT O 5e-04
4g56_B357 Crystal Structure Of Full Length Prmt5/mep50 Comple 6e-04
3odt_A313 Crystal Structure Of Wd40 Beta Propeller Domain Of 7e-04
4gga_A420 Structural Analysis Of Human Cdc20 Supports Multi-S 7e-04
4ggd_A431 Structural Analysis Of Human Cdc20 Supports Multisi 7e-04
>pdb|2GNQ|A Chain A, Structure Of Wdr5 Length = 336 Back     alignment and structure

Iteration: 1

Score = 109 bits (272), Expect = 8e-24, Method: Compositional matrix adjust. Identities = 83/281 (29%), Positives = 130/281 (46%), Gaps = 50/281 (17%) Query: 330 TWEGHTKGISAIRWFPKSAHLLLSCSMDCRVKLWEVYKERRCVRTYYGHRQAVRDICFNN 389 T GH GIS + W S +LL+S S D +K+W+V +C++T GH V C N Sbjct: 84 TISGHKLGISDVAWSSDS-NLLVSASDDKTLKIWDV-SSGKCLKTLKGHSNYV--FCCN- 138 Query: 390 TGTNFISAIRWFPKSAHLLLSCSMDCRVKLWEVYKEHRCVRTYYGHRQAVRDICFNNTGT 449 F ++L++S S D V++W+V K +C++T H V + FN G+ Sbjct: 139 -----------FNPQSNLIVSGSFDESVRIWDV-KTGKCLKTLPAHSDPVSAVHFNRDGS 186 Query: 450 NFISAGYDRYLKLWDTESGECISRFTSRKVAYCVKFHPDEDKQHLDIPVDMKYIADPTMH 509 +S+ YD ++WDT SG+C+ D+D PV Sbjct: 187 LIVSSSYDGLCRIWDTASGQCLKTLI------------DDDNP----PVSF--------- 221 Query: 510 SMPAVTSSPNNKWLACQSMDNKILIFSALNRFKLNRKKTFEGHMVAGYACSLDFS-PDMS 568 V SPN K++ ++DN + ++ + K KT+ GH Y +FS Sbjct: 222 ----VKFSPNGKYILAATLDNTLKLW---DYSKGKCLKTYTGHKNEKYCIFANFSVTGGK 274 Query: 569 YLISGDADGKCYIWDWKTTKLFKKWKAHDGVCISTLWHPHE 609 +++SG D YIW+ +T ++ +K + H V IST HP E Sbjct: 275 WIVSGSEDNLVYIWNLQTKEIVQKLQGHTDVVISTACHPTE 315
>pdb|2XL2|A Chain A, Wdr5 In Complex With An Rbbp5 Peptide Recruited To Novel Site Length = 334 Back     alignment and structure
>pdb|3EMH|A Chain A, Structural Basis Of Wdr5-Mll Interaction Length = 318 Back     alignment and structure
>pdb|4A7J|A Chain A, Symmetric Dimethylation Of H3 Arginine 2 Is A Novel Histone Mark That Supports Euchromatin Maintenance Length = 318 Back     alignment and structure
>pdb|2H9L|A Chain A, Wdr5delta23 Length = 329 Back     alignment and structure
>pdb|2H68|A Chain A, Histone H3 Recognition And Presentation By The Wdr5 Module Of The Mll1 Complex Length = 312 Back     alignment and structure
>pdb|2H13|A Chain A, Crystal Structure Of Wdr5HISTONE H3 COMPLEX Length = 317 Back     alignment and structure
>pdb|2H9M|A Chain A, Wdr5 In Complex With Unmodified H3k4 Peptide Length = 313 Back     alignment and structure
>pdb|3PSL|A Chain A, Fine-Tuning The Stimulation Of Mll1 Methyltransferase Activity By A Histone H3 Based Peptide Mimetic Length = 318 Back     alignment and structure
>pdb|3N0D|A Chain A, Crystal Structure Of Wdr5 Mutant (W330f) Length = 315 Back     alignment and structure
>pdb|3SMR|A Chain A, Crystal Structure Of Human Wd Repeat Domain 5 With Compound Length = 312 Back     alignment and structure
>pdb|3N0E|A Chain A, Crystal Structure Of Wdr5 Mutant (W330y) Length = 315 Back     alignment and structure
>pdb|2G9A|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 311 Back     alignment and structure
>pdb|2G99|A Chain A, Structural Basis For The Specific Recognition Of Methylated Histone H3 Lysine 4 By The Wd-40 Protein Wdr5 Length = 308 Back     alignment and structure
>pdb|3MXX|A Chain A, Crystal Structure Of Wdr5 Mutant (S62a) Length = 315 Back     alignment and structure
>pdb|2CO0|A Chain A, Wdr5 And Unmodified Histone H3 Complex At 2.25 Angstrom Length = 315 Back     alignment and structure
>pdb|2CNX|A Chain A, Wdr5 And Histone H3 Lysine 4 Dimethyl Complex At 2.1 Angstrom Length = 315 Back     alignment and structure
>pdb|1VYH|C Chain C, Paf-Ah Holoenzyme: Lis1ALFA2 Length = 410 Back     alignment and structure
>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana Length = 694 Back     alignment and structure
>pdb|2YMU|A Chain A, Structure Of A Highly Repetitive Propeller Structure Length = 577 Back     alignment and structure
>pdb|2XZM|R Chain R, Crystal Structure Of The Eukaryotic 40s Ribosomal Subunit In Complex With Initiation Factor 1. This File Contains The 40s Subunit And Initiation Factor For Molecule 1 Length = 343 Back     alignment and structure
>pdb|2OVP|B Chain B, Structure Of The Skp1-Fbw7 Complex Length = 445 Back     alignment and structure
>pdb|4AOW|A Chain A, Crystal Structure Of The Human Rack1 Protein At A Resolution Of 2.45 Angstrom Length = 340 Back     alignment and structure
>pdb|2ZKQ|AA Chain a, Structure Of A Mammalian Ribosomal 40s Subunit Within An 80s Complex Obtained By Docking Homology Models Of The Rna And Proteins Into An 8.7 A Cryo-Em Map Length = 317 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|3ZEY|7 Chain 7, High-resolution Cryo-electron Microscopy Structure Of The Trypanosoma Brucei Ribosome Length = 318 Back     alignment and structure
>pdb|3OW8|A Chain A, Crystal Structure Of The Wd Repeat-Containing Protein 61 Length = 321 Back     alignment and structure
>pdb|3FM0|A Chain A, Crystal Structure Of Wd40 Protein Ciao1 Length = 345 Back     alignment and structure
>pdb|1TRJ|A Chain A, Homology Model Of Yeast Rack1 Protein Fitted Into 11.7a Cryo-em Map Of Yeast 80s Ribosome Length = 314 Back     alignment and structure
>pdb|3ACP|A Chain A, Crystal Structure Of Yeast Rpn14, A Chaperone Of The 19s Reg Particle Of The Proteasome Length = 417 Back     alignment and structure
>pdb|3VL1|A Chain A, Crystal Structure Of Yeast Rpn14 Length = 420 Back     alignment and structure
>pdb|3RFH|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P21 Length = 319 Back     alignment and structure
>pdb|3JYV|R Chain R, Structure Of The 40s Rrna And Proteins And PE TRNA FOR EUKARYOTIC Ribosome Based On Cryo-Em Map Of Thermomyces Lanuginosus Ribosome At 8.9a Resolution Length = 313 Back     alignment and structure
>pdb|3RFG|A Chain A, Crystal Structure Of The Yeast Rack1 Dimer In Space Group P63 Length = 319 Back     alignment and structure
>pdb|3IZB|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 80s Ribosome Length = 319 Back     alignment and structure
>pdb|3FRX|A Chain A, Crystal Structure Of The Yeast Orthologue Of Rack1, Asc1. Length = 319 Back     alignment and structure
>pdb|2PBI|B Chain B, The Multifunctional Nature Of Gbeta5RGS9 REVEALED FROM ITS CRYSTAL Structure Length = 354 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|1ERJ|A Chain A, Crystal Structure Of The C-Terminal Wd40 Domain Of Tup1 Length = 393 Back     alignment and structure
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure
>pdb|3MKQ|A Chain A, Crystal Structure Of Yeast AlphaBETAPRIME-Cop Subcomplex Of The Copi Vesicular Coat Length = 814 Back     alignment and structure
>pdb|2HES|X Chain X, Cytosolic Iron-sulphur Assembly Protein- 1 Length = 330 Back     alignment and structure
>pdb|3IZ6|AA Chain a, Localization Of The Small Subunit Ribosomal Proteins Into A 5.5 A Cryo-Em Map Of Triticum Aestivum Translating 80s Ribosome Length = 380 Back     alignment and structure
>pdb|4A11|B Chain B, Structure Of The Hsddb1-Hscsa Complex Length = 408 Back     alignment and structure
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|2YNP|A Chain A, Yeast Betaprime Cop 1-604 With Ktktn Motif Length = 604 Back     alignment and structure
>pdb|3A98|B Chain B, Crystal Structure Of The Complex Of The Interacting Regions Of Dock2 And Elmo1 Length = 203 Back     alignment and structure
>pdb|2VSZ|A Chain A, Crystal Structure Of The Elmo1 Ph Domain Length = 149 Back     alignment and structure
>pdb|2XYI|A Chain A, Crystal Structure Of Nurf55 In Complex With A H4 Peptide Length = 430 Back     alignment and structure
>pdb|3C99|A Chain A, Structural Basis Of Histone H4 Recognition By P55 Length = 432 Back     alignment and structure
>pdb|3ZWL|B Chain B, Structure Of Eukaryotic Translation Initiation Factor Eif3i Complex With Eif3b C-Terminus (655-700) Length = 369 Back     alignment and structure
>pdb|2YBA|A Chain A, Crystal Structure Of Nurf55 In Complex With Histone H3 Length = 422 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNO|A Chain A, Yeast Betaprime Cop 1-304h6 Length = 310 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|2YNN|A Chain A, Yeast Betaprime Cop 1-304 With Ktktn Motif Length = 304 Back     alignment and structure
>pdb|3SHF|A Chain A, Crystal Structure Of The R265s Mutant Of Full-Length Murine Apaf-1 Length = 1256 Back     alignment and structure
>pdb|3SN6|B Chain B, Crystal Structure Of The Beta2 Adrenergic Receptor-Gs Protein Complex Length = 351 Back     alignment and structure
>pdb|2BCJ|B Chain B, Crystal Structure Of G Protein-coupled Receptor Kinase 2 In Complex With Galpha-q And Gbetagamma Subunits Length = 340 Back     alignment and structure
>pdb|1GG2|B Chain B, G Protein Heterotrimer Mutant Gi_alpha_1(G203a) Beta_1 Gamma_2 With Gdp Bound Length = 340 Back     alignment and structure
>pdb|1GOT|B Chain B, Heterotrimeric Complex Of A Gt-AlphaGI-Alpha Chimera And The Gt-Beta-Gamma Subunits Length = 340 Back     alignment and structure
>pdb|1A0R|B Chain B, Heterotrimeric Complex Of PhosducinTRANSDUCIN BETA-Gamma Length = 340 Back     alignment and structure
>pdb|3SFZ|A Chain A, Crystal Structure Of Full-Length Murine Apaf-1 Length = 1249 Back     alignment and structure
>pdb|3GFC|A Chain A, Crystal Structure Of Histone-Binding Protein Rbbp4 Length = 425 Back     alignment and structure
>pdb|2AQ5|A Chain A, Crystal Structure Of Murine Coronin-1 Length = 402 Back     alignment and structure
>pdb|2AQ5|A Chain A, Crystal Structure Of Murine Coronin-1 Length = 402 Back     alignment and structure
>pdb|3CFS|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|3JPX|A Chain A, Eed: A Novel Histone Trimethyllysine Binder Within The Eed-Ezh2 Polycomb Complex Length = 402 Back     alignment and structure
>pdb|2B4E|A Chain A, Crystal Structure Of Murine Coronin-1: Monoclinic Form Length = 402 Back     alignment and structure
>pdb|3CFV|B Chain B, Structural Basis Of The Interaction Of Rbap46RBAP48 WITH Histone H4 Length = 414 Back     alignment and structure
>pdb|2QXV|A Chain A, Structural Basis Of Ezh2 Recognition By Eed Length = 361 Back     alignment and structure
>pdb|3IIY|A Chain A, Crystal Structure Of Eed In Complex With A Trimethylated Histone H1k26 Peptide Length = 365 Back     alignment and structure
>pdb|3JZN|A Chain A, Structure Of Eed In Apo Form Length = 366 Back     alignment and structure
>pdb|3IIW|A Chain A, Crystal Structure Of Eed In Complex With A Trimethylated Histone H3k27 Peptide Length = 365 Back     alignment and structure
>pdb|1P22|A Chain A, Structure Of A Beta-Trcp1-Skp1-Beta-Catenin Complex: Destruction Motif Binding And Lysine Specificity On The Scfbeta-Trcp1 Ubiquitin Ligase Length = 435 Back     alignment and structure
>pdb|2PM9|A Chain A, Crystal Structure Of Yeast Sec1331 VERTEX ELEMENT OF THE Copii Vesicular Coat Length = 416 Back     alignment and structure
>pdb|4G56|B Chain B, Crystal Structure Of Full Length Prmt5/mep50 Complexes From Xenopus Laevis Length = 357 Back     alignment and structure
>pdb|3ODT|A Chain A, Crystal Structure Of Wd40 Beta Propeller Domain Of Doa1 Length = 313 Back     alignment and structure
>pdb|4GGA|A Chain A, Structural Analysis Of Human Cdc20 Supports Multi-Site Degron Recognition By ApcC Length = 420 Back     alignment and structure
>pdb|4GGD|A Chain A, Structural Analysis Of Human Cdc20 Supports Multisite Degron Recognition By ApcC. Length = 431 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1019
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 100.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
3ow8_A321 WD repeat-containing protein 61; structural genomi 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
1nr0_A611 Actin interacting protein 1; beta propeller, WD40 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 100.0
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 100.0
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 100.0
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 100.0
4g56_B357 MGC81050 protein; protein arginine methyltransfera 100.0
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 100.0
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 100.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 100.0
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 100.0
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 100.0
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 100.0
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 100.0
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 100.0
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 100.0
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 100.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 100.0
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 100.0
2pm7_B297 Protein transport protein SEC13, protein transport 100.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 100.0
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 100.0
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 100.0
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 100.0
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 100.0
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 100.0
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 100.0
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.98
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 99.98
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.98
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 99.98
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 99.98
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 99.98
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.98
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.98
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.98
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.97
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 99.97
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.97
2j04_B524 YDR362CP, TAU91; beta propeller, type 2 promoters, 99.97
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.97
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 99.97
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 99.97
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 99.97
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 99.97
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 99.97
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.97
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 99.97
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 99.97
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.97
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.97
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.97
3jrp_A379 Fusion protein of protein transport protein SEC13 99.97
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.97
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.97
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 99.97
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.97
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 99.97
2pm7_B297 Protein transport protein SEC13, protein transport 99.97
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.97
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 99.97
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 99.97
2oaj_A902 Protein SNI1; WD40 repeat, beta propeller, endocyt 99.97
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.97
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.97
4e54_B435 DNA damage-binding protein 2; beta barrel, double 99.97
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 99.97
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.97
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 99.97
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.96
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 99.96
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 99.96
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 99.96
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.96
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.96
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 99.96
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 99.96
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 99.96
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.96
3jro_A753 Fusion protein of protein transport protein SEC13 99.96
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 99.96
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 99.95
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.95
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 99.95
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 99.95
3jrp_A379 Fusion protein of protein transport protein SEC13 99.95
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 99.95
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 99.95
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.95
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.95
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 99.94
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 99.94
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.94
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.94
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 99.94
2xyi_A430 Probable histone-binding protein CAF1; transcripti 99.94
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.93
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.93
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 99.93
3jro_A753 Fusion protein of protein transport protein SEC13 99.93
4gq1_A393 NUP37; propeller, transport protein; 2.40A {Schizo 99.93
2j04_A588 TAU60, YPL007P, hypothetical protein YPL007C; beta 99.93
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 99.93
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 99.92
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 99.91
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 99.91
2w18_A356 PALB2, fancn, partner and localizer of BRCA2; fanc 99.91
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 99.9
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 99.89
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.87
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.87
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 99.85
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.84
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.84
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.83
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.83
1nir_A543 Nitrite reductase; hemoprotein, denitrification, d 99.82
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.81
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.81
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 99.8
1k32_A 1045 Tricorn protease; protein degradation, substrate g 99.8
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.8
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.79
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.79
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 99.78
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.78
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 99.77
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 99.77
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.76
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 99.76
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.74
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.73
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 99.73
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.72
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 99.72
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 99.72
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 99.7
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 99.7
2oit_A434 Nucleoporin 214KDA; NH2 terminal domain of NUP214/ 99.69
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.68
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 99.68
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 99.68
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.65
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.65
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 99.63
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.6
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.59
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.58
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.58
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.57
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.53
1jof_A365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 99.53
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.53
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 99.52
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 99.51
2oiz_A361 Aromatic amine dehydrogenase, large subunit; oxido 99.51
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.5
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 99.48
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 99.47
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.45
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 99.44
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.44
3dad_A339 FH1/FH2 domain-containing protein 1; formin, FHOD1 99.39
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.38
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 99.35
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.35
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.34
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 99.33
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.33
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.33
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.32
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 99.27
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 99.27
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 99.24
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 99.24
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 99.24
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 99.23
1qks_A567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 99.22
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 99.19
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 99.18
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 99.17
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 99.17
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 99.17
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 99.14
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 99.13
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.11
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.1
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 99.09
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 99.08
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 99.07
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 99.06
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 99.05
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.01
2qe8_A343 Uncharacterized protein; structural genomics, join 99.0
1xip_A388 Nucleoporin NUP159; beta-propeller, transport prot 99.0
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 98.97
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 98.96
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.89
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 98.88
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 98.88
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.84
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.8
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 98.78
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 98.76
2ece_A462 462AA long hypothetical selenium-binding protein; 98.73
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 98.7
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 98.7
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.64
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 98.63
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 98.61
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.57
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.56
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.52
2qe8_A343 Uncharacterized protein; structural genomics, join 98.5
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.48
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.46
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 98.46
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.45
2hz6_A369 Endoplasmic reticulum to nucleus signalling 1 isof 98.31
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.28
2fp8_A322 Strictosidine synthase; six bladed beta propeller 98.28
1kb0_A677 Quinohemoprotein alcohol dehydrogenase; beta-prope 98.27
1yiq_A689 Quinohemoprotein alcohol dehydrogenase; electron t 98.24
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.23
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 98.19
2p4o_A306 Hypothetical protein; putative lactonase, structur 98.19
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 98.18
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.15
2ece_A462 462AA long hypothetical selenium-binding protein; 98.09
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 98.08
1fwx_A595 Nitrous oxide reductase; beta-propeller domain, cu 98.01
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 98.0
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.92
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.88
3v65_B386 Low-density lipoprotein receptor-related protein; 97.86
4a2l_A795 BT_4663, two-component system sensor histidine kin 97.82
4a2l_A795 BT_4663, two-component system sensor histidine kin 97.8
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 97.8
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.78
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.77
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 97.76
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.72
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.71
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.69
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 97.66
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 97.65
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 97.65
1kv9_A668 Type II quinohemoprotein alcohol dehydrogenase; el 97.64
3qqz_A255 Putative uncharacterized protein YJIK; MCSG, PSI-2 97.6
2xe4_A751 Oligopeptidase B; hydrolase-inhibitor complex, hyd 97.57
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.53
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.49
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 97.48
3v65_B386 Low-density lipoprotein receptor-related protein; 97.46
3v9f_A781 Two-component system sensor histidine kinase/RESP 97.45
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.45
3v9f_A781 Two-component system sensor histidine kinase/RESP 97.36
2fp8_A322 Strictosidine synthase; six bladed beta propeller 97.35
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.35
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 97.35
2p4o_A306 Hypothetical protein; putative lactonase, structur 97.33
1w6s_A599 Methanol dehydrogenase subunit 1; anisotropic, ele 97.31
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 97.3
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 97.26
2ad6_A571 Methanol dehydrogenase subunit 1; PQQ configuratio 97.22
1flg_A582 Protein (quinoprotein ethanol dehydrogenase); supe 97.16
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 97.13
3sov_A318 LRP-6, low-density lipoprotein receptor-related pr 97.11
3kya_A496 Putative phosphatase; structural genomics, joint c 97.04
3p5b_L400 Low density lipoprotein receptor variant; B-propel 97.02
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.98
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 96.9
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 96.88
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 96.86
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 96.72
4hw6_A433 Hypothetical protein, IPT/TIG domain protein; puta 96.7
3s94_A619 LRP-6, low-density lipoprotein receptor-related pr 96.61
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 96.59
2p9w_A334 MAL S 1 allergenic protein; beta propeller; 1.35A 96.55
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 96.5
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 96.48
3m0c_C791 LDL receptor, low-density lipoprotein receptor; pr 96.21
4a0p_A628 LRP6, LRP-6, low-density lipoprotein receptor-rela 96.2
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 96.11
3kya_A496 Putative phosphatase; structural genomics, joint c 95.9
3amr_A355 3-phytase; beta-propeller, phytate, MYO-inositol h 95.88
2ism_A352 Putative oxidoreductase; BL41XU spring-8, bladed b 95.8
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 95.8
3a9g_A354 Putative uncharacterized protein; PQQ dependent de 95.72
3sre_A355 PON1, serum paraoxonase; directed evolution, 6-bla 95.71
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 95.42
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 95.33
3ei3_A1158 DNA damage-binding protein 1; UV-damage, DDB, nucl 95.19
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 94.79
2g8s_A353 Glucose/sorbosone dehydrogenases; bladed beta-prop 94.69
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 94.61
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 94.19
2be1_A339 Serine/threonine-protein kinase/endoribonuclease; 93.93
3pbp_A452 Nucleoporin NUP82; beta-propeller, mRNA export, mR 93.02
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 92.99
1cru_A454 Protein (soluble quinoprotein glucose dehydrogena; 92.91
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 92.72
3ott_A 758 Two-component system sensor histidine kinase; beta 92.61
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 92.32
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 92.29
2xzh_A365 Clathrin heavy chain 1; endocytosis, endocytosis i 92.26
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 91.75
3das_A347 Putative oxidoreductase; aldose sugar dehydrogenas 91.64
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 91.58
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 90.92
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 90.84
1tl2_A236 L10, protein (tachylectin-2); animal lectin, horse 89.72
1bpo_A494 Protein (clathrin); clathrin endocytosis beta-prop 89.36
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 89.3
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 88.93
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 88.5
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 87.87
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 85.96
3s25_A302 Hypothetical 7-bladed beta-propeller-like protein; 85.77
1xi4_A 1630 Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle 85.52
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 82.55
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
Probab=100.00  E-value=1.3e-38  Score=390.20  Aligned_cols=402  Identities=15%  Similarity=0.162  Sum_probs=306.4

Q ss_pred             CCCCCCCeeeeCCCCCceeeecCCCCCCccCCccceeeeccCCCCeEEEEEcCCCCcEEEEeeCCCeEEEEecCC-CcEE
Q psy307          293 PTDYQGRSFLHPPHDVGTNLRSDTPPDRCFLPKTQVHTWEGHTKGISAIRWFPKSAHLLLSCSMDCRVKLWEVYK-ERRC  371 (1019)
Q Consensus       293 ~~~~~gr~~~~~~~D~~v~lw~~~~~~~~~lp~~~i~~l~gH~~~V~~i~fspd~g~lLaSgs~Dg~I~IWdl~~-~~~~  371 (1019)
                      .++++|+.++++. +..+.+|+...       .+...++.+|.+.|++++|+|+ +.+|+||+.||+|+|||+.. ...+
T Consensus        25 ~~spdg~~l~~~~-~~~v~l~~~~~-------~~~~~~~~~h~~~v~~~~~spd-g~~lasg~~d~~v~lWd~~~~~~~~   95 (611)
T 1nr0_A           25 GNTPAGDKIQYCN-GTSVYTVPVGS-------LTDTEIYTEHSHQTTVAKTSPS-GYYCASGDVHGNVRIWDTTQTTHIL   95 (611)
T ss_dssp             EECTTSSEEEEEE-TTEEEEEETTC-------SSCCEEECCCSSCEEEEEECTT-SSEEEEEETTSEEEEEESSSTTCCE
T ss_pred             eeCCCCCEEEeCC-CCEEEEecCCC-------cccCeEecCCCCceEEEEECCC-CcEEEEEeCCCCEEEeECCCCccee
Confidence            4688999999986 56999998753       3457789999999999999996 89999999999999999853 3345


Q ss_pred             EEEecccCccEeEEEEcCCCCcee-------------------------------EEEeecCCCCcEEEEEeCCCcEEEE
Q psy307          372 VRTYYGHRQAVRDICFNNTGTNFI-------------------------------SAIRWFPKSAHLLLSCSMDCRVKLW  420 (1019)
Q Consensus       372 ~~~~~gh~~~V~~i~fspdg~~~v-------------------------------s~i~~~p~~~~~L~sgs~Dg~I~IW  420 (1019)
                      ...+.+|.+.|.+++|+|+|..++                               .+++|+|+.+..|++|+.|++|++|
T Consensus        96 ~~~~~~~~~~v~~v~fs~dg~~l~~~~~~~~~~~~v~~wd~~~~~~~l~gh~~~v~~v~f~p~~~~~l~s~s~D~~v~lw  175 (611)
T 1nr0_A           96 KTTIPVFSGPVKDISWDSESKRIAAVGEGRERFGHVFLFDTGTSNGNLTGQARAMNSVDFKPSRPFRIISGSDDNTVAIF  175 (611)
T ss_dssp             EEEEECSSSCEEEEEECTTSCEEEEEECCSSCSEEEEETTTCCBCBCCCCCSSCEEEEEECSSSSCEEEEEETTSCEEEE
T ss_pred             eEeecccCCceEEEEECCCCCEEEEEECCCCceeEEEEeeCCCCcceecCCCCCceEEEECCCCCeEEEEEeCCCeEEEE
Confidence            667889999999999999987553                               4567888887789999999999999


Q ss_pred             EccCCCeEEEEEccccccEeEEEEecCCCEEEEEEcCCeEEEEECCCCceEEEEe--------cCCceEEEEEecCCCee
Q psy307          421 EVYKEHRCVRTYYGHRQAVRDICFNNTGTNFISAGYDRYLKLWDTESGECISRFT--------SRKVAYCVKFHPDEDKQ  492 (1019)
Q Consensus       421 Dl~~~~~~~~~l~~H~~~V~sl~fspdg~~l~S~s~Dg~I~lWDl~t~~~i~~~~--------~~~~v~~v~~~p~~~~~  492 (1019)
                      |. ...++...+.+|...|.+++|+|+|++|++++.|++|++||+.+++++..+.        +...+.+++|+|++..+
T Consensus       176 d~-~~~~~~~~l~~H~~~V~~v~fspdg~~las~s~D~~i~lwd~~~g~~~~~~~~~~~~~~~h~~~V~~v~~spdg~~l  254 (611)
T 1nr0_A          176 EG-PPFKFKSTFGEHTKFVHSVRYNPDGSLFASTGGDGTIVLYNGVDGTKTGVFEDDSLKNVAHSGSVFGLTWSPDGTKI  254 (611)
T ss_dssp             ET-TTBEEEEEECCCSSCEEEEEECTTSSEEEEEETTSCEEEEETTTCCEEEECBCTTSSSCSSSSCEEEEEECTTSSEE
T ss_pred             EC-CCCeEeeeeccccCceEEEEECCCCCEEEEEECCCcEEEEECCCCcEeeeeccccccccccCCCEEEEEECCCCCEE
Confidence            98 5678888999999999999999999999999999999999999999988883        45689999999998755


Q ss_pred             ee----------ccCCC--------------------------------------------ceeeeCCCCCcccEEEEcC
Q psy307          493 HL----------DIPVD--------------------------------------------MKYIADPTMHSMPAVTSSP  518 (1019)
Q Consensus       493 ~~----------~~~~~--------------------------------------------~~~i~~~~~~~i~~v~~sp  518 (1019)
                      +.          +....                                            .......|...|.+++|+|
T Consensus       255 ~s~s~D~~v~lWd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~s~s~d~~i~~~~~~~~~~~~~~~gh~~~v~~l~~sp  334 (611)
T 1nr0_A          255 ASASADKTIKIWNVATLKVEKTIPVGTRIEDQQLGIIWTKQALVSISANGFINFVNPELGSIDQVRYGHNKAITALSSSA  334 (611)
T ss_dssp             EEEETTSEEEEEETTTTEEEEEEECCSSGGGCEEEEEECSSCEEEEETTCCEEEEETTTTEEEEEECCCSSCEEEEEECT
T ss_pred             EEEeCCCeEEEEeCCCCceeeeecCCCCccceeEEEEEcCCEEEEEeCCCcEEEEeCCCCCcceEEcCCCCCEEEEEEeC
Confidence            43          11110                                            0012235667899999999


Q ss_pred             CCCEEEEEecCCeEEEEEccCcccccce----------------------------e-----------------EEecc-
Q psy307          519 NNKWLACQSMDNKILIFSALNRFKLNRK----------------------------K-----------------TFEGH-  552 (1019)
Q Consensus       519 dg~~Lasgs~Dg~I~iwd~~~~~~~~~~----------------------------~-----------------~l~gh-  552 (1019)
                      +|++|++++.|++|++||+.++......                            +                 .+.++ 
T Consensus       335 dg~~l~s~s~D~~v~~Wd~~~~~~~~~~~~~h~~~v~~~~~s~~~~l~s~s~d~~v~~w~~~~~~~~~~~~~~~~~~~~~  414 (611)
T 1nr0_A          335 DGKTLFSADAEGHINSWDISTGISNRVFPDVHATMITGIKTTSKGDLFTVSWDDHLKVVPAGGSGVDSSKAVANKLSSQP  414 (611)
T ss_dssp             TSSEEEEEETTSCEEEEETTTCCEEECSSCSCSSCEEEEEECTTSCEEEEETTTEEEEECSSSSSSCTTSCCEEECSSCE
T ss_pred             CCCEEEEEeCCCcEEEEECCCCceeeecccCCcceEEEEEECCCCcEEEEEcCCceEEeecCCccccccceeeeecCCCC
Confidence            9999999999999999998754221100                            0                 00000 


Q ss_pred             -------------------------------ccccceEEEEEcCCCCEEEEEeCCCeEEEEeCCCCce--eeeeeccCCC
Q psy307          553 -------------------------------MVAGYACSLDFSPDMSYLISGDADGKCYIWDWKTTKL--FKKWKAHDGV  599 (1019)
Q Consensus       553 -------------------------------~~~~~V~~v~fspdg~~Lasgs~DG~I~IWDl~t~~~--l~~l~~h~~~  599 (1019)
                                                     .....+.+++|+|||++|++|+.||+|+|||+.++..  +.. .+|...
T Consensus       415 ~~~~~s~dg~~~~~~~~~~v~~~~~~~~~~~~~~~~v~~va~spdg~~lasgs~D~~v~lwd~~~~~~~~~~~-~~h~~~  493 (611)
T 1nr0_A          415 LGLAVSADGDIAVAACYKHIAIYSHGKLTEVPISYNSSCVALSNDKQFVAVGGQDSKVHVYKLSGASVSEVKT-IVHPAE  493 (611)
T ss_dssp             EEEEECTTSSCEEEEESSEEEEEETTEEEEEECSSCEEEEEECTTSCEEEEEETTSEEEEEEEETTEEEEEEE-EECSSC
T ss_pred             cEEEEeCCCcEEEEEeCceEEEEeCCceeeeecCCCceEEEEeCCCCEEEEeCCCCeEEEEEccCCceeeeec-cCCCCc
Confidence                                           0013467899999999999999999999999987654  334 689999


Q ss_pred             EEEEEEcCCCCcEEEEEeCCCcEEEEeccceeeeeee--ccccCCceeecccccccchhhhhhhcccccCCCceeEEEee
Q psy307          600 CISTLWHPHEPSKVVTAGWDAATAKVQDANIVKIAVE--MEKQVPQLYQFNQTLTLSSIIQEICSGWSLSDSEQYALQFS  677 (1019)
Q Consensus       600 V~sl~~sp~~~~~l~s~s~Dg~I~iwwd~~i~ki~~e--~~~~v~ql~~l~~~~~LSs~~~~~~~~wsls~~e~~al~~s  677 (1019)
                      |.+++|+|++ .+|++++.|++|++|.-....+....  ...+..                 .+....+++...+++..+
T Consensus       494 v~~v~fspdg-~~las~s~d~~v~~w~~~~~~~~~~~~~~~~H~~-----------------~V~~v~fspdg~~lasgs  555 (611)
T 1nr0_A          494 ITSVAFSNNG-AFLVATDQSRKVIPYSVANNFELAHTNSWTFHTA-----------------KVACVSWSPDNVRLATGS  555 (611)
T ss_dssp             EEEEEECTTS-SEEEEEETTSCEEEEEGGGTTEESCCCCCCCCSS-----------------CEEEEEECTTSSEEEEEE
T ss_pred             eEEEEECCCC-CEEEEEcCCCCEEEEEcCCCCceeeeeeeeeccc-----------------ceeEEEECCCCCEEEEEE
Confidence            9999999998 69999999999977643321222111  000111                 111223333344555555


Q ss_pred             cCCCceEEeccccc--c-----cc-CCceEEEEecCCccHHHHHhhcCCCchhhHHH
Q psy307          678 ETNNKNYITEKNRN--E-----IK-NGSVLRLAFSASKTADDILSKLSDKNASLEEK  726 (1019)
Q Consensus       678 d~~~~~~it~~~~~--~-----I~-ng~Vl~LafSPd~~a~~Ilt~~~d~~i~lw~~  726 (1019)
                      .++...+|......  .     .| .+.|.+++|+|++  + |++++.|++|+||+.
T Consensus       556 ~D~~v~lW~~~~~~~~~~~~~~~h~~~~v~~v~fs~d~--~-l~s~~~D~~i~lW~~  609 (611)
T 1nr0_A          556 LDNSVIVWNMNKPSDHPIIIKGAHAMSSVNSVIWLNET--T-IVSAGQDSNIKFWNV  609 (611)
T ss_dssp             TTSCEEEEETTCTTSCCEEETTSSTTSCEEEEEEEETT--E-EEEEETTSCEEEEEC
T ss_pred             CCCcEEEEECCCcccccchhhccCcccCeeEEEEcCCC--E-EEEecCCCCEEEEec
Confidence            55556666654322  1     25 6889999999998  5 999999999999975



>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2j04_B YDR362CP, TAU91; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>2oaj_A Protein SNI1; WD40 repeat, beta propeller, endocytosis/exocytosis complex; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4gq1_A NUP37; propeller, transport protein; 2.40A {Schizosaccharomyces pombe} PDB: 4gq2_P 4fhl_A 4fhm_A 4fhn_A Back     alignment and structure
>2j04_A TAU60, YPL007P, hypothetical protein YPL007C; beta propeller, type 2 promoters, transcription, hypothetica protein, preinitiation complex, yeast RNA polymerase III; 3.2A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>2w18_A PALB2, fancn, partner and localizer of BRCA2; fanconi anemia, homologous recomination, polymorphism, phosphoprotein, beta-propeller, WD40, nucleus; 1.90A {Homo sapiens} PDB: 3eu7_A Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>2oit_A Nucleoporin 214KDA; NH2 terminal domain of NUP214/CAN, X-RAY crystallography, beta-propeller, structure, mRNA export, NPC assembly, leukemia; HET: MES; 1.65A {Homo sapiens} PDB: 3fmo_A* 3fmp_A* 3fhc_A Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>2oiz_A Aromatic amine dehydrogenase, large subunit; oxidoreductase, tryptophan tryptophyl quinone, H-tunneling; HET: TRQ TSR PG4; 1.05A {Alcaligenes faecalis} PDB: 2agw_A* 2agx_A* 2agl_A* 2agz_A* 2ah0_A* 2ah1_A* 2hj4_A* 2hjb_A* 2i0t_A* 2iup_A* 2iuq_A* 2iur_A* 2iuv_A* 2agy_A* 2ok4_A* 2ok6_A* 2iaa_A* 2h47_A* 2h3x_A* 2hkr_A* ... Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3dad_A FH1/FH2 domain-containing protein 1; formin, FHOD1, GTPase-binding domain, ubiquitin-superfold, armadillo repeats, actin-binding, coiled coil; 2.30A {Homo sapiens} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1xip_A Nucleoporin NUP159; beta-propeller, transport protein; 2.50A {Saccharomyces cerevisiae} SCOP: b.69.14.1 PDB: 3pez_C* 3rrm_C* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>2ece_A 462AA long hypothetical selenium-binding protein; beta propeller, structural genomics, unknown function; 2.00A {Sulfolobus tokodaii} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3qqz_A Putative uncharacterized protein YJIK; MCSG, PSI-2, structural genomics, midwest center for structu genomics, TOLB-like, Ca binding; 2.55A {Escherichia coli} Back     alignment and structure
>2xe4_A Oligopeptidase B; hydrolase-inhibitor complex, hydrolase, protease inhibitor trypanosomes, CLAN SC; HET: FC0 RGL; 1.65A {Leishmania major} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>3sov_A LRP-6, low-density lipoprotein receptor-related protein; beta propeller, protein binding-antagonist complex; HET: NAG FUC; 1.27A {Homo sapiens} PDB: 3soq_A* 3sob_B Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>3s94_A LRP-6, low-density lipoprotein receptor-related protein; WNT, LDL receptor-like protein, dickko YWTD B-propeller, signaling protein; HET: NAG; 2.80A {Homo sapiens} PDB: 4dg6_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>2p9w_A MAL S 1 allergenic protein; beta propeller; 1.35A {Malassezia sympodialis} Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>4a0p_A LRP6, LRP-6, low-density lipoprotein receptor-related protein; signaling, WNT signalling, WNT3A, DKK1, MESD; HET: NAG; 1.90A {Homo sapiens} PDB: 3s2k_A* 3s8z_A* 3s8v_A* Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>3kya_A Putative phosphatase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.77A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3amr_A 3-phytase; beta-propeller, phytate, MYO-inositol hexasulfate, hydrolase-hydrolase inhibitor complex; HET: IHS; 1.25A {Bacillus subtilis} PDB: 3ams_A* 2poo_A 1poo_A 1qlg_A 1h6l_A 1cvm_A Back     alignment and structure
>2ism_A Putative oxidoreductase; BL41XU spring-8, bladed beta-propellor, glucose dehydrogenas structural genomics, NPPSFA; 1.90A {Thermus thermophilus} Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>3a9g_A Putative uncharacterized protein; PQQ dependent dehydrogenase, aldose sugar dehydrogenase, BET propeller fold, oxidoreductase; HET: TRE; 2.39A {Pyrobaculum aerophilum} PDB: 3a9h_A* Back     alignment and structure
>3sre_A PON1, serum paraoxonase; directed evolution, 6-blades-propeller fold, hydrolase; HET: LMT; 1.99A {Artificial gene} PDB: 1v04_A* 3srg_A* Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>3ei3_A DNA damage-binding protein 1; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Homo sapiens} PDB: 3ei1_A* 3ei2_A* 3ei4_A* 4a0l_A* 3e0c_A* 3i7k_A* 3i7h_A* 3i7l_A* 3i7n_A* 3i7o_A* 3i7p_A* 3i89_A* 3i8c_A* 3i8e_A* 2b5l_A 2b5m_A 2hye_A* 4a11_A* 4a0k_C* 4a0a_A* ... Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>2g8s_A Glucose/sorbosone dehydrogenases; bladed beta-propellor, pyrolloquinoline quinone (PQQ), quinoprotein, sugar binding protein; HET: MSE; 1.50A {Escherichia coli K12} Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>2be1_A Serine/threonine-protein kinase/endoribonuclease; transcription; 2.98A {Saccharomyces cerevisiae} Back     alignment and structure
>3pbp_A Nucleoporin NUP82; beta-propeller, mRNA export, mRNP remodelling, nucleocytoplasmic transport, protein transport; HET: PGE; 2.60A {Saccharomyces cerevisiae} PDB: 3tkn_A Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>1cru_A Protein (soluble quinoprotein glucose dehydrogena; beta-propeller, superbarrel; HET: PQQ; 1.50A {Acinetobacter calcoaceticus} SCOP: b.68.2.1 PDB: 1c9u_A* 1cq1_A* 1qbi_A Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3das_A Putative oxidoreductase; aldose sugar dehydrogenase, beta propellor, PQQ, SGDH; HET: MSE ARA PQQ; 1.60A {Streptomyces coelicolor} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>1tl2_A L10, protein (tachylectin-2); animal lectin, horseshoe CRAB, N-acetylglucosamine, beta- propeller, sugar binding protein; HET: NDG; 2.00A {Tachypleus tridentatus} SCOP: b.67.1.1 PDB: 3kif_A* 3kih_A* Back     alignment and structure
>1bpo_A Protein (clathrin); clathrin endocytosis beta-propeller coated-PITS, membrane PR; 2.60A {Rattus norvegicus} SCOP: a.118.1.4 b.69.6.1 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>3s25_A Hypothetical 7-bladed beta-propeller-like protein; structural genomics, joint center F structural genomics, JCSG; 1.88A {Eubacterium rectale} Back     alignment and structure
>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1019
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 8e-35
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 7e-19
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 1e-18
d1vyhc1317 b.69.4.1 (C:92-408) Platelet-activating factor ace 3e-18
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 6e-27
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 3e-18
d1tbga_340 b.69.4.1 (A:) beta1-subunit of the signal-transduc 7e-14
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-20
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 2e-19
d2ovrb2342 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing 1e-16
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 3e-20
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 2e-10
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 5e-08
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 1e-06
d1yfqa_342 b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Bake 0.001
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 3e-19
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 1e-08
d1gxra_337 b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Hum 5e-08
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-18
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 4e-13
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 3e-12
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 1e-09
d1erja_388 b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yea 0.004
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-18
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 2e-10
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 3e-08
d1pgua2287 b.69.4.1 (A:327-613) Actin interacting protein 1 { 4e-08
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 1e-17
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 3e-08
d1p22a2293 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (be 1e-05
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 6e-16
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-09
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-08
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 2e-07
d1nr0a2299 b.69.4.1 (A:313-611) Actin interacting protein 1 { 0.002
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 2e-15
d1nexb2355 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker' 1e-08
d1sq9a_393 b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Bake 5e-15
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 8e-14
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 9e-13
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 1e-06
d1pgua1325 b.69.4.1 (A:2-326) Actin interacting protein 1 {Ba 3e-06
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 5e-13
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 4e-12
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 2e-09
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 7e-06
d1k8kc_371 b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 1e-04
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 5e-13
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 8e-13
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 1e-07
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 3e-05
d1nr0a1311 b.69.4.1 (A:2-312) Actin interacting protein 1 {Ne 4e-05
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 6e-12
d1jmxb_346 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 3e-05
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 5e-10
d1k32a3360 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Ar 5e-08
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 1e-08
d1pbyb_337 b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase 9e-05
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 1e-07
d1l0qa2301 b.69.2.3 (A:1-301) Surface layer protein {Archaeon 2e-04
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 8e-07
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 2e-05
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 5e-04
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 0.003
d2bbkh_355 b.69.2.1 (H:) Methylamine dehydrogenase, H-chain { 0.004
d1qksa2432 b.70.2.1 (A:136-567) C-terminal (heme d1) domain o 1e-06
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 9e-06
d1hzua2426 b.70.2.1 (A:118-543) C-terminal (heme d1) domain o 2e-04
d1ri6a_333 b.69.11.1 (A:) Putative isomerase YbhE {Escherichi 0.001
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure

class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
 Score =  133 bits (334), Expect = 8e-35
 Identities = 69/325 (21%), Positives = 122/325 (37%), Gaps = 49/325 (15%)

Query: 324 PKTQVHTWEGHTKGISAIRWFPKSAHLLLSCSMDCRVKLWEVYKERRCVRTYYGHRQAVR 383
              + +   GH   ++ + + P    +++S S D  +K+W+  +     RT  GH  +V+
Sbjct: 6   RPPEKYALSGHRSPVTRVIFHPVF-SVMVSASEDATIKVWDY-ETGDFERTLKGHTDSVQ 63

Query: 384 DICFNNT----------------------------GTNFISAIRWFPKSAHLLLSCSMDC 415
           DI F+++                            G +   +      +   ++S S D 
Sbjct: 64  DISFDHSGKLLASCSADMTIKLWDFQGFECIRTMHGHDHNVSSVSIMPNGDHIVSASRDK 123

Query: 416 RVKLWEVYKEHRCVRTYYGHRQAVRDICFNNTGTNFISAGYDRYLKLWDTESGECISRFT 475
            +K+WEV +   CV+T+ GHR+ VR +  N  GT   S   D+ +++W   + EC +   
Sbjct: 124 TIKMWEV-QTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQTVRVWVVATKECKAELR 182

Query: 476 S-RKVAYCVKFHPDEDKQHLDIPVDMKYIADPTMHSMPAVTSSPNNKWLACQSMDNKILI 534
             R V  C+ + P+     +                     S     +L   S D  I +
Sbjct: 183 EHRHVVECISWAPESSYSSIS-----------EATGSETKKSGKPGPFLLSGSRDKTIKM 231

Query: 535 FSALNRFKLNRKKTFEGHMVAGYACSLDFSPDMSYLISGDADGKCYIWDWKTTKLFKKWK 594
           +       L    T  GH    +   + F     +++S   D    +WD+K  +  K   
Sbjct: 232 WDVSTGMCL---MTLVGH--DNWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLN 286

Query: 595 AHDGVCISTLWHPHEPSKVVTAGWD 619
           AH+    S  +H   P  VVT   D
Sbjct: 287 AHEHFVTSLDFHKTAP-YVVTGSVD 310


>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Length = 317 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Length = 340 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 388 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 287 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 299 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 355 Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 393 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 325 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Length = 371 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 311 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Length = 346 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 360 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Length = 337 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Length = 301 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Length = 355 Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Length = 432 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Length = 426 Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Length = 333 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1019
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 100.0
d1tbga_340 beta1-subunit of the signal-transducing G protein 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 100.0
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 100.0
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 100.0
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 99.97
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.97
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.97
d1tbga_340 beta1-subunit of the signal-transducing G protein 99.96
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.96
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 99.96
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 99.95
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 99.95
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 99.95
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.95
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 99.95
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.95
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 99.93
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.93
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.93
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 99.93
d1sq9a_393 Antiviral protein Ski8 (Ski8p) {Baker's yeast (Sac 99.93
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.93
d1yfqa_342 Cell cycle arrest protein BUB3 {Baker's yeast (Sac 99.91
d1pgua2287 Actin interacting protein 1 {Baker's yeast (Saccha 99.89
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.87
d1k32a3360 Tricorn protease domain 2 {Archaeon Thermoplasma a 99.86
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.85
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.82
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.81
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.78
d1hzua2426 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.77
d1qksa2432 C-terminal (heme d1) domain of cytochrome cd1-nitr 99.77
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.75
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 99.74
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 99.71
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 99.7
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.65
d1ri6a_333 Putative isomerase YbhE {Escherichia coli [TaxId: 99.62
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.6
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.57
d2madh_373 Methylamine dehydrogenase, H-chain {Gram negative 99.53
d2bbkh_355 Methylamine dehydrogenase, H-chain {Paracoccus den 99.48
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.27
d1mdah_368 Methylamine dehydrogenase, H-chain {Paracoccus den 99.25
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.15
d2bgra1470 Dipeptidyl peptidase IV/CD26, N-terminal domain {P 99.13
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 99.13
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.84
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.83
d1qnia2441 Nitrous oxide reductase, N-terminal domain {Pseudo 98.76
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.75
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.73
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.61
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.59
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.48
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 98.47
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 98.33
d1jofa_365 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neu 98.33
d2hqsa1269 TolB, C-terminal domain {Escherichia coli [TaxId: 98.33
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 98.25
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 98.2
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 98.07
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 98.03
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.82
d1xfda1465 Dipeptidyl aminopeptidase-like protein 6, DPP6, N- 97.74
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.45
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 97.32
d1k32a2281 Tricorn protease N-terminal domain {Archaeon Therm 97.1
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 96.82
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 96.44
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 95.9
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 95.85
d1fwxa2459 Nitrous oxide reductase, N-terminal domain {Paraco 95.7
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 95.23
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 95.06
d1v04a_340 Serum paraoxonase/arylesterase 1, PON1 {Rabit (Ory 94.87
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 93.91
d1qfma1430 Prolyl oligopeptidase, N-terminal domain {Pig (Sus 93.47
d1npea_263 Nidogen {Mouse (Mus musculus) [TaxId: 10090]} 92.77
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 92.37
d1utca2327 Clathrin heavy-chain terminal domain {Rat (Rattus 92.16
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 91.94
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 91.69
d2ad6a1571 Methanol dehydrogenase, heavy chain {Methylophilus 91.29
d1flga_582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 90.63
d1ijqa1266 Low density lipoprotein (LDL) receptor {Human (Hom 90.54
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 90.03
d1xipa_381 Nucleoporin NUP159 {Baker's yeast (Saccharomyces c 88.08
d1w6sa_596 Methanol dehydrogenase, heavy chain {Methylobacter 87.88
d1kv9a2560 Quinoprotein alcohol dehydrogenase, N-terminal dom 86.42
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 84.56
d1kb0a2573 Quinoprotein alcohol dehydrogenase, N-terminal dom 83.67
d1crua_450 Soluble quinoprotein glucose dehydrogenase {Acinet 83.05
d1h6la_353 Thermostable phytase (3-phytase) {Bacillus amyloli 81.22
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: 7-bladed beta-propeller
superfamily: WD40 repeat-like
family: WD40-repeat
domain: Platelet-activating factor acetylhydrolase IB subunit alpha
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=100.00  E-value=1e-33  Score=307.70  Aligned_cols=277  Identities=25%  Similarity=0.444  Sum_probs=235.8

Q ss_pred             eeeeccCCCCeEEEEEcCCCCcEEEEeeCCCeEEEEecCCCcEEEEEecccCccEeEEEEcCCCCceeEE----------
Q psy307          328 VHTWEGHTKGISAIRWFPKSAHLLLSCSMDCRVKLWEVYKERRCVRTYYGHRQAVRDICFNNTGTNFISA----------  397 (1019)
Q Consensus       328 i~~l~gH~~~V~~i~fspd~g~lLaSgs~Dg~I~IWdl~~~~~~~~~~~gh~~~V~~i~fspdg~~~vs~----------  397 (1019)
                      .++|+||+++|++|+|+|+ +.+|+||+.||+|+|||+ ..++++.++.+|...|.+++|++++..++.+          
T Consensus        10 ~~~L~GH~~~I~~l~~sp~-~~~l~s~s~Dg~i~iWd~-~~~~~~~~~~~h~~~V~~~~~~~~~~~~~~~~~~~~~~~~~   87 (317)
T d1vyhc1          10 KYALSGHRSPVTRVIFHPV-FSVMVSASEDATIKVWDY-ETGDFERTLKGHTDSVQDISFDHSGKLLASCSADMTIKLWD   87 (317)
T ss_dssp             SCEEECCSSCEEEEEECSS-SSEEEEEESSSCEEEEET-TTCCCCEEECCCSSCEEEEEECTTSSEEEEEETTSCCCEEE
T ss_pred             cEEEcCCCCCeEEEEEcCC-CCEEEEEeCCCeEEEEEC-CCCCEEEEEeCCCCcEEEEeeeccccccccccccccccccc
Confidence            4689999999999999996 789999999999999999 5567888999999999999999999776543          


Q ss_pred             -------------------EeecCCCCcEEEEEeCCCcEEEEEccCCCeEEEEEccccccEeEEEEecCCCEEEEEEcCC
Q psy307          398 -------------------IRWFPKSAHLLLSCSMDCRVKLWEVYKEHRCVRTYYGHRQAVRDICFNNTGTNFISAGYDR  458 (1019)
Q Consensus       398 -------------------i~~~p~~~~~L~sgs~Dg~I~IWDl~~~~~~~~~l~~H~~~V~sl~fspdg~~l~S~s~Dg  458 (1019)
                                         +.|+|+ +..+++++.|+.+++||+ ..+.....+.+|...+.+++|++++.+|++++.|+
T Consensus        88 ~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~d~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~d~  165 (317)
T d1vyhc1          88 FQGFECIRTMHGHDHNVSSVSIMPN-GDHIVSASRDKTIKMWEV-QTGYCVKTFTGHREWVRMVRPNQDGTLIASCSNDQ  165 (317)
T ss_dssp             TTSSCEEECCCCCSSCEEEEEECSS-SSEEEEEETTSEEEEEET-TTCCEEEEEECCSSCEEEEEECTTSSEEEEEETTS
T ss_pred             ccccccccccccccccceeeeccCC-CceEEeeccCcceeEeec-ccceeeeEEccCCCcceeeecccCCCEEEEEeCCC
Confidence                               334444 467899999999999999 56678888999999999999999999999999999


Q ss_pred             eEEEEECCCCceEEEEecC-CceEEEEEecCCCeeeeccCCCceeeeCCCCCcccEEEEcCCCCEEEEEecCCeEEEEEc
Q psy307          459 YLKLWDTESGECISRFTSR-KVAYCVKFHPDEDKQHLDIPVDMKYIADPTMHSMPAVTSSPNNKWLACQSMDNKILIFSA  537 (1019)
Q Consensus       459 ~I~lWDl~t~~~i~~~~~~-~~v~~v~~~p~~~~~~~~~~~~~~~i~~~~~~~i~~v~~spdg~~Lasgs~Dg~I~iwd~  537 (1019)
                      .|++|++.+++.+..+..+ ..+.++.++|+........           ............+.++++++.|+.|++||+
T Consensus       166 ~v~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~-----------~~~~~~~~~~~~~~~~~~~~~d~~i~~~~~  234 (317)
T d1vyhc1         166 TVRVWVVATKECKAELREHRHVVECISWAPESSYSSISE-----------ATGSETKKSGKPGPFLLSGSRDKTIKMWDV  234 (317)
T ss_dssp             CEEEEETTTCCEEEEECCCSSCEEEEEECCSCGGGGGGG-----------CCSCC-------CCEEEEEETTSEEEEEET
T ss_pred             eEEEEeeccceeeEEEecCCCCceEEEEeeccccceeec-----------cccceeeeeccCCceeEeccCCCEEEEEEC
Confidence            9999999999999888754 6788999998865433221           122233445567889999999999999999


Q ss_pred             cCcccccceeEEeccccccceEEEEEcCCCCEEEEEeCCCeEEEEeCCCCceeeeeeccCCCEEEEEEcCCCCcEEEEEe
Q psy307          538 LNRFKLNRKKTFEGHMVAGYACSLDFSPDMSYLISGDADGKCYIWDWKTTKLFKKWKAHDGVCISTLWHPHEPSKVVTAG  617 (1019)
Q Consensus       538 ~~~~~~~~~~~l~gh~~~~~V~~v~fspdg~~Lasgs~DG~I~IWDl~t~~~l~~l~~h~~~V~sl~~sp~~~~~l~s~s  617 (1019)
                      .++   ..+..+.+|.  ..|.+++|+|+|++|++|+.||.|+|||+.+++++.++.+|.+.|++++|+|++ .+|+|||
T Consensus       235 ~~~---~~~~~~~~~~--~~v~~~~~~~~~~~l~s~~~dg~i~iwd~~~~~~~~~~~~h~~~V~~~~~s~~~-~~l~s~s  308 (317)
T d1vyhc1         235 STG---MCLMTLVGHD--NWVRGVLFHSGGKFILSCADDKTLRVWDYKNKRCMKTLNAHEHFVTSLDFHKTA-PYVVTGS  308 (317)
T ss_dssp             TTT---EEEEEEECCS--SCEEEEEECSSSSCEEEEETTTEEEEECCTTSCCCEEEECCSSCEEEEEECSSS-SCEEEEE
T ss_pred             CCC---cEEEEEeCCC--CCEEEEEECCCCCEEEEEECCCeEEEEECCCCcEEEEEcCCCCCEEEEEEcCCC-CEEEEEe
Confidence            887   4457788887  779999999999999999999999999999999999999999999999999998 6899999


Q ss_pred             CCCcEEEE
Q psy307          618 WDAATAKV  625 (1019)
Q Consensus       618 ~Dg~I~iw  625 (1019)
                      .||+|++|
T Consensus       309 ~Dg~i~iW  316 (317)
T d1vyhc1         309 VDQTVKVW  316 (317)
T ss_dssp             TTSEEEEE
T ss_pred             CCCeEEEe
Confidence            99999877



>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sq9a_ b.69.4.1 (A:) Antiviral protein Ski8 (Ski8p) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yfqa_ b.69.4.2 (A:) Cell cycle arrest protein BUB3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgua2 b.69.4.1 (A:327-613) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2madh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Gram negative methylotrophic bacteria (Thiobacillus versutus) [TaxId: 34007]} Back     information, alignment and structure
>d2bbkh_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1mdah_ b.69.2.1 (H:) Methylamine dehydrogenase, H-chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bgra1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qnia2 b.69.3.1 (A:10-450) Nitrous oxide reductase, N-terminal domain {Pseudomonas nautica [TaxId: 2743]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1jofa_ b.69.10.1 (A:) 3-carboxy-cis,cis-mucoante lactonizing enzyme {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d2hqsa1 b.68.4.1 (A:163-431) TolB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xfda1 b.70.3.1 (A:127-591) Dipeptidyl aminopeptidase-like protein 6, DPP6, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1k32a2 b.68.7.1 (A:39-319) Tricorn protease N-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1fwxa2 b.69.3.1 (A:8-451) Nitrous oxide reductase, N-terminal domain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1v04a_ b.68.6.2 (A:) Serum paraoxonase/arylesterase 1, PON1 {Rabit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1qfma1 b.69.7.1 (A:1-430) Prolyl oligopeptidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1npea_ b.68.5.1 (A:) Nidogen {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1utca2 b.69.6.1 (A:4-330) Clathrin heavy-chain terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ijqa1 b.68.5.1 (A:377-642) Low density lipoprotein (LDL) receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1xipa_ b.69.14.1 (A:) Nucleoporin NUP159 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w6sa_ b.70.1.1 (A:) Methanol dehydrogenase, heavy chain {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1crua_ b.68.2.1 (A:) Soluble quinoprotein glucose dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1h6la_ b.68.3.1 (A:) Thermostable phytase (3-phytase) {Bacillus amyloliquefaciens [TaxId: 1390]} Back     information, alignment and structure