Psyllid ID: psy3109
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 58 | ||||||
| 196006435 | 396 | hypothetical protein TRIADDRAFT_50344 [T | 0.551 | 0.080 | 0.781 | 2e-07 | |
| 193650225 | 400 | PREDICTED: aminoacylase-1A-like [Acyrtho | 0.551 | 0.08 | 0.75 | 9e-07 | |
| 48096676 | 401 | PREDICTED: aminoacylase-1-like [Apis mel | 0.551 | 0.079 | 0.75 | 9e-07 | |
| 383851451 | 508 | PREDICTED: aminoacylase-1-like [Megachil | 0.551 | 0.062 | 0.75 | 9e-07 | |
| 395516946 | 412 | PREDICTED: aminoacylase-1A-like [Sarcoph | 0.551 | 0.077 | 0.75 | 1e-06 | |
| 363738590 | 348 | PREDICTED: aminoacylase-1-like isoform 2 | 0.551 | 0.091 | 0.781 | 1e-06 | |
| 363738588 | 413 | PREDICTED: aminoacylase-1-like isoform 1 | 0.551 | 0.077 | 0.781 | 1e-06 | |
| 326927775 | 392 | PREDICTED: aminoacylase-1-like, partial | 0.551 | 0.081 | 0.781 | 1e-06 | |
| 260798889 | 411 | hypothetical protein BRAFLDRAFT_262219 [ | 0.551 | 0.077 | 0.75 | 3e-06 | |
| 380020424 | 401 | PREDICTED: LOW QUALITY PROTEIN: aminoacy | 0.551 | 0.079 | 0.75 | 3e-06 |
| >gi|196006435|ref|XP_002113084.1| hypothetical protein TRIADDRAFT_50344 [Trichoplax adhaerens] gi|190585125|gb|EDV25194.1| hypothetical protein TRIADDRAFT_50344 [Trichoplax adhaerens] | Back alignment and taxonomy information |
|---|
Score = 59.7 bits (143), Expect = 2e-07, Method: Composition-based stats.
Identities = 25/32 (78%), Positives = 28/32 (87%)
Query: 1 MKCVGIQYLETIRRYIAEGKKFKRTIHVSFVP 32
MKCVGIQY+E IRR EGK+FKRTIH+SFVP
Sbjct: 109 MKCVGIQYIEAIRRLKKEGKRFKRTIHMSFVP 140
|
Source: Trichoplax adhaerens Species: Trichoplax adhaerens Genus: Trichoplax Family: Order: Class: Phylum: Placozoa Superkingdom: Eukaryota |
| >gi|193650225|ref|XP_001951399.1| PREDICTED: aminoacylase-1A-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|48096676|ref|XP_392498.1| PREDICTED: aminoacylase-1-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|383851451|ref|XP_003701246.1| PREDICTED: aminoacylase-1-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|395516946|ref|XP_003762644.1| PREDICTED: aminoacylase-1A-like [Sarcophilus harrisii] | Back alignment and taxonomy information |
|---|
| >gi|363738590|ref|XP_003642034.1| PREDICTED: aminoacylase-1-like isoform 2 [Gallus gallus] | Back alignment and taxonomy information |
|---|
| >gi|363738588|ref|XP_003642033.1| PREDICTED: aminoacylase-1-like isoform 1 [Gallus gallus] | Back alignment and taxonomy information |
|---|
| >gi|326927775|ref|XP_003210064.1| PREDICTED: aminoacylase-1-like, partial [Meleagris gallopavo] | Back alignment and taxonomy information |
|---|
| >gi|260798889|ref|XP_002594432.1| hypothetical protein BRAFLDRAFT_262219 [Branchiostoma floridae] gi|229279666|gb|EEN50443.1| hypothetical protein BRAFLDRAFT_262219 [Branchiostoma floridae] | Back alignment and taxonomy information |
|---|
| >gi|380020424|ref|XP_003694085.1| PREDICTED: LOW QUALITY PROTEIN: aminoacylase-1-like [Apis florea] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 58 | ||||||
| UNIPROTKB|F8WC59 | 201 | ACY1 "Aminoacylase-1" [Homo sa | 0.551 | 0.159 | 0.656 | 6.5e-07 | |
| UNIPROTKB|C9JYZ0 | 228 | ACY1 "Aminoacylase-1" [Homo sa | 0.551 | 0.140 | 0.656 | 1e-06 | |
| UNIPROTKB|F1PHI4 | 408 | ACY1 "Uncharacterized protein" | 0.551 | 0.078 | 0.687 | 1.3e-06 | |
| UNIPROTKB|Q3T0V2 | 373 | ACY1 "Aminoacylase 1" [Bos tau | 0.551 | 0.085 | 0.687 | 2.4e-06 | |
| UNIPROTKB|C9JWD4 | 343 | ACY1 "Aminoacylase-1" [Homo sa | 0.551 | 0.093 | 0.656 | 2.7e-06 | |
| UNIPROTKB|C9J6I6 | 373 | ACY1 "Aminoacylase-1" [Homo sa | 0.551 | 0.085 | 0.656 | 3.1e-06 | |
| UNIPROTKB|Q03154 | 408 | ACY1 "Aminoacylase-1" [Homo sa | 0.551 | 0.078 | 0.656 | 3.6e-06 | |
| UNIPROTKB|F1MR63 | 501 | ACY1 "Uncharacterized protein" | 0.551 | 0.063 | 0.687 | 3.9e-06 | |
| UNIPROTKB|B4DNW0 | 498 | ACY1 "cDNA FLJ60317, highly si | 0.551 | 0.064 | 0.656 | 4.9e-06 | |
| UNIPROTKB|C9JMV9 | 509 | ABHD14A-ACY1 "Protein ABHD14A- | 0.551 | 0.062 | 0.656 | 5.1e-06 |
| UNIPROTKB|F8WC59 ACY1 "Aminoacylase-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 115 (45.5 bits), Expect = 6.5e-07, P = 6.5e-07
Identities = 21/32 (65%), Positives = 25/32 (78%)
Query: 1 MKCVGIQYLETIRRYIAEGKKFKRTIHVSFVP 32
MKCV IQYLE +RR EG +F RTIH++FVP
Sbjct: 114 MKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVP 145
|
|
| UNIPROTKB|C9JYZ0 ACY1 "Aminoacylase-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PHI4 ACY1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q3T0V2 ACY1 "Aminoacylase 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JWD4 ACY1 "Aminoacylase-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9J6I6 ACY1 "Aminoacylase-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q03154 ACY1 "Aminoacylase-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MR63 ACY1 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4DNW0 ACY1 "cDNA FLJ60317, highly similar to Aminoacylase-1 (EC 3.5.1.14)" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9JMV9 ABHD14A-ACY1 "Protein ABHD14A-ACY1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 58 | |||
| cd05646 | 391 | cd05646, M20_AcylaseI_like, M20 Aminoacylase-I lik | 8e-17 | |
| TIGR01880 | 400 | TIGR01880, Ac-peptdase-euk, N-acyl-L-amino-acid am | 9e-14 |
| >gnl|CDD|193524 cd05646, M20_AcylaseI_like, M20 Aminoacylase-I like subfamily | Back alignment and domain information |
|---|
Score = 71.2 bits (175), Expect = 8e-17
Identities = 25/32 (78%), Positives = 26/32 (81%)
Query: 1 MKCVGIQYLETIRRYIAEGKKFKRTIHVSFVP 32
MKCVGIQYLE IRR A G K KRTIH+SFVP
Sbjct: 106 MKCVGIQYLEAIRRLKASGFKPKRTIHLSFVP 137
|
Peptidase M20 family, Aminoacylase-I like (AcyI-like; Acylase I; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14) subfamily. Acylase I is involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate) and is considered as a potential target of antimicrobial agents. Porcine AcyI is also shown to deacetylate certain quorum-sensing N-acylhomoserine lactones, while the rat enzyme has been implicated in degradation of chemotactic peptides of commensal bacteria. Prokaryotic arginine synthesis usually involves the transfer of an acetyl group to glutamate by ornithine acetyltransferase in order to form ornithine. However, Escherichia coli acetylornithine deacetylase (acetylornithinase, ArgE) (EC 3.5.1.16) catalyzes the deacylation of N2-acetyl-L-ornithine to yield ornithine and acetate. Phylogenetic evidence suggests that the clustering of the arg genes in one continuous sequence pattern arose in an ancestor common to Enterobacteriaceae and Vibrionaceae, where ornithine acetyltransferase was lost and replaced by a deacylase. Length = 391 |
| >gnl|CDD|233615 TIGR01880, Ac-peptdase-euk, N-acyl-L-amino-acid amidohydrolase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 58 | |||
| KOG2275|consensus | 420 | 99.31 | ||
| PRK12891 | 414 | allantoate amidohydrolase; Reviewed | 98.86 | |
| PF01546 | 189 | Peptidase_M20: Peptidase family M20/M25/M40 This f | 98.85 | |
| TIGR03176 | 406 | AllC allantoate amidohydrolase. This enzyme cataly | 98.84 | |
| PRK07205 | 444 | hypothetical protein; Provisional | 98.83 | |
| PRK07338 | 402 | hypothetical protein; Provisional | 98.79 | |
| PRK07906 | 426 | hypothetical protein; Provisional | 98.78 | |
| PRK13983 | 400 | diaminopimelate aminotransferase; Provisional | 98.77 | |
| PRK13013 | 427 | succinyl-diaminopimelate desuccinylase; Reviewed | 98.77 | |
| PRK07318 | 466 | dipeptidase PepV; Reviewed | 98.74 | |
| PRK08588 | 377 | succinyl-diaminopimelate desuccinylase; Reviewed | 98.71 | |
| PRK08262 | 486 | hypothetical protein; Provisional | 98.7 | |
| TIGR01880 | 400 | Ac-peptdase-euk N-acyl-L-amino-acid amidohydrolase | 98.7 | |
| PRK12890 | 414 | allantoate amidohydrolase; Reviewed | 98.67 | |
| PRK13009 | 375 | succinyl-diaminopimelate desuccinylase; Reviewed | 98.66 | |
| PRK09104 | 464 | hypothetical protein; Validated | 98.65 | |
| TIGR01246 | 370 | dapE_proteo succinyl-diaminopimelate desuccinylase | 98.65 | |
| TIGR01887 | 447 | dipeptidaselike dipeptidase, putative. This model | 98.64 | |
| PRK07473 | 376 | carboxypeptidase; Provisional | 98.63 | |
| PRK13590 | 591 | putative bifunctional OHCU decarboxylase/allantoat | 98.62 | |
| PRK09133 | 472 | hypothetical protein; Provisional | 98.62 | |
| PRK08596 | 421 | acetylornithine deacetylase; Validated | 98.6 | |
| PRK06156 | 520 | hypothetical protein; Provisional | 98.59 | |
| COG0624 | 409 | ArgE Acetylornithine deacetylase/Succinyl-diaminop | 98.59 | |
| PRK08201 | 456 | hypothetical protein; Provisional | 98.59 | |
| TIGR01910 | 375 | DapE-ArgE acetylornithine deacetylase or succinyl- | 98.58 | |
| PRK09290 | 413 | allantoate amidohydrolase; Reviewed | 98.57 | |
| PRK12893 | 412 | allantoate amidohydrolase; Reviewed | 98.56 | |
| TIGR01886 | 466 | dipeptidase dipeptidase PepV. This model represent | 98.52 | |
| PRK06915 | 422 | acetylornithine deacetylase; Validated | 98.52 | |
| PRK06446 | 436 | hypothetical protein; Provisional | 98.52 | |
| PRK06133 | 410 | glutamate carboxypeptidase; Reviewed | 98.51 | |
| PRK07079 | 469 | hypothetical protein; Provisional | 98.51 | |
| PRK04443 | 348 | acetyl-lysine deacetylase; Provisional | 98.51 | |
| TIGR01883 | 361 | PepT-like peptidase T-like protein. This model rep | 98.51 | |
| PRK13799 | 591 | unknown domain/N-carbamoyl-L-amino acid hydrolase | 98.5 | |
| PRK06837 | 427 | acetylornithine deacetylase; Provisional | 98.48 | |
| TIGR01879 | 401 | hydantase amidase, hydantoinase/carbamoylase famil | 98.44 | |
| PRK05469 | 408 | peptidase T; Provisional | 98.42 | |
| TIGR01882 | 410 | peptidase-T peptidase T. This model represents a t | 98.41 | |
| PRK08554 | 438 | peptidase; Reviewed | 98.41 | |
| PRK13004 | 399 | peptidase; Reviewed | 98.39 | |
| PRK12892 | 412 | allantoate amidohydrolase; Reviewed | 98.39 | |
| PRK08652 | 347 | acetylornithine deacetylase; Provisional | 98.38 | |
| TIGR01900 | 373 | dapE-gram_pos succinyl-diaminopimelate desuccinyla | 98.37 | |
| PRK08651 | 394 | succinyl-diaminopimelate desuccinylase; Reviewed | 98.33 | |
| PRK13381 | 404 | peptidase T; Provisional | 98.32 | |
| PRK07522 | 385 | acetylornithine deacetylase; Provisional | 98.31 | |
| TIGR01892 | 364 | AcOrn-deacetyl acetylornithine deacetylase (ArgE). | 98.3 | |
| TIGR03106 | 343 | trio_M42_hydro hydrolase, peptidase M42 family. Th | 98.3 | |
| PRK07907 | 449 | hypothetical protein; Provisional | 98.24 | |
| PRK05111 | 383 | acetylornithine deacetylase; Provisional | 98.24 | |
| PRK13007 | 352 | succinyl-diaminopimelate desuccinylase; Reviewed | 98.21 | |
| PRK00466 | 346 | acetyl-lysine deacetylase; Validated | 98.2 | |
| TIGR03320 | 395 | ygeY M20/DapE family protein YgeY. Members of this | 98.18 | |
| PRK10199 | 346 | alkaline phosphatase isozyme conversion aminopepti | 98.16 | |
| TIGR01902 | 336 | dapE-lys-deAc N-acetyl-ornithine/N-acetyl-lysine d | 98.13 | |
| TIGR03526 | 395 | selenium_YgeY putative selenium metabolism hydrola | 97.99 | |
| PF04389 | 179 | Peptidase_M28: Peptidase family M28; InterPro: IPR | 97.98 | |
| PLN02693 | 437 | IAA-amino acid hydrolase | 97.87 | |
| PRK08737 | 364 | acetylornithine deacetylase; Provisional | 97.86 | |
| TIGR01891 | 363 | amidohydrolases amidohydrolase. This model represe | 97.74 | |
| TIGR01893 | 477 | aa-his-dipept aminoacyl-histidine dipeptidase. | 97.7 | |
| PRK15026 | 485 | aminoacyl-histidine dipeptidase; Provisional | 97.59 | |
| PLN02280 | 478 | IAA-amino acid hydrolase | 97.48 | |
| PRK09961 | 344 | exoaminopeptidase; Provisional | 96.93 | |
| KOG2195|consensus | 702 | 96.58 | ||
| TIGR03107 | 350 | glu_aminopep glutamyl aminopeptidase. This model r | 96.56 | |
| PF05343 | 292 | Peptidase_M42: M42 glutamyl aminopeptidase; InterP | 96.42 | |
| COG1363 | 355 | FrvX Cellulase M and related proteins [Carbohydrat | 96.2 | |
| COG2234 | 435 | Iap Predicted aminopeptidases [General function pr | 96.12 | |
| PRK09864 | 356 | putative peptidase; Provisional | 96.1 | |
| COG2195 | 414 | PepD Di- and tripeptidases [Amino acid transport a | 95.74 | |
| COG4187 | 553 | RocB Arginine degradation protein (predicted deacy | 95.7 | |
| KOG2276|consensus | 473 | 93.67 | ||
| PRK02256 | 462 | putative aminopeptidase 1; Provisional | 93.64 | |
| COG1473 | 392 | AbgB Metal-dependent amidase/aminoacylase/carboxyp | 90.27 | |
| PF05450 | 234 | Nicastrin: Nicastrin; InterPro: IPR008710 Nicastri | 89.69 | |
| PF02127 | 432 | Peptidase_M18: Aminopeptidase I zinc metalloprotea | 88.96 | |
| PRK02813 | 428 | putative aminopeptidase 2; Provisional | 88.77 | |
| KOG2194|consensus | 834 | 85.47 | ||
| PTZ00371 | 465 | aspartyl aminopeptidase; Provisional | 85.08 |
| >KOG2275|consensus | Back alignment and domain information |
|---|
Probab=99.31 E-value=3.7e-12 Score=91.06 Aligned_cols=49 Identities=47% Similarity=0.694 Sum_probs=44.9
Q ss_pred ChHHHHHHHHHHHHHHHcCCCCCceEEEEeeCCCCCCChhhhHHHHHHHH
Q psy3109 1 MKCVGIQYLETIRRYIAEGKKFKRTIHVSFVPGPVTQNETCGLAAANSVL 50 (58)
Q Consensus 1 MK~~~~~~leAl~~L~~~g~~p~r~I~l~f~~DEE~Gg~~~g~~~~~s~~ 50 (58)
|||.++|+++|+|.|+..|++|+|||.++|++|||+||. .|+.-+++.+
T Consensus 130 ~K~~~va~leAir~L~~~g~kp~Rti~lsfvpDEEi~G~-~Gm~~fa~~~ 178 (420)
T KOG2275|consen 130 MKCVGVAYLEAIRNLKASGFKPKRTIHLSFVPDEEIGGH-IGMKEFAKTE 178 (420)
T ss_pred hHhHHHHHHHHHHHHHhcCCCcCceEEEEecCchhccCc-chHHHHhhhh
Confidence 899999999999999999999999999999999999997 5777777644
|
|
| >PRK12891 allantoate amidohydrolase; Reviewed | Back alignment and domain information |
|---|
| >PF01546 Peptidase_M20: Peptidase family M20/M25/M40 This family only corresponds to M20 family; InterPro: IPR002933 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >TIGR03176 AllC allantoate amidohydrolase | Back alignment and domain information |
|---|
| >PRK07205 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07338 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK07906 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13983 diaminopimelate aminotransferase; Provisional | Back alignment and domain information |
|---|
| >PRK13013 succinyl-diaminopimelate desuccinylase; Reviewed | Back alignment and domain information |
|---|
| >PRK07318 dipeptidase PepV; Reviewed | Back alignment and domain information |
|---|
| >PRK08588 succinyl-diaminopimelate desuccinylase; Reviewed | Back alignment and domain information |
|---|
| >PRK08262 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01880 Ac-peptdase-euk N-acyl-L-amino-acid amidohydrolase | Back alignment and domain information |
|---|
| >PRK12890 allantoate amidohydrolase; Reviewed | Back alignment and domain information |
|---|
| >PRK13009 succinyl-diaminopimelate desuccinylase; Reviewed | Back alignment and domain information |
|---|
| >PRK09104 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01246 dapE_proteo succinyl-diaminopimelate desuccinylase, proteobacterial clade | Back alignment and domain information |
|---|
| >TIGR01887 dipeptidaselike dipeptidase, putative | Back alignment and domain information |
|---|
| >PRK07473 carboxypeptidase; Provisional | Back alignment and domain information |
|---|
| >PRK13590 putative bifunctional OHCU decarboxylase/allantoate amidohydrolase; Provisional | Back alignment and domain information |
|---|
| >PRK09133 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08596 acetylornithine deacetylase; Validated | Back alignment and domain information |
|---|
| >PRK06156 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0624 ArgE Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08201 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01910 DapE-ArgE acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase | Back alignment and domain information |
|---|
| >PRK09290 allantoate amidohydrolase; Reviewed | Back alignment and domain information |
|---|
| >PRK12893 allantoate amidohydrolase; Reviewed | Back alignment and domain information |
|---|
| >TIGR01886 dipeptidase dipeptidase PepV | Back alignment and domain information |
|---|
| >PRK06915 acetylornithine deacetylase; Validated | Back alignment and domain information |
|---|
| >PRK06446 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK06133 glutamate carboxypeptidase; Reviewed | Back alignment and domain information |
|---|
| >PRK07079 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04443 acetyl-lysine deacetylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01883 PepT-like peptidase T-like protein | Back alignment and domain information |
|---|
| >PRK13799 unknown domain/N-carbamoyl-L-amino acid hydrolase fusion protein; Provisional | Back alignment and domain information |
|---|
| >PRK06837 acetylornithine deacetylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01879 hydantase amidase, hydantoinase/carbamoylase family | Back alignment and domain information |
|---|
| >PRK05469 peptidase T; Provisional | Back alignment and domain information |
|---|
| >TIGR01882 peptidase-T peptidase T | Back alignment and domain information |
|---|
| >PRK08554 peptidase; Reviewed | Back alignment and domain information |
|---|
| >PRK13004 peptidase; Reviewed | Back alignment and domain information |
|---|
| >PRK12892 allantoate amidohydrolase; Reviewed | Back alignment and domain information |
|---|
| >PRK08652 acetylornithine deacetylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01900 dapE-gram_pos succinyl-diaminopimelate desuccinylase | Back alignment and domain information |
|---|
| >PRK08651 succinyl-diaminopimelate desuccinylase; Reviewed | Back alignment and domain information |
|---|
| >PRK13381 peptidase T; Provisional | Back alignment and domain information |
|---|
| >PRK07522 acetylornithine deacetylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01892 AcOrn-deacetyl acetylornithine deacetylase (ArgE) | Back alignment and domain information |
|---|
| >TIGR03106 trio_M42_hydro hydrolase, peptidase M42 family | Back alignment and domain information |
|---|
| >PRK07907 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05111 acetylornithine deacetylase; Provisional | Back alignment and domain information |
|---|
| >PRK13007 succinyl-diaminopimelate desuccinylase; Reviewed | Back alignment and domain information |
|---|
| >PRK00466 acetyl-lysine deacetylase; Validated | Back alignment and domain information |
|---|
| >TIGR03320 ygeY M20/DapE family protein YgeY | Back alignment and domain information |
|---|
| >PRK10199 alkaline phosphatase isozyme conversion aminopeptidase; Provisional | Back alignment and domain information |
|---|
| >TIGR01902 dapE-lys-deAc N-acetyl-ornithine/N-acetyl-lysine deacetylase | Back alignment and domain information |
|---|
| >TIGR03526 selenium_YgeY putative selenium metabolism hydrolase | Back alignment and domain information |
|---|
| >PF04389 Peptidase_M28: Peptidase family M28; InterPro: IPR007484 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PLN02693 IAA-amino acid hydrolase | Back alignment and domain information |
|---|
| >PRK08737 acetylornithine deacetylase; Provisional | Back alignment and domain information |
|---|
| >TIGR01891 amidohydrolases amidohydrolase | Back alignment and domain information |
|---|
| >TIGR01893 aa-his-dipept aminoacyl-histidine dipeptidase | Back alignment and domain information |
|---|
| >PRK15026 aminoacyl-histidine dipeptidase; Provisional | Back alignment and domain information |
|---|
| >PLN02280 IAA-amino acid hydrolase | Back alignment and domain information |
|---|
| >PRK09961 exoaminopeptidase; Provisional | Back alignment and domain information |
|---|
| >KOG2195|consensus | Back alignment and domain information |
|---|
| >TIGR03107 glu_aminopep glutamyl aminopeptidase | Back alignment and domain information |
|---|
| >PF05343 Peptidase_M42: M42 glutamyl aminopeptidase; InterPro: IPR008007 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >COG1363 FrvX Cellulase M and related proteins [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG2234 Iap Predicted aminopeptidases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09864 putative peptidase; Provisional | Back alignment and domain information |
|---|
| >COG2195 PepD Di- and tripeptidases [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG4187 RocB Arginine degradation protein (predicted deacylase) [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2276|consensus | Back alignment and domain information |
|---|
| >PRK02256 putative aminopeptidase 1; Provisional | Back alignment and domain information |
|---|
| >COG1473 AbgB Metal-dependent amidase/aminoacylase/carboxypeptidase [General function prediction only] | Back alignment and domain information |
|---|
| >PF05450 Nicastrin: Nicastrin; InterPro: IPR008710 Nicastrin and presenilin are two major components of the gamma-secretase complex, which executes the intramembrane proteolysis of type I integral membrane proteins such as the amyloid precursor protein (APP) and Notch | Back alignment and domain information |
|---|
| >PF02127 Peptidase_M18: Aminopeptidase I zinc metalloprotease (M18); InterPro: IPR001948 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PRK02813 putative aminopeptidase 2; Provisional | Back alignment and domain information |
|---|
| >KOG2194|consensus | Back alignment and domain information |
|---|
| >PTZ00371 aspartyl aminopeptidase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 58 | ||||
| 1q7l_A | 198 | Zn-binding Domain Of The T347g Mutant Of Human Amin | 6e-08 |
| >pdb|1Q7L|A Chain A, Zn-binding Domain Of The T347g Mutant Of Human Aminoacylase- I Length = 198 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 58 | |||
| 1q7l_A | 198 | Aminoacylase-1; catalysis, enzyme dimerization, si | 2e-09 |
| >1q7l_A Aminoacylase-1; catalysis, enzyme dimerization, site- directed mutagenesis, structure comparison, zinc, hydrolase; 1.40A {Homo sapiens} SCOP: c.56.5.4 Length = 198 | Back alignment and structure |
|---|
Score = 49.0 bits (117), Expect = 2e-09
Identities = 21/32 (65%), Positives = 25/32 (78%)
Query: 1 MKCVGIQYLETIRRYIAEGKKFKRTIHVSFVP 32
MKCV IQYLE +RR EG +F RTIH++FVP
Sbjct: 114 MKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVP 145
|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 58 | |||
| 1q7l_A | 198 | Aminoacylase-1; catalysis, enzyme dimerization, si | 99.02 | |
| 4h2k_A | 269 | Succinyl-diaminopimelate desuccinylase; DAPE, MCSG | 98.81 | |
| 3t68_A | 268 | Succinyl-diaminopimelate desuccinylase; DAPE, csgi | 98.8 | |
| 1lfw_A | 470 | PEPV; hydrolase, dipeptidase; HET: AEP; 1.80A {Bac | 98.75 | |
| 2zog_A | 479 | Cytosolic non-specific dipeptidase; metallopeptida | 98.73 | |
| 1rtq_A | 299 | Bacterial leucyl aminopeptidase; bimetallic, zinc, | 98.72 | |
| 1vgy_A | 393 | Succinyl-diaminopimelate desuccinylase; structural | 98.71 | |
| 1tkj_A | 284 | Aminopeptidase, SGAP; double-zinc metalloproteinas | 98.68 | |
| 3khx_A | 492 | Putative dipeptidase sacol1801; DAPE, metallopepti | 98.67 | |
| 1cg2_A | 393 | Carboxypeptidase G2; metallocarboxypeptidase, hydr | 98.66 | |
| 2pok_A | 481 | Peptidase, M20/M25/M40 family; M20 family peptidas | 98.64 | |
| 3dlj_A | 485 | Beta-Ala-His dipeptidase; CNDP1, carnosine dipepti | 98.63 | |
| 2gre_A | 349 | Deblocking aminopeptidase; structural genomi prote | 98.6 | |
| 3pfo_A | 433 | Putative acetylornithine deacetylase; metal bindin | 98.59 | |
| 3pfe_A | 472 | Succinyl-diaminopimelate desuccinylase; metal bind | 98.57 | |
| 3ife_A | 434 | Peptidase T; metallopeptidase, aminopeptidase, hyd | 98.55 | |
| 3isz_A | 377 | Succinyl-diaminopimelate desuccinylase; DAPE, Zn-b | 98.55 | |
| 2v8h_A | 474 | Beta-alanine synthase; amidohydrolase, alpha and b | 98.54 | |
| 3ct9_A | 356 | Acetylornithine deacetylase; NP_812461.1, A putati | 98.48 | |
| 3tx8_A | 369 | Succinyl-diaminopimelate desuccinylase; peptidase, | 98.47 | |
| 1vhe_A | 373 | Aminopeptidase/glucanase homolog; structural genom | 98.45 | |
| 1z2l_A | 423 | Allantoate amidohydrolase; ALLC, purine cataboli a | 98.43 | |
| 1fno_A | 417 | Peptidase T; metallo peptidase, protease, hydrolas | 98.42 | |
| 2wyr_A | 332 | Cobalt-activated peptidase TET1; hydrolase, large | 98.42 | |
| 3gux_A | 314 | Putative Zn-dependent exopeptidase; aminopeptidase | 98.41 | |
| 3tc8_A | 309 | Leucine aminopeptidase; phosphorylase/hydrolase-li | 98.4 | |
| 2rb7_A | 364 | Peptidase, M20/M25/M40 family; YP_387682.1, CO-cat | 98.39 | |
| 3gb0_A | 373 | Peptidase T; NP_980509.1, aminopeptidase PEPT, pep | 98.38 | |
| 3n5f_A | 408 | L-carbamoylase, N-carbamoyl-L-amino acid hydrolase | 98.33 | |
| 3rza_A | 396 | Tripeptidase; phosphorylase/hydrolase-like, struct | 98.33 | |
| 1xmb_A | 418 | IAA-amino acid hydrolase homolog 2; structural gen | 98.3 | |
| 3iib_A | 444 | Peptidase M28; YP_926796.1, structural genomics, J | 98.28 | |
| 1y0y_A | 353 | FRV operon protein FRVX; aminopeptidase, PDZ, hydr | 98.26 | |
| 2fvg_A | 340 | Endoglucanase; TM1049, structural genomics, joint | 98.18 | |
| 2afw_A | 329 | Glutaminyl-peptide cyclotransferase; alpha-beta pr | 98.17 | |
| 1ysj_A | 404 | Protein YXEP; M20 family peptidase, dinuclear meta | 98.15 | |
| 3io1_A | 445 | Aminobenzoyl-glutamate utilization protein; peptid | 97.99 | |
| 2f7v_A | 369 | Aectylcitrulline deacetylase; alpha/beta, hydrolas | 97.95 | |
| 2ek8_A | 421 | Aminopeptidase; metalloproteinase, hydrolase; 1.80 | 97.9 | |
| 4f9u_A | 312 | CG32412; alpha/beta hydrolase, PGlu formation, PE, | 97.77 | |
| 1ylo_A | 348 | Hypothetical protein SF2450; structural genomics, | 97.66 | |
| 2qyv_A | 487 | XAA-His dipeptidase; YP_718209.1, structural genom | 97.61 | |
| 4fai_A | 330 | CG5976, isoform B; alpha/beta hydrolase, PGlu form | 97.59 | |
| 3fed_A | 707 | Glutamate carboxypeptidase III; metallopeptidase, | 97.54 | |
| 3mru_A | 490 | Aminoacyl-histidine dipeptidase; metalloprotease, | 97.53 | |
| 1vho_A | 346 | Endoglucanase; structural genomics, unknown functi | 97.5 | |
| 3kas_A | 640 | Transferrin receptor protein 1; transferrin recept | 97.44 | |
| 3pb6_X | 330 | Glutaminyl-peptide cyclotransferase-like protein; | 97.37 | |
| 3ram_A | 394 | HMRA protein; two-domain, catalytic (alpha-beta-al | 97.36 | |
| 3kl9_A | 355 | PEPA, glutamyl aminopeptidase; tetrahedral aminope | 97.27 | |
| 4fuu_A | 309 | Leucine aminopeptidase; phosphorylase/hydrolase li | 97.2 | |
| 3cpx_A | 321 | Aminopeptidase, M42 family; YP_676701.1, putative | 97.05 | |
| 2vpu_A | 354 | TET3, 354AA long hypothetical operon protein FRV; | 96.72 | |
| 3isx_A | 343 | Endoglucanase; TM1050, structural genomics, joint | 95.5 | |
| 1y7e_A | 458 | Probable M18-family aminopeptidase 1; aminopeptida | 93.98 | |
| 2glj_A | 461 | Probable M18-family aminopeptidase 1; aminopeptida | 93.8 | |
| 2glf_A | 450 | Probable M18-family aminopeptidase 1; putative, NY | 91.9 | |
| 3k9t_A | 435 | Putative peptidase; structural genomics, joint cen | 86.91 | |
| 2ijz_A | 428 | Probable M18-family aminopeptidase 2; putative ami | 85.58 |
| >1q7l_A Aminoacylase-1; catalysis, enzyme dimerization, site- directed mutagenesis, structure comparison, zinc, hydrolase; 1.40A {Homo sapiens} SCOP: c.56.5.4 | Back alignment and structure |
|---|
Probab=99.02 E-value=5.8e-10 Score=69.78 Aligned_cols=46 Identities=46% Similarity=0.725 Sum_probs=39.8
Q ss_pred ChHHHHHHHHHHHHHHHcCCCCCceEEEEeeCCCCCCChhhhHHHH
Q psy3109 1 MKCVGIQYLETIRRYIAEGKKFKRTIHVSFVPGPVTQNETCGLAAA 46 (58)
Q Consensus 1 MK~~~~~~leAl~~L~~~g~~p~r~I~l~f~~DEE~Gg~~~g~~~~ 46 (58)
||+++++.++|++.|++.+..|+++|+++|++|||+|+..+...++
T Consensus 114 ~K~g~a~~l~a~~~l~~~~~~~~~~v~~~~~~~EE~g~~~Ga~~~~ 159 (198)
T 1q7l_A 114 MKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFV 159 (198)
T ss_dssp THHHHHHHHHHHHHHHHTTCCCSSCEEEEEESCGGGTSTTTHHHHT
T ss_pred chHHHHHHHHHHHHHHHcCCCCCCCEEEEEEcccccCccccHHHHH
Confidence 8999999999999999999889999999999999998653333333
|
| >4h2k_A Succinyl-diaminopimelate desuccinylase; DAPE, MCSG, PSI-biology, structural genomics, midwest center structural genomics, hydrolase; 1.84A {Haemophilus influenzae} | Back alignment and structure |
|---|
| >3t68_A Succinyl-diaminopimelate desuccinylase; DAPE, csgid, metalloenzyme, structural genomics; 1.65A {Vibrio cholerae o1 biovar el tor} PDB: 3t6m_A | Back alignment and structure |
|---|
| >1lfw_A PEPV; hydrolase, dipeptidase; HET: AEP; 1.80A {Bacteria} SCOP: c.56.5.4 d.58.19.1 | Back alignment and structure |
|---|
| >2zog_A Cytosolic non-specific dipeptidase; metallopeptidase, protein-inhibitor complex, CNDP2, CNDP DIP 2, bestatin, L-carnosine, carnosinase, Zn; HET: BES; 1.70A {Mus musculus} PDB: 2zof_A* | Back alignment and structure |
|---|
| >1rtq_A Bacterial leucyl aminopeptidase; bimetallic, zinc, high resolution, hydrolase; 0.95A {Vibrio proteolyticus} SCOP: c.56.5.4 PDB: 1txr_A* 1xry_A* 2dea_A 2nyq_A 3fh4_A 3vh9_A* 1lok_A 1cp6_A 1ft7_A* 1igb_A* 1amp_A 2iq6_A 2prq_A 3b3v_A 3b3w_A 3b7i_A* 3b3t_A 3b35_A 3b3c_A* 3b3s_A ... | Back alignment and structure |
|---|
| >1vgy_A Succinyl-diaminopimelate desuccinylase; structural genomics, unknown function; HET: MSE; 1.90A {Neisseria meningitidis} SCOP: c.56.5.4 d.58.19.1 | Back alignment and structure |
|---|
| >1tkj_A Aminopeptidase, SGAP; double-zinc metalloproteinase, calcium activation, protein- inhibitor complex, hydrolase; HET: MED; 1.15A {Streptomyces griseus} SCOP: c.56.5.4 PDB: 1f2o_A 1f2p_A* 1cp7_A 1qq9_A* 1tf9_A* 1tf8_A* 1tkh_A* 1tkf_A* 1xbu_A* 1xjo_A | Back alignment and structure |
|---|
| >3khx_A Putative dipeptidase sacol1801; DAPE, metallopeptidase, hydrolase, metal-bindin metalloprotease, protease; 2.30A {Staphylococcus aureus} PDB: 3ki9_A 3khz_A | Back alignment and structure |
|---|
| >1cg2_A Carboxypeptidase G2; metallocarboxypeptidase, hydrolase; 2.50A {Pseudomonas SP} SCOP: c.56.5.4 d.58.19.1 | Back alignment and structure |
|---|
| >2pok_A Peptidase, M20/M25/M40 family; M20 family peptidase, metallo protein, MCSG, structural GENO PSI-2, protein structure initiative; HET: BGC; 1.90A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3dlj_A Beta-Ala-His dipeptidase; CNDP1, carnosine dipeptidase 1, structural genomics, structu genomics consortium, SGC, metallopeptidase M20 family; 2.26A {Homo sapiens} | Back alignment and structure |
|---|
| >2gre_A Deblocking aminopeptidase; structural genomi protein structure initiative, midwest center for structural genomics, MCSG, hydrolase; 2.65A {Bacillus cereus} SCOP: b.49.3.1 c.56.5.4 | Back alignment and structure |
|---|
| >3pfo_A Putative acetylornithine deacetylase; metal binding, merops M20A family, amino-acid biosynthesis, metallopeptidase; 1.90A {Rhodopseudomonas palustris} | Back alignment and structure |
|---|
| >3pfe_A Succinyl-diaminopimelate desuccinylase; metal binding, merops M20 familiy, phosphorylase/hydrolase-L structural genomics; HET: MSE; 1.50A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3ife_A Peptidase T; metallopeptidase, aminopeptidase, hydro metal-binding, metalloprotease, protease; HET: SUC; 1.55A {Bacillus anthracis} | Back alignment and structure |
|---|
| >3isz_A Succinyl-diaminopimelate desuccinylase; DAPE, Zn-binding, metallopeptidase, structural genomics, PSI-2, protein struc initiative; 2.00A {Haemophilus influenzae} PDB: 3ic1_A | Back alignment and structure |
|---|
| >2v8h_A Beta-alanine synthase; amidohydrolase, alpha and beta protein, DI-zinc center, COMP N-carbamyl-beta-alanine, hydrolase; HET: BCN; 2.0A {Saccharomyces kluyveri} PDB: 2v8d_A* 2vl1_A 2v8g_A 2v8v_A 1r43_A 1r3n_A | Back alignment and structure |
|---|
| >3ct9_A Acetylornithine deacetylase; NP_812461.1, A putative zinc peptidase, peptidase family M20 structural genomics; 2.31A {Bacteroides thetaiotaomicron vpi-5482} | Back alignment and structure |
|---|
| >3tx8_A Succinyl-diaminopimelate desuccinylase; peptidase, structural genomics, joint center for structural JCSG; 2.97A {Corynebacterium glutamicum} | Back alignment and structure |
|---|
| >1vhe_A Aminopeptidase/glucanase homolog; structural genomics, unknown function; HET: MSE; 1.90A {Bacillus subtilis} SCOP: b.49.3.1 c.56.5.4 | Back alignment and structure |
|---|
| >1z2l_A Allantoate amidohydrolase; ALLC, purine cataboli allantoin utilization, structural genomics, PSI, Pro structure initiative; HET: 1AL; 2.25A {Escherichia coli} SCOP: c.56.5.4 d.58.19.1 PDB: 2imo_A | Back alignment and structure |
|---|
| >1fno_A Peptidase T; metallo peptidase, protease, hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.56.5.4 d.58.19.1 PDB: 1vix_A | Back alignment and structure |
|---|
| >2wyr_A Cobalt-activated peptidase TET1; hydrolase, large SELF-assembled dodecamer, hyperthermophilic; 2.24A {Pyrococcus horikoshii} PDB: 2cf4_A | Back alignment and structure |
|---|
| >3gux_A Putative Zn-dependent exopeptidase; aminopeptidase, phosphorylase/hydrolase-like fold, structura genomics; 1.80A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >3tc8_A Leucine aminopeptidase; phosphorylase/hydrolase-like, structural genomics, joint CEN structural genomics, JCSG; 1.06A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >2rb7_A Peptidase, M20/M25/M40 family; YP_387682.1, CO-catalytic metallopeptidase, peptidase family M20/M25/M40, structural genomics; HET: MSE PGE PG4; 1.60A {Desulfovibrio desulfuricans subsp} | Back alignment and structure |
|---|
| >3gb0_A Peptidase T; NP_980509.1, aminopeptidase PEPT, peptidase family M20/M25/M structural genomics, joint center for structural genomics; 2.04A {Bacillus cereus atcc 10987} | Back alignment and structure |
|---|
| >3n5f_A L-carbamoylase, N-carbamoyl-L-amino acid hydrolase; hinge domain, M20 peptidase family, evolution, residue, dimerization domain; 2.75A {Bacillus stearothermophilus} | Back alignment and structure |
|---|
| >3rza_A Tripeptidase; phosphorylase/hydrolase-like, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; HET: CIT PG4 PGE; 2.10A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1xmb_A IAA-amino acid hydrolase homolog 2; structural genomics, protein structure initiative, CESG AT5G56660, ILL2, indole-3-acetic acid, auxin; 2.00A {Arabidopsis thaliana} SCOP: c.56.5.4 d.58.19.1 PDB: 2q43_A | Back alignment and structure |
|---|
| >3iib_A Peptidase M28; YP_926796.1, structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2; HET: PGE; 1.70A {Shewanella amazonensis SB2B} | Back alignment and structure |
|---|
| >1y0y_A FRV operon protein FRVX; aminopeptidase, PDZ, hydrolase; HET: ATI; 1.60A {Pyrococcus horikoshii} SCOP: b.49.3.1 c.56.5.4 PDB: 1y0r_A* 1xfo_A | Back alignment and structure |
|---|
| >2fvg_A Endoglucanase; TM1049, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.01A {Thermotoga maritima} SCOP: b.49.3.1 c.56.5.4 | Back alignment and structure |
|---|
| >2afw_A Glutaminyl-peptide cyclotransferase; alpha-beta protein, metalloprotein; HET: AHN; 1.56A {Homo sapiens} SCOP: c.56.5.8 PDB: 2afo_A 2afm_A* 2afx_A* 2afz_A 3pbb_A* 2zed_A 2zeh_A 2afu_A 2zee_A 2zeo_A 2zef_A 2zem_A 2zel_A 2zen_A 3pbe_A 2zeg_A 2zep_A 2afs_A 3si0_A* 3si2_A* ... | Back alignment and structure |
|---|
| >1ysj_A Protein YXEP; M20 family peptidase, dinuclear metal binding, structural GE PSI, protein structure initiative; 2.40A {Bacillus subtilis} SCOP: c.56.5.4 d.58.19.1 | Back alignment and structure |
|---|
| >3io1_A Aminobenzoyl-glutamate utilization protein; peptidase_M20D superfamily, protein structure initiative II, NYSGXRC, structural genomics; 2.50A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >2f7v_A Aectylcitrulline deacetylase; alpha/beta, hydrolase; 1.75A {Xanthomonas campestris} PDB: 2f8h_A | Back alignment and structure |
|---|
| >2ek8_A Aminopeptidase; metalloproteinase, hydrolase; 1.80A {Aneurinibacillus SP} PDB: 2ek9_A* | Back alignment and structure |
|---|
| >4f9u_A CG32412; alpha/beta hydrolase, PGlu formation, PE, alzheimer'S diseas pyroglutamate, PGlu-amyloid, glycosylation, transferase, HY; HET: PBD NAG BMA MAN; 1.80A {Drosophila melanogaster} PDB: 4f9v_A* | Back alignment and structure |
|---|
| >1ylo_A Hypothetical protein SF2450; structural genomics, MCSG, PSI, structure initiative; 2.15A {Shigella flexneri 2a str} SCOP: b.49.3.1 c.56.5.4 | Back alignment and structure |
|---|
| >2qyv_A XAA-His dipeptidase; YP_718209.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; 2.11A {Haemophilus somnus 129PT} | Back alignment and structure |
|---|
| >4fai_A CG5976, isoform B; alpha/beta hydrolase, PGlu formation, PE, alzheimer'S diseas pyroglutamate, PGlu-amyloid, transferase, hydrolase; HET: PBD; 1.65A {Drosophila melanogaster} PDB: 4fbe_A* | Back alignment and structure |
|---|
| >3fed_A Glutamate carboxypeptidase III; metallopeptidase, bimetallic active site, N-glycosylation, C cation, chloride anion, zinc IONS, dipept glycoprotein; HET: NAG BIX; 1.29A {Homo sapiens} PDB: 3fec_A* 3fee_A* 3ff3_A* 2c6c_A* 2c6g_A* 2c6p_A* 2cij_A* 2jbj_A* 2jbk_A* 3rbu_A* 3bi1_A* 2oot_A* 2pvv_A* 2pvw_A* 2xei_A* 2or4_A* 3bi0_A* 3bhx_A* 3d7d_A* 3d7f_A* ... | Back alignment and structure |
|---|
| >3mru_A Aminoacyl-histidine dipeptidase; metalloprotease, homodimer, hydrolase; 3.00A {Vibrio alginolyticus} | Back alignment and structure |
|---|
| >1vho_A Endoglucanase; structural genomics, unknown function; HET: MSE; 1.86A {Thermotoga maritima} SCOP: b.49.3.1 c.56.5.4 | Back alignment and structure |
|---|
| >3kas_A Transferrin receptor protein 1; transferrin receptor 1, arenavirus, cell MEMB disulfide bond, endocytosis, HOST-virus inter receptor, secreted, transmembrane; HET: NAG FUC BMA MAN; 2.40A {Homo sapiens} PDB: 1de4_C* 3s9l_A* 3s9m_A* 3s9n_A* 1cx8_A* 1suv_A 2nsu_A | Back alignment and structure |
|---|
| >3pb6_X Glutaminyl-peptide cyclotransferase-like protein; alpha/beta protein, alpha/beta-mixed fold, glutaminyl cyclas membrane; 1.05A {Homo sapiens} PDB: 3pb4_X 3pb7_X* 3pb8_X* 3pb9_X* | Back alignment and structure |
|---|
| >3ram_A HMRA protein; two-domain, catalytic (alpha-beta-alpha) motif, tetramerisat (alpha,beta,BETA,alpha), endoprotease, hydrolase; 2.70A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3kl9_A PEPA, glutamyl aminopeptidase; tetrahedral aminopeptidase, S specificity, metallopeptidase M42, hydrolas; 2.70A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >4fuu_A Leucine aminopeptidase; phosphorylase/hydrolase like fold, peptidase family M28, STR genomics, joint center for structural genomics; 1.30A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3cpx_A Aminopeptidase, M42 family; YP_676701.1, putative M42 glutamyl aminopeptidase, structura genomics; 2.39A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >3isx_A Endoglucanase; TM1050, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.40A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1y7e_A Probable M18-family aminopeptidase 1; aminopeptidase I, borrelia burgdorferi B31, YSCI, structural genomics, PSI; 3.20A {Borrelia burgdorferi} SCOP: b.49.3.1 c.56.5.4 | Back alignment and structure |
|---|
| >2glj_A Probable M18-family aminopeptidase 1; aminopeptidase I, NYSGXRC, structural genomics, PSI, protein structure initiative; 3.20A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2glf_A Probable M18-family aminopeptidase 1; putative, NYSGXRC, structural genomics, PS protein structure initiative; 2.80A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3k9t_A Putative peptidase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2, aminop hydrolase; 2.37A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2ijz_A Probable M18-family aminopeptidase 2; putative aminopeptidase 2, structura genomics, PSI, protein structure initiative; 3.00A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 58 | |||
| g1q7l.1 | 280 | Aminoacylase-1, catalytic domain {Human (Homo sapi | 98.93 | |
| d1cg2a1 | 276 | Carboxypeptidase G2, catalytic domain {Pseudomonas | 98.92 | |
| d1lfwa1 | 272 | Aminopeptidase PepV {Lactobacillus delbrueckii [Ta | 98.87 | |
| d1vgya1 | 262 | Succinyl-diaminopimelate desuccinylase, catalytic | 98.75 | |
| d1z2la1 | 293 | Allantoate amidohydrolase AllC catalytic domain {E | 98.66 | |
| d1r3na1 | 322 | Peptidase-like beta-alanine synthase, catalytic do | 98.54 | |
| d1tkja1 | 277 | Aminopeptidase {Streptomyces griseus [TaxId: 1911] | 98.54 | |
| d2grea2 | 233 | Deblocking aminopeptidase YhfE {Bacillus cereus [T | 98.48 | |
| d1rtqa_ | 291 | Aminopeptidase {Aeromonas proteolytica [TaxId: 671 | 98.36 | |
| d1de4c3 | 294 | Transferrin receptor ectodomain, protease-like dom | 97.94 | |
| d3bi1a3 | 304 | Glutamate carboxypeptidase II FOLH1 {Human (Homo s | 97.84 | |
| d2afwa1 | 329 | Glutaminyl-peptide cyclotransferase, QPCT {Human ( | 97.78 | |
| d1fnoa4 | 295 | Peptidase T (tripeptidase), catalytic domain {Salm | 97.75 | |
| d1vhea2 | 275 | Hypothetical protein YsdC, catalytic domain {Bacil | 97.74 | |
| d1vhoa2 | 248 | Putative endoglucanase TM1048, catalytic domain {T | 97.72 | |
| d1yloa2 | 264 | Aminopeptidase YpdE {Shigella flexneri [TaxId: 623 | 97.53 | |
| d2fvga2 | 255 | Endoglucanase TM1049 {Thermotoga maritima [TaxId: | 97.46 | |
| d1y0ya2 | 255 | Frv operon protein FrvX, catalytic domain {Pyrococ | 96.92 | |
| d1xmba1 | 273 | IAA-amino acid hydrolase, catalytic domain {Mouse- | 95.9 | |
| d1ysja1 | 261 | Protein YxeP {Bacillus subtilis [TaxId: 1423]} | 95.83 | |
| d1y7ea2 | 322 | Probable aminopeptidase ApeA {Borrelia burgdorferi | 91.91 |
| >d1cg2a1 c.56.5.4 (A:26-213,A:327-414) Carboxypeptidase G2, catalytic domain {Pseudomonas sp., strain rs-16 [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1lfwa1 c.56.5.4 (A:1-186,A:383-468) Aminopeptidase PepV {Lactobacillus delbrueckii [TaxId: 1584]} | Back information, alignment and structure |
|---|
| >d1vgya1 c.56.5.4 (A:2-180,A:294-376) Succinyl-diaminopimelate desuccinylase, catalytic domain {Neisseria meningitidis [TaxId: 487]} | Back information, alignment and structure |
|---|
| >d1z2la1 c.56.5.4 (A:4-212,A:330-413) Allantoate amidohydrolase AllC catalytic domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1r3na1 c.56.5.4 (A:18-247,A:364-455) Peptidase-like beta-alanine synthase, catalytic domain {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} | Back information, alignment and structure |
|---|
| >d1tkja1 c.56.5.4 (A:1-277) Aminopeptidase {Streptomyces griseus [TaxId: 1911]} | Back information, alignment and structure |
|---|
| >d2grea2 c.56.5.4 (A:3-73,A:187-348) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1rtqa_ c.56.5.4 (A:) Aminopeptidase {Aeromonas proteolytica [TaxId: 671]} | Back information, alignment and structure |
|---|
| >d1de4c3 c.56.5.5 (C:122-189,C:383-608) Transferrin receptor ectodomain, protease-like domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bi1a3 c.56.5.5 (A:57-117,A:351-593) Glutamate carboxypeptidase II FOLH1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2afwa1 c.56.5.8 (A:33-361) Glutaminyl-peptide cyclotransferase, QPCT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fnoa4 c.56.5.4 (A:1-207,A:321-408) Peptidase T (tripeptidase), catalytic domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1vhea2 c.56.5.4 (A:3-72,A:163-367) Hypothetical protein YsdC, catalytic domain {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1vhoa2 c.56.5.4 (A:3-69,A:153-333) Putative endoglucanase TM1048, catalytic domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1yloa2 c.56.5.4 (A:1-66,A:148-345) Aminopeptidase YpdE {Shigella flexneri [TaxId: 623]} | Back information, alignment and structure |
|---|
| >d2fvga2 c.56.5.4 (A:1-64,A:149-339) Endoglucanase TM1049 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1y0ya2 c.56.5.4 (A:164-351,A:6-72) Frv operon protein FrvX, catalytic domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1xmba1 c.56.5.4 (A:37-215,A:335-428) IAA-amino acid hydrolase, catalytic domain {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1ysja1 c.56.5.4 (A:4-177,A:293-379) Protein YxeP {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1y7ea2 c.56.5.4 (A:4-100,A:234-458) Probable aminopeptidase ApeA {Borrelia burgdorferi [TaxId: 139]} | Back information, alignment and structure |
|---|