Psyllid ID: psy3109


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------
MKCVGIQYLETIRRYIAEGKKFKRTIHVSFVPGPVTQNETCGLAAANSVLYLLGLMSH
cEEHHHHHHHHHHHHHHcccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHccc
ccEHHHHHHHHHHHHHHccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHccc
MKCVGIQYLETIRRYIAEGKKFKRTihvsfvpgpvtqnetcglAAANSVLYLLGLMSH
MKCVGIQYLETIRRYIAEGKKFKRTIHVSFVPGPVTQNETCGLAAANSVLYLLGLMSH
MKCVGIQYLETIRRYIAEGKKFKRTIHVSFVPGPVTQNETCGLAAANSVLYLLGLMSH
**CVGIQYLETIRRYIAEGKKFKRTIHVSFVPGPVTQNETCGLAAANSVLYLLGL***
*KCVGIQYLETIRRYIAEGKKFKRTIHVSFVPGPVTQNETCGLAAANSVLYLLGLMS*
MKCVGIQYLETIRRYIAEGKKFKRTIHVSFVPGPVTQNETCGLAAANSVLYLLGLMSH
MKCVGIQYLETIRRYIAEGKKFKRTIHVSFVPGPVTQNETCGLAAANSVLYLLGLMS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKCVGIQYLETIRRYIAEGKKFKRTIHVSFVPGPVTQNETCGLAAANSVLYLLGLMSH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query58 2.2.26 [Sep-21-2011]
Q03154 408 Aminoacylase-1 OS=Homo sa no N/A 0.551 0.078 0.656 8e-07
Q5RFB0 408 Aminoacylase-1 OS=Pongo a yes N/A 0.551 0.078 0.625 1e-06
P37111 407 Aminoacylase-1 OS=Sus scr yes N/A 0.551 0.078 0.656 2e-06
Q6PTT0 408 Aminoacylase-1B OS=Rattus yes N/A 0.551 0.078 0.625 2e-06
Q99JW2 408 Aminoacylase-1 OS=Mus mus yes N/A 0.551 0.078 0.625 8e-06
Q6AYS7 408 Aminoacylase-1A OS=Rattus yes N/A 0.551 0.078 0.625 8e-06
Q55DP8 408 Aminoacylase-1 OS=Dictyos yes N/A 0.551 0.078 0.593 1e-05
>sp|Q03154|ACY1_HUMAN Aminoacylase-1 OS=Homo sapiens GN=ACY1 PE=1 SV=1 Back     alignment and function desciption
 Score = 52.4 bits (124), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 21/32 (65%), Positives = 25/32 (78%)

Query: 1   MKCVGIQYLETIRRYIAEGKKFKRTIHVSFVP 32
           MKCV IQYLE +RR   EG +F RTIH++FVP
Sbjct: 114 MKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVP 145




Involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate).
Homo sapiens (taxid: 9606)
EC: 3EC: .EC: 5EC: .EC: 1EC: .EC: 1EC: 4
>sp|Q5RFB0|ACY1_PONAB Aminoacylase-1 OS=Pongo abelii GN=ACY1 PE=2 SV=2 Back     alignment and function description
>sp|P37111|ACY1_PIG Aminoacylase-1 OS=Sus scrofa GN=ACY1 PE=1 SV=2 Back     alignment and function description
>sp|Q6PTT0|ACY1B_RAT Aminoacylase-1B OS=Rattus norvegicus GN=Acy1b PE=1 SV=1 Back     alignment and function description
>sp|Q99JW2|ACY1_MOUSE Aminoacylase-1 OS=Mus musculus GN=Acy1 PE=1 SV=1 Back     alignment and function description
>sp|Q6AYS7|ACY1A_RAT Aminoacylase-1A OS=Rattus norvegicus GN=Acy1a PE=1 SV=1 Back     alignment and function description
>sp|Q55DP8|ACY1_DICDI Aminoacylase-1 OS=Dictyostelium discoideum GN=acy1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query58
196006435 396 hypothetical protein TRIADDRAFT_50344 [T 0.551 0.080 0.781 2e-07
193650225 400 PREDICTED: aminoacylase-1A-like [Acyrtho 0.551 0.08 0.75 9e-07
48096676 401 PREDICTED: aminoacylase-1-like [Apis mel 0.551 0.079 0.75 9e-07
383851451 508 PREDICTED: aminoacylase-1-like [Megachil 0.551 0.062 0.75 9e-07
395516946 412 PREDICTED: aminoacylase-1A-like [Sarcoph 0.551 0.077 0.75 1e-06
363738590 348 PREDICTED: aminoacylase-1-like isoform 2 0.551 0.091 0.781 1e-06
363738588 413 PREDICTED: aminoacylase-1-like isoform 1 0.551 0.077 0.781 1e-06
326927775 392 PREDICTED: aminoacylase-1-like, partial 0.551 0.081 0.781 1e-06
260798889 411 hypothetical protein BRAFLDRAFT_262219 [ 0.551 0.077 0.75 3e-06
380020424 401 PREDICTED: LOW QUALITY PROTEIN: aminoacy 0.551 0.079 0.75 3e-06
>gi|196006435|ref|XP_002113084.1| hypothetical protein TRIADDRAFT_50344 [Trichoplax adhaerens] gi|190585125|gb|EDV25194.1| hypothetical protein TRIADDRAFT_50344 [Trichoplax adhaerens] Back     alignment and taxonomy information
 Score = 59.7 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (87%)

Query: 1   MKCVGIQYLETIRRYIAEGKKFKRTIHVSFVP 32
           MKCVGIQY+E IRR   EGK+FKRTIH+SFVP
Sbjct: 109 MKCVGIQYIEAIRRLKKEGKRFKRTIHMSFVP 140




Source: Trichoplax adhaerens

Species: Trichoplax adhaerens

Genus: Trichoplax

Family:

Order:

Class:

Phylum: Placozoa

Superkingdom: Eukaryota

>gi|193650225|ref|XP_001951399.1| PREDICTED: aminoacylase-1A-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|48096676|ref|XP_392498.1| PREDICTED: aminoacylase-1-like [Apis mellifera] Back     alignment and taxonomy information
>gi|383851451|ref|XP_003701246.1| PREDICTED: aminoacylase-1-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|395516946|ref|XP_003762644.1| PREDICTED: aminoacylase-1A-like [Sarcophilus harrisii] Back     alignment and taxonomy information
>gi|363738590|ref|XP_003642034.1| PREDICTED: aminoacylase-1-like isoform 2 [Gallus gallus] Back     alignment and taxonomy information
>gi|363738588|ref|XP_003642033.1| PREDICTED: aminoacylase-1-like isoform 1 [Gallus gallus] Back     alignment and taxonomy information
>gi|326927775|ref|XP_003210064.1| PREDICTED: aminoacylase-1-like, partial [Meleagris gallopavo] Back     alignment and taxonomy information
>gi|260798889|ref|XP_002594432.1| hypothetical protein BRAFLDRAFT_262219 [Branchiostoma floridae] gi|229279666|gb|EEN50443.1| hypothetical protein BRAFLDRAFT_262219 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|380020424|ref|XP_003694085.1| PREDICTED: LOW QUALITY PROTEIN: aminoacylase-1-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query58
UNIPROTKB|F8WC59201 ACY1 "Aminoacylase-1" [Homo sa 0.551 0.159 0.656 6.5e-07
UNIPROTKB|C9JYZ0228 ACY1 "Aminoacylase-1" [Homo sa 0.551 0.140 0.656 1e-06
UNIPROTKB|F1PHI4 408 ACY1 "Uncharacterized protein" 0.551 0.078 0.687 1.3e-06
UNIPROTKB|Q3T0V2 373 ACY1 "Aminoacylase 1" [Bos tau 0.551 0.085 0.687 2.4e-06
UNIPROTKB|C9JWD4 343 ACY1 "Aminoacylase-1" [Homo sa 0.551 0.093 0.656 2.7e-06
UNIPROTKB|C9J6I6 373 ACY1 "Aminoacylase-1" [Homo sa 0.551 0.085 0.656 3.1e-06
UNIPROTKB|Q03154 408 ACY1 "Aminoacylase-1" [Homo sa 0.551 0.078 0.656 3.6e-06
UNIPROTKB|F1MR63 501 ACY1 "Uncharacterized protein" 0.551 0.063 0.687 3.9e-06
UNIPROTKB|B4DNW0 498 ACY1 "cDNA FLJ60317, highly si 0.551 0.064 0.656 4.9e-06
UNIPROTKB|C9JMV9 509 ABHD14A-ACY1 "Protein ABHD14A- 0.551 0.062 0.656 5.1e-06
UNIPROTKB|F8WC59 ACY1 "Aminoacylase-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 115 (45.5 bits), Expect = 6.5e-07, P = 6.5e-07
 Identities = 21/32 (65%), Positives = 25/32 (78%)

Query:     1 MKCVGIQYLETIRRYIAEGKKFKRTIHVSFVP 32
             MKCV IQYLE +RR   EG +F RTIH++FVP
Sbjct:   114 MKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVP 145




GO:0004046 "aminoacylase activity" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
GO:0006520 "cellular amino acid metabolic process" evidence=IEA
GO:0008237 "metallopeptidase activity" evidence=IEA
UNIPROTKB|C9JYZ0 ACY1 "Aminoacylase-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1PHI4 ACY1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T0V2 ACY1 "Aminoacylase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|C9JWD4 ACY1 "Aminoacylase-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C9J6I6 ACY1 "Aminoacylase-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q03154 ACY1 "Aminoacylase-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MR63 ACY1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B4DNW0 ACY1 "cDNA FLJ60317, highly similar to Aminoacylase-1 (EC 3.5.1.14)" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|C9JMV9 ABHD14A-ACY1 "Protein ABHD14A-ACY1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5RFB0ACY1_PONAB3, ., 5, ., 1, ., 1, 40.6250.55170.0784yesN/A
P37111ACY1_PIG3, ., 5, ., 1, ., 1, 40.65620.55170.0786yesN/A
Q6AYS7ACY1A_RAT3, ., 5, ., 1, ., 1, 40.6250.55170.0784yesN/A
Q55DP8ACY1_DICDI3, ., 5, ., 1, ., 1, 40.59370.55170.0784yesN/A
Q6PTT0ACY1B_RAT3, ., 5, ., 1, ., 1, 40.6250.55170.0784yesN/A
Q99JW2ACY1_MOUSE3, ., 5, ., 1, ., 1, 40.6250.55170.0784yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query58
cd05646 391 cd05646, M20_AcylaseI_like, M20 Aminoacylase-I lik 8e-17
TIGR01880 400 TIGR01880, Ac-peptdase-euk, N-acyl-L-amino-acid am 9e-14
>gnl|CDD|193524 cd05646, M20_AcylaseI_like, M20 Aminoacylase-I like subfamily Back     alignment and domain information
 Score = 71.2 bits (175), Expect = 8e-17
 Identities = 25/32 (78%), Positives = 26/32 (81%)

Query: 1   MKCVGIQYLETIRRYIAEGKKFKRTIHVSFVP 32
           MKCVGIQYLE IRR  A G K KRTIH+SFVP
Sbjct: 106 MKCVGIQYLEAIRRLKASGFKPKRTIHLSFVP 137


Peptidase M20 family, Aminoacylase-I like (AcyI-like; Acylase I; N-acyl-L-amino-acid amidohydrolase; EC 3.5.1.14) subfamily. Acylase I is involved in the hydrolysis of N-acylated or N-acetylated amino acids (except L-aspartate) and is considered as a potential target of antimicrobial agents. Porcine AcyI is also shown to deacetylate certain quorum-sensing N-acylhomoserine lactones, while the rat enzyme has been implicated in degradation of chemotactic peptides of commensal bacteria. Prokaryotic arginine synthesis usually involves the transfer of an acetyl group to glutamate by ornithine acetyltransferase in order to form ornithine. However, Escherichia coli acetylornithine deacetylase (acetylornithinase, ArgE) (EC 3.5.1.16) catalyzes the deacylation of N2-acetyl-L-ornithine to yield ornithine and acetate. Phylogenetic evidence suggests that the clustering of the arg genes in one continuous sequence pattern arose in an ancestor common to Enterobacteriaceae and Vibrionaceae, where ornithine acetyltransferase was lost and replaced by a deacylase. Length = 391

>gnl|CDD|233615 TIGR01880, Ac-peptdase-euk, N-acyl-L-amino-acid amidohydrolase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 58
KOG2275|consensus 420 99.31
PRK12891 414 allantoate amidohydrolase; Reviewed 98.86
PF01546189 Peptidase_M20: Peptidase family M20/M25/M40 This f 98.85
TIGR03176 406 AllC allantoate amidohydrolase. This enzyme cataly 98.84
PRK07205 444 hypothetical protein; Provisional 98.83
PRK07338 402 hypothetical protein; Provisional 98.79
PRK07906 426 hypothetical protein; Provisional 98.78
PRK13983 400 diaminopimelate aminotransferase; Provisional 98.77
PRK13013 427 succinyl-diaminopimelate desuccinylase; Reviewed 98.77
PRK07318 466 dipeptidase PepV; Reviewed 98.74
PRK08588 377 succinyl-diaminopimelate desuccinylase; Reviewed 98.71
PRK08262 486 hypothetical protein; Provisional 98.7
TIGR01880 400 Ac-peptdase-euk N-acyl-L-amino-acid amidohydrolase 98.7
PRK12890 414 allantoate amidohydrolase; Reviewed 98.67
PRK13009 375 succinyl-diaminopimelate desuccinylase; Reviewed 98.66
PRK09104 464 hypothetical protein; Validated 98.65
TIGR01246 370 dapE_proteo succinyl-diaminopimelate desuccinylase 98.65
TIGR01887 447 dipeptidaselike dipeptidase, putative. This model 98.64
PRK07473 376 carboxypeptidase; Provisional 98.63
PRK13590 591 putative bifunctional OHCU decarboxylase/allantoat 98.62
PRK09133 472 hypothetical protein; Provisional 98.62
PRK08596 421 acetylornithine deacetylase; Validated 98.6
PRK06156 520 hypothetical protein; Provisional 98.59
COG0624 409 ArgE Acetylornithine deacetylase/Succinyl-diaminop 98.59
PRK08201 456 hypothetical protein; Provisional 98.59
TIGR01910 375 DapE-ArgE acetylornithine deacetylase or succinyl- 98.58
PRK09290 413 allantoate amidohydrolase; Reviewed 98.57
PRK12893 412 allantoate amidohydrolase; Reviewed 98.56
TIGR01886 466 dipeptidase dipeptidase PepV. This model represent 98.52
PRK06915 422 acetylornithine deacetylase; Validated 98.52
PRK06446 436 hypothetical protein; Provisional 98.52
PRK06133 410 glutamate carboxypeptidase; Reviewed 98.51
PRK07079 469 hypothetical protein; Provisional 98.51
PRK04443 348 acetyl-lysine deacetylase; Provisional 98.51
TIGR01883 361 PepT-like peptidase T-like protein. This model rep 98.51
PRK13799 591 unknown domain/N-carbamoyl-L-amino acid hydrolase 98.5
PRK06837 427 acetylornithine deacetylase; Provisional 98.48
TIGR01879 401 hydantase amidase, hydantoinase/carbamoylase famil 98.44
PRK05469 408 peptidase T; Provisional 98.42
TIGR01882 410 peptidase-T peptidase T. This model represents a t 98.41
PRK08554 438 peptidase; Reviewed 98.41
PRK13004 399 peptidase; Reviewed 98.39
PRK12892 412 allantoate amidohydrolase; Reviewed 98.39
PRK08652 347 acetylornithine deacetylase; Provisional 98.38
TIGR01900 373 dapE-gram_pos succinyl-diaminopimelate desuccinyla 98.37
PRK08651 394 succinyl-diaminopimelate desuccinylase; Reviewed 98.33
PRK13381 404 peptidase T; Provisional 98.32
PRK07522 385 acetylornithine deacetylase; Provisional 98.31
TIGR01892 364 AcOrn-deacetyl acetylornithine deacetylase (ArgE). 98.3
TIGR03106 343 trio_M42_hydro hydrolase, peptidase M42 family. Th 98.3
PRK07907 449 hypothetical protein; Provisional 98.24
PRK05111 383 acetylornithine deacetylase; Provisional 98.24
PRK13007 352 succinyl-diaminopimelate desuccinylase; Reviewed 98.21
PRK00466 346 acetyl-lysine deacetylase; Validated 98.2
TIGR03320 395 ygeY M20/DapE family protein YgeY. Members of this 98.18
PRK10199 346 alkaline phosphatase isozyme conversion aminopepti 98.16
TIGR01902 336 dapE-lys-deAc N-acetyl-ornithine/N-acetyl-lysine d 98.13
TIGR03526 395 selenium_YgeY putative selenium metabolism hydrola 97.99
PF04389179 Peptidase_M28: Peptidase family M28; InterPro: IPR 97.98
PLN02693 437 IAA-amino acid hydrolase 97.87
PRK08737 364 acetylornithine deacetylase; Provisional 97.86
TIGR01891 363 amidohydrolases amidohydrolase. This model represe 97.74
TIGR01893 477 aa-his-dipept aminoacyl-histidine dipeptidase. 97.7
PRK15026 485 aminoacyl-histidine dipeptidase; Provisional 97.59
PLN02280 478 IAA-amino acid hydrolase 97.48
PRK09961 344 exoaminopeptidase; Provisional 96.93
KOG2195|consensus 702 96.58
TIGR03107 350 glu_aminopep glutamyl aminopeptidase. This model r 96.56
PF05343 292 Peptidase_M42: M42 glutamyl aminopeptidase; InterP 96.42
COG1363 355 FrvX Cellulase M and related proteins [Carbohydrat 96.2
COG2234 435 Iap Predicted aminopeptidases [General function pr 96.12
PRK09864 356 putative peptidase; Provisional 96.1
COG2195 414 PepD Di- and tripeptidases [Amino acid transport a 95.74
COG4187 553 RocB Arginine degradation protein (predicted deacy 95.7
KOG2276|consensus 473 93.67
PRK02256 462 putative aminopeptidase 1; Provisional 93.64
COG1473 392 AbgB Metal-dependent amidase/aminoacylase/carboxyp 90.27
PF05450 234 Nicastrin: Nicastrin; InterPro: IPR008710 Nicastri 89.69
PF02127 432 Peptidase_M18: Aminopeptidase I zinc metalloprotea 88.96
PRK02813 428 putative aminopeptidase 2; Provisional 88.77
KOG2194|consensus 834 85.47
PTZ00371 465 aspartyl aminopeptidase; Provisional 85.08
>KOG2275|consensus Back     alignment and domain information
Probab=99.31  E-value=3.7e-12  Score=91.06  Aligned_cols=49  Identities=47%  Similarity=0.694  Sum_probs=44.9

Q ss_pred             ChHHHHHHHHHHHHHHHcCCCCCceEEEEeeCCCCCCChhhhHHHHHHHH
Q psy3109           1 MKCVGIQYLETIRRYIAEGKKFKRTIHVSFVPGPVTQNETCGLAAANSVL   50 (58)
Q Consensus         1 MK~~~~~~leAl~~L~~~g~~p~r~I~l~f~~DEE~Gg~~~g~~~~~s~~   50 (58)
                      |||.++|+++|+|.|+..|++|+|||.++|++|||+||. .|+.-+++.+
T Consensus       130 ~K~~~va~leAir~L~~~g~kp~Rti~lsfvpDEEi~G~-~Gm~~fa~~~  178 (420)
T KOG2275|consen  130 MKCVGVAYLEAIRNLKASGFKPKRTIHLSFVPDEEIGGH-IGMKEFAKTE  178 (420)
T ss_pred             hHhHHHHHHHHHHHHHhcCCCcCceEEEEecCchhccCc-chHHHHhhhh
Confidence            899999999999999999999999999999999999997 5777777644



>PRK12891 allantoate amidohydrolase; Reviewed Back     alignment and domain information
>PF01546 Peptidase_M20: Peptidase family M20/M25/M40 This family only corresponds to M20 family; InterPro: IPR002933 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR03176 AllC allantoate amidohydrolase Back     alignment and domain information
>PRK07205 hypothetical protein; Provisional Back     alignment and domain information
>PRK07338 hypothetical protein; Provisional Back     alignment and domain information
>PRK07906 hypothetical protein; Provisional Back     alignment and domain information
>PRK13983 diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK13013 succinyl-diaminopimelate desuccinylase; Reviewed Back     alignment and domain information
>PRK07318 dipeptidase PepV; Reviewed Back     alignment and domain information
>PRK08588 succinyl-diaminopimelate desuccinylase; Reviewed Back     alignment and domain information
>PRK08262 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01880 Ac-peptdase-euk N-acyl-L-amino-acid amidohydrolase Back     alignment and domain information
>PRK12890 allantoate amidohydrolase; Reviewed Back     alignment and domain information
>PRK13009 succinyl-diaminopimelate desuccinylase; Reviewed Back     alignment and domain information
>PRK09104 hypothetical protein; Validated Back     alignment and domain information
>TIGR01246 dapE_proteo succinyl-diaminopimelate desuccinylase, proteobacterial clade Back     alignment and domain information
>TIGR01887 dipeptidaselike dipeptidase, putative Back     alignment and domain information
>PRK07473 carboxypeptidase; Provisional Back     alignment and domain information
>PRK13590 putative bifunctional OHCU decarboxylase/allantoate amidohydrolase; Provisional Back     alignment and domain information
>PRK09133 hypothetical protein; Provisional Back     alignment and domain information
>PRK08596 acetylornithine deacetylase; Validated Back     alignment and domain information
>PRK06156 hypothetical protein; Provisional Back     alignment and domain information
>COG0624 ArgE Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08201 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01910 DapE-ArgE acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase Back     alignment and domain information
>PRK09290 allantoate amidohydrolase; Reviewed Back     alignment and domain information
>PRK12893 allantoate amidohydrolase; Reviewed Back     alignment and domain information
>TIGR01886 dipeptidase dipeptidase PepV Back     alignment and domain information
>PRK06915 acetylornithine deacetylase; Validated Back     alignment and domain information
>PRK06446 hypothetical protein; Provisional Back     alignment and domain information
>PRK06133 glutamate carboxypeptidase; Reviewed Back     alignment and domain information
>PRK07079 hypothetical protein; Provisional Back     alignment and domain information
>PRK04443 acetyl-lysine deacetylase; Provisional Back     alignment and domain information
>TIGR01883 PepT-like peptidase T-like protein Back     alignment and domain information
>PRK13799 unknown domain/N-carbamoyl-L-amino acid hydrolase fusion protein; Provisional Back     alignment and domain information
>PRK06837 acetylornithine deacetylase; Provisional Back     alignment and domain information
>TIGR01879 hydantase amidase, hydantoinase/carbamoylase family Back     alignment and domain information
>PRK05469 peptidase T; Provisional Back     alignment and domain information
>TIGR01882 peptidase-T peptidase T Back     alignment and domain information
>PRK08554 peptidase; Reviewed Back     alignment and domain information
>PRK13004 peptidase; Reviewed Back     alignment and domain information
>PRK12892 allantoate amidohydrolase; Reviewed Back     alignment and domain information
>PRK08652 acetylornithine deacetylase; Provisional Back     alignment and domain information
>TIGR01900 dapE-gram_pos succinyl-diaminopimelate desuccinylase Back     alignment and domain information
>PRK08651 succinyl-diaminopimelate desuccinylase; Reviewed Back     alignment and domain information
>PRK13381 peptidase T; Provisional Back     alignment and domain information
>PRK07522 acetylornithine deacetylase; Provisional Back     alignment and domain information
>TIGR01892 AcOrn-deacetyl acetylornithine deacetylase (ArgE) Back     alignment and domain information
>TIGR03106 trio_M42_hydro hydrolase, peptidase M42 family Back     alignment and domain information
>PRK07907 hypothetical protein; Provisional Back     alignment and domain information
>PRK05111 acetylornithine deacetylase; Provisional Back     alignment and domain information
>PRK13007 succinyl-diaminopimelate desuccinylase; Reviewed Back     alignment and domain information
>PRK00466 acetyl-lysine deacetylase; Validated Back     alignment and domain information
>TIGR03320 ygeY M20/DapE family protein YgeY Back     alignment and domain information
>PRK10199 alkaline phosphatase isozyme conversion aminopeptidase; Provisional Back     alignment and domain information
>TIGR01902 dapE-lys-deAc N-acetyl-ornithine/N-acetyl-lysine deacetylase Back     alignment and domain information
>TIGR03526 selenium_YgeY putative selenium metabolism hydrolase Back     alignment and domain information
>PF04389 Peptidase_M28: Peptidase family M28; InterPro: IPR007484 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN02693 IAA-amino acid hydrolase Back     alignment and domain information
>PRK08737 acetylornithine deacetylase; Provisional Back     alignment and domain information
>TIGR01891 amidohydrolases amidohydrolase Back     alignment and domain information
>TIGR01893 aa-his-dipept aminoacyl-histidine dipeptidase Back     alignment and domain information
>PRK15026 aminoacyl-histidine dipeptidase; Provisional Back     alignment and domain information
>PLN02280 IAA-amino acid hydrolase Back     alignment and domain information
>PRK09961 exoaminopeptidase; Provisional Back     alignment and domain information
>KOG2195|consensus Back     alignment and domain information
>TIGR03107 glu_aminopep glutamyl aminopeptidase Back     alignment and domain information
>PF05343 Peptidase_M42: M42 glutamyl aminopeptidase; InterPro: IPR008007 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>COG1363 FrvX Cellulase M and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2234 Iap Predicted aminopeptidases [General function prediction only] Back     alignment and domain information
>PRK09864 putative peptidase; Provisional Back     alignment and domain information
>COG2195 PepD Di- and tripeptidases [Amino acid transport and metabolism] Back     alignment and domain information
>COG4187 RocB Arginine degradation protein (predicted deacylase) [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2276|consensus Back     alignment and domain information
>PRK02256 putative aminopeptidase 1; Provisional Back     alignment and domain information
>COG1473 AbgB Metal-dependent amidase/aminoacylase/carboxypeptidase [General function prediction only] Back     alignment and domain information
>PF05450 Nicastrin: Nicastrin; InterPro: IPR008710 Nicastrin and presenilin are two major components of the gamma-secretase complex, which executes the intramembrane proteolysis of type I integral membrane proteins such as the amyloid precursor protein (APP) and Notch Back     alignment and domain information
>PF02127 Peptidase_M18: Aminopeptidase I zinc metalloprotease (M18); InterPro: IPR001948 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PRK02813 putative aminopeptidase 2; Provisional Back     alignment and domain information
>KOG2194|consensus Back     alignment and domain information
>PTZ00371 aspartyl aminopeptidase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query58
1q7l_A198 Zn-binding Domain Of The T347g Mutant Of Human Amin 6e-08
>pdb|1Q7L|A Chain A, Zn-binding Domain Of The T347g Mutant Of Human Aminoacylase- I Length = 198 Back     alignment and structure

Iteration: 1

Score = 52.4 bits (124), Expect = 6e-08, Method: Composition-based stats. Identities = 21/32 (65%), Positives = 25/32 (78%) Query: 1 MKCVGIQYLETIRRYIAEGKKFKRTIHVSFVP 32 MKCV IQYLE +RR EG +F RTIH++FVP Sbjct: 114 MKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVP 145 Database: pdbaa

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query58
1q7l_A198 Aminoacylase-1; catalysis, enzyme dimerization, si 2e-09
>1q7l_A Aminoacylase-1; catalysis, enzyme dimerization, site- directed mutagenesis, structure comparison, zinc, hydrolase; 1.40A {Homo sapiens} SCOP: c.56.5.4 Length = 198 Back     alignment and structure
 Score = 49.0 bits (117), Expect = 2e-09
 Identities = 21/32 (65%), Positives = 25/32 (78%)

Query: 1   MKCVGIQYLETIRRYIAEGKKFKRTIHVSFVP 32
           MKCV IQYLE +RR   EG +F RTIH++FVP
Sbjct: 114 MKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVP 145


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query58
1q7l_A198 Aminoacylase-1; catalysis, enzyme dimerization, si 99.02
4h2k_A 269 Succinyl-diaminopimelate desuccinylase; DAPE, MCSG 98.81
3t68_A 268 Succinyl-diaminopimelate desuccinylase; DAPE, csgi 98.8
1lfw_A 470 PEPV; hydrolase, dipeptidase; HET: AEP; 1.80A {Bac 98.75
2zog_A 479 Cytosolic non-specific dipeptidase; metallopeptida 98.73
1rtq_A 299 Bacterial leucyl aminopeptidase; bimetallic, zinc, 98.72
1vgy_A 393 Succinyl-diaminopimelate desuccinylase; structural 98.71
1tkj_A 284 Aminopeptidase, SGAP; double-zinc metalloproteinas 98.68
3khx_A 492 Putative dipeptidase sacol1801; DAPE, metallopepti 98.67
1cg2_A 393 Carboxypeptidase G2; metallocarboxypeptidase, hydr 98.66
2pok_A 481 Peptidase, M20/M25/M40 family; M20 family peptidas 98.64
3dlj_A 485 Beta-Ala-His dipeptidase; CNDP1, carnosine dipepti 98.63
2gre_A 349 Deblocking aminopeptidase; structural genomi prote 98.6
3pfo_A 433 Putative acetylornithine deacetylase; metal bindin 98.59
3pfe_A 472 Succinyl-diaminopimelate desuccinylase; metal bind 98.57
3ife_A 434 Peptidase T; metallopeptidase, aminopeptidase, hyd 98.55
3isz_A 377 Succinyl-diaminopimelate desuccinylase; DAPE, Zn-b 98.55
2v8h_A 474 Beta-alanine synthase; amidohydrolase, alpha and b 98.54
3ct9_A 356 Acetylornithine deacetylase; NP_812461.1, A putati 98.48
3tx8_A 369 Succinyl-diaminopimelate desuccinylase; peptidase, 98.47
1vhe_A 373 Aminopeptidase/glucanase homolog; structural genom 98.45
1z2l_A 423 Allantoate amidohydrolase; ALLC, purine cataboli a 98.43
1fno_A 417 Peptidase T; metallo peptidase, protease, hydrolas 98.42
2wyr_A 332 Cobalt-activated peptidase TET1; hydrolase, large 98.42
3gux_A 314 Putative Zn-dependent exopeptidase; aminopeptidase 98.41
3tc8_A 309 Leucine aminopeptidase; phosphorylase/hydrolase-li 98.4
2rb7_A 364 Peptidase, M20/M25/M40 family; YP_387682.1, CO-cat 98.39
3gb0_A 373 Peptidase T; NP_980509.1, aminopeptidase PEPT, pep 98.38
3n5f_A 408 L-carbamoylase, N-carbamoyl-L-amino acid hydrolase 98.33
3rza_A 396 Tripeptidase; phosphorylase/hydrolase-like, struct 98.33
1xmb_A 418 IAA-amino acid hydrolase homolog 2; structural gen 98.3
3iib_A 444 Peptidase M28; YP_926796.1, structural genomics, J 98.28
1y0y_A 353 FRV operon protein FRVX; aminopeptidase, PDZ, hydr 98.26
2fvg_A 340 Endoglucanase; TM1049, structural genomics, joint 98.18
2afw_A 329 Glutaminyl-peptide cyclotransferase; alpha-beta pr 98.17
1ysj_A 404 Protein YXEP; M20 family peptidase, dinuclear meta 98.15
3io1_A 445 Aminobenzoyl-glutamate utilization protein; peptid 97.99
2f7v_A 369 Aectylcitrulline deacetylase; alpha/beta, hydrolas 97.95
2ek8_A 421 Aminopeptidase; metalloproteinase, hydrolase; 1.80 97.9
4f9u_A 312 CG32412; alpha/beta hydrolase, PGlu formation, PE, 97.77
1ylo_A 348 Hypothetical protein SF2450; structural genomics, 97.66
2qyv_A 487 XAA-His dipeptidase; YP_718209.1, structural genom 97.61
4fai_A 330 CG5976, isoform B; alpha/beta hydrolase, PGlu form 97.59
3fed_A 707 Glutamate carboxypeptidase III; metallopeptidase, 97.54
3mru_A 490 Aminoacyl-histidine dipeptidase; metalloprotease, 97.53
1vho_A 346 Endoglucanase; structural genomics, unknown functi 97.5
3kas_A 640 Transferrin receptor protein 1; transferrin recept 97.44
3pb6_X 330 Glutaminyl-peptide cyclotransferase-like protein; 97.37
3ram_A 394 HMRA protein; two-domain, catalytic (alpha-beta-al 97.36
3kl9_A 355 PEPA, glutamyl aminopeptidase; tetrahedral aminope 97.27
4fuu_A 309 Leucine aminopeptidase; phosphorylase/hydrolase li 97.2
3cpx_A 321 Aminopeptidase, M42 family; YP_676701.1, putative 97.05
2vpu_A 354 TET3, 354AA long hypothetical operon protein FRV; 96.72
3isx_A 343 Endoglucanase; TM1050, structural genomics, joint 95.5
1y7e_A 458 Probable M18-family aminopeptidase 1; aminopeptida 93.98
2glj_A 461 Probable M18-family aminopeptidase 1; aminopeptida 93.8
2glf_A 450 Probable M18-family aminopeptidase 1; putative, NY 91.9
3k9t_A 435 Putative peptidase; structural genomics, joint cen 86.91
2ijz_A 428 Probable M18-family aminopeptidase 2; putative ami 85.58
>1q7l_A Aminoacylase-1; catalysis, enzyme dimerization, site- directed mutagenesis, structure comparison, zinc, hydrolase; 1.40A {Homo sapiens} SCOP: c.56.5.4 Back     alignment and structure
Probab=99.02  E-value=5.8e-10  Score=69.78  Aligned_cols=46  Identities=46%  Similarity=0.725  Sum_probs=39.8

Q ss_pred             ChHHHHHHHHHHHHHHHcCCCCCceEEEEeeCCCCCCChhhhHHHH
Q psy3109           1 MKCVGIQYLETIRRYIAEGKKFKRTIHVSFVPGPVTQNETCGLAAA   46 (58)
Q Consensus         1 MK~~~~~~leAl~~L~~~g~~p~r~I~l~f~~DEE~Gg~~~g~~~~   46 (58)
                      ||+++++.++|++.|++.+..|+++|+++|++|||+|+..+...++
T Consensus       114 ~K~g~a~~l~a~~~l~~~~~~~~~~v~~~~~~~EE~g~~~Ga~~~~  159 (198)
T 1q7l_A          114 MKCVSIQYLEAVRRLKVEGHRFPRTIHMTFVPDEEVGGHQGMELFV  159 (198)
T ss_dssp             THHHHHHHHHHHHHHHHTTCCCSSCEEEEEESCGGGTSTTTHHHHT
T ss_pred             chHHHHHHHHHHHHHHHcCCCCCCCEEEEEEcccccCccccHHHHH
Confidence            8999999999999999999889999999999999998653333333



>4h2k_A Succinyl-diaminopimelate desuccinylase; DAPE, MCSG, PSI-biology, structural genomics, midwest center structural genomics, hydrolase; 1.84A {Haemophilus influenzae} Back     alignment and structure
>3t68_A Succinyl-diaminopimelate desuccinylase; DAPE, csgid, metalloenzyme, structural genomics; 1.65A {Vibrio cholerae o1 biovar el tor} PDB: 3t6m_A Back     alignment and structure
>1lfw_A PEPV; hydrolase, dipeptidase; HET: AEP; 1.80A {Bacteria} SCOP: c.56.5.4 d.58.19.1 Back     alignment and structure
>2zog_A Cytosolic non-specific dipeptidase; metallopeptidase, protein-inhibitor complex, CNDP2, CNDP DIP 2, bestatin, L-carnosine, carnosinase, Zn; HET: BES; 1.70A {Mus musculus} PDB: 2zof_A* Back     alignment and structure
>1rtq_A Bacterial leucyl aminopeptidase; bimetallic, zinc, high resolution, hydrolase; 0.95A {Vibrio proteolyticus} SCOP: c.56.5.4 PDB: 1txr_A* 1xry_A* 2dea_A 2nyq_A 3fh4_A 3vh9_A* 1lok_A 1cp6_A 1ft7_A* 1igb_A* 1amp_A 2iq6_A 2prq_A 3b3v_A 3b3w_A 3b7i_A* 3b3t_A 3b35_A 3b3c_A* 3b3s_A ... Back     alignment and structure
>1vgy_A Succinyl-diaminopimelate desuccinylase; structural genomics, unknown function; HET: MSE; 1.90A {Neisseria meningitidis} SCOP: c.56.5.4 d.58.19.1 Back     alignment and structure
>1tkj_A Aminopeptidase, SGAP; double-zinc metalloproteinase, calcium activation, protein- inhibitor complex, hydrolase; HET: MED; 1.15A {Streptomyces griseus} SCOP: c.56.5.4 PDB: 1f2o_A 1f2p_A* 1cp7_A 1qq9_A* 1tf9_A* 1tf8_A* 1tkh_A* 1tkf_A* 1xbu_A* 1xjo_A Back     alignment and structure
>3khx_A Putative dipeptidase sacol1801; DAPE, metallopeptidase, hydrolase, metal-bindin metalloprotease, protease; 2.30A {Staphylococcus aureus} PDB: 3ki9_A 3khz_A Back     alignment and structure
>1cg2_A Carboxypeptidase G2; metallocarboxypeptidase, hydrolase; 2.50A {Pseudomonas SP} SCOP: c.56.5.4 d.58.19.1 Back     alignment and structure
>2pok_A Peptidase, M20/M25/M40 family; M20 family peptidase, metallo protein, MCSG, structural GENO PSI-2, protein structure initiative; HET: BGC; 1.90A {Streptococcus pneumoniae} Back     alignment and structure
>3dlj_A Beta-Ala-His dipeptidase; CNDP1, carnosine dipeptidase 1, structural genomics, structu genomics consortium, SGC, metallopeptidase M20 family; 2.26A {Homo sapiens} Back     alignment and structure
>2gre_A Deblocking aminopeptidase; structural genomi protein structure initiative, midwest center for structural genomics, MCSG, hydrolase; 2.65A {Bacillus cereus} SCOP: b.49.3.1 c.56.5.4 Back     alignment and structure
>3pfo_A Putative acetylornithine deacetylase; metal binding, merops M20A family, amino-acid biosynthesis, metallopeptidase; 1.90A {Rhodopseudomonas palustris} Back     alignment and structure
>3pfe_A Succinyl-diaminopimelate desuccinylase; metal binding, merops M20 familiy, phosphorylase/hydrolase-L structural genomics; HET: MSE; 1.50A {Legionella pneumophila subsp} Back     alignment and structure
>3ife_A Peptidase T; metallopeptidase, aminopeptidase, hydro metal-binding, metalloprotease, protease; HET: SUC; 1.55A {Bacillus anthracis} Back     alignment and structure
>3isz_A Succinyl-diaminopimelate desuccinylase; DAPE, Zn-binding, metallopeptidase, structural genomics, PSI-2, protein struc initiative; 2.00A {Haemophilus influenzae} PDB: 3ic1_A Back     alignment and structure
>2v8h_A Beta-alanine synthase; amidohydrolase, alpha and beta protein, DI-zinc center, COMP N-carbamyl-beta-alanine, hydrolase; HET: BCN; 2.0A {Saccharomyces kluyveri} PDB: 2v8d_A* 2vl1_A 2v8g_A 2v8v_A 1r43_A 1r3n_A Back     alignment and structure
>3ct9_A Acetylornithine deacetylase; NP_812461.1, A putative zinc peptidase, peptidase family M20 structural genomics; 2.31A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3tx8_A Succinyl-diaminopimelate desuccinylase; peptidase, structural genomics, joint center for structural JCSG; 2.97A {Corynebacterium glutamicum} Back     alignment and structure
>1vhe_A Aminopeptidase/glucanase homolog; structural genomics, unknown function; HET: MSE; 1.90A {Bacillus subtilis} SCOP: b.49.3.1 c.56.5.4 Back     alignment and structure
>1z2l_A Allantoate amidohydrolase; ALLC, purine cataboli allantoin utilization, structural genomics, PSI, Pro structure initiative; HET: 1AL; 2.25A {Escherichia coli} SCOP: c.56.5.4 d.58.19.1 PDB: 2imo_A Back     alignment and structure
>1fno_A Peptidase T; metallo peptidase, protease, hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.56.5.4 d.58.19.1 PDB: 1vix_A Back     alignment and structure
>2wyr_A Cobalt-activated peptidase TET1; hydrolase, large SELF-assembled dodecamer, hyperthermophilic; 2.24A {Pyrococcus horikoshii} PDB: 2cf4_A Back     alignment and structure
>3gux_A Putative Zn-dependent exopeptidase; aminopeptidase, phosphorylase/hydrolase-like fold, structura genomics; 1.80A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>3tc8_A Leucine aminopeptidase; phosphorylase/hydrolase-like, structural genomics, joint CEN structural genomics, JCSG; 1.06A {Parabacteroides distasonis} Back     alignment and structure
>2rb7_A Peptidase, M20/M25/M40 family; YP_387682.1, CO-catalytic metallopeptidase, peptidase family M20/M25/M40, structural genomics; HET: MSE PGE PG4; 1.60A {Desulfovibrio desulfuricans subsp} Back     alignment and structure
>3gb0_A Peptidase T; NP_980509.1, aminopeptidase PEPT, peptidase family M20/M25/M structural genomics, joint center for structural genomics; 2.04A {Bacillus cereus atcc 10987} Back     alignment and structure
>3n5f_A L-carbamoylase, N-carbamoyl-L-amino acid hydrolase; hinge domain, M20 peptidase family, evolution, residue, dimerization domain; 2.75A {Bacillus stearothermophilus} Back     alignment and structure
>3rza_A Tripeptidase; phosphorylase/hydrolase-like, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; HET: CIT PG4 PGE; 2.10A {Staphylococcus aureus subsp} Back     alignment and structure
>1xmb_A IAA-amino acid hydrolase homolog 2; structural genomics, protein structure initiative, CESG AT5G56660, ILL2, indole-3-acetic acid, auxin; 2.00A {Arabidopsis thaliana} SCOP: c.56.5.4 d.58.19.1 PDB: 2q43_A Back     alignment and structure
>3iib_A Peptidase M28; YP_926796.1, structural genomics, J center for structural genomics, JCSG, protein structure INI PSI-2; HET: PGE; 1.70A {Shewanella amazonensis SB2B} Back     alignment and structure
>1y0y_A FRV operon protein FRVX; aminopeptidase, PDZ, hydrolase; HET: ATI; 1.60A {Pyrococcus horikoshii} SCOP: b.49.3.1 c.56.5.4 PDB: 1y0r_A* 1xfo_A Back     alignment and structure
>2fvg_A Endoglucanase; TM1049, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS hydrolase; 2.01A {Thermotoga maritima} SCOP: b.49.3.1 c.56.5.4 Back     alignment and structure
>2afw_A Glutaminyl-peptide cyclotransferase; alpha-beta protein, metalloprotein; HET: AHN; 1.56A {Homo sapiens} SCOP: c.56.5.8 PDB: 2afo_A 2afm_A* 2afx_A* 2afz_A 3pbb_A* 2zed_A 2zeh_A 2afu_A 2zee_A 2zeo_A 2zef_A 2zem_A 2zel_A 2zen_A 3pbe_A 2zeg_A 2zep_A 2afs_A 3si0_A* 3si2_A* ... Back     alignment and structure
>1ysj_A Protein YXEP; M20 family peptidase, dinuclear metal binding, structural GE PSI, protein structure initiative; 2.40A {Bacillus subtilis} SCOP: c.56.5.4 d.58.19.1 Back     alignment and structure
>3io1_A Aminobenzoyl-glutamate utilization protein; peptidase_M20D superfamily, protein structure initiative II, NYSGXRC, structural genomics; 2.50A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2f7v_A Aectylcitrulline deacetylase; alpha/beta, hydrolase; 1.75A {Xanthomonas campestris} PDB: 2f8h_A Back     alignment and structure
>2ek8_A Aminopeptidase; metalloproteinase, hydrolase; 1.80A {Aneurinibacillus SP} PDB: 2ek9_A* Back     alignment and structure
>4f9u_A CG32412; alpha/beta hydrolase, PGlu formation, PE, alzheimer'S diseas pyroglutamate, PGlu-amyloid, glycosylation, transferase, HY; HET: PBD NAG BMA MAN; 1.80A {Drosophila melanogaster} PDB: 4f9v_A* Back     alignment and structure
>1ylo_A Hypothetical protein SF2450; structural genomics, MCSG, PSI, structure initiative; 2.15A {Shigella flexneri 2a str} SCOP: b.49.3.1 c.56.5.4 Back     alignment and structure
>2qyv_A XAA-His dipeptidase; YP_718209.1, structural genomi center for structural genomics, JCSG, protein structure INI PSI-2, hydrolase; 2.11A {Haemophilus somnus 129PT} Back     alignment and structure
>4fai_A CG5976, isoform B; alpha/beta hydrolase, PGlu formation, PE, alzheimer'S diseas pyroglutamate, PGlu-amyloid, transferase, hydrolase; HET: PBD; 1.65A {Drosophila melanogaster} PDB: 4fbe_A* Back     alignment and structure
>3fed_A Glutamate carboxypeptidase III; metallopeptidase, bimetallic active site, N-glycosylation, C cation, chloride anion, zinc IONS, dipept glycoprotein; HET: NAG BIX; 1.29A {Homo sapiens} PDB: 3fec_A* 3fee_A* 3ff3_A* 2c6c_A* 2c6g_A* 2c6p_A* 2cij_A* 2jbj_A* 2jbk_A* 3rbu_A* 3bi1_A* 2oot_A* 2pvv_A* 2pvw_A* 2xei_A* 2or4_A* 3bi0_A* 3bhx_A* 3d7d_A* 3d7f_A* ... Back     alignment and structure
>3mru_A Aminoacyl-histidine dipeptidase; metalloprotease, homodimer, hydrolase; 3.00A {Vibrio alginolyticus} Back     alignment and structure
>1vho_A Endoglucanase; structural genomics, unknown function; HET: MSE; 1.86A {Thermotoga maritima} SCOP: b.49.3.1 c.56.5.4 Back     alignment and structure
>3kas_A Transferrin receptor protein 1; transferrin receptor 1, arenavirus, cell MEMB disulfide bond, endocytosis, HOST-virus inter receptor, secreted, transmembrane; HET: NAG FUC BMA MAN; 2.40A {Homo sapiens} PDB: 1de4_C* 3s9l_A* 3s9m_A* 3s9n_A* 1cx8_A* 1suv_A 2nsu_A Back     alignment and structure
>3pb6_X Glutaminyl-peptide cyclotransferase-like protein; alpha/beta protein, alpha/beta-mixed fold, glutaminyl cyclas membrane; 1.05A {Homo sapiens} PDB: 3pb4_X 3pb7_X* 3pb8_X* 3pb9_X* Back     alignment and structure
>3ram_A HMRA protein; two-domain, catalytic (alpha-beta-alpha) motif, tetramerisat (alpha,beta,BETA,alpha), endoprotease, hydrolase; 2.70A {Staphylococcus aureus} Back     alignment and structure
>3kl9_A PEPA, glutamyl aminopeptidase; tetrahedral aminopeptidase, S specificity, metallopeptidase M42, hydrolas; 2.70A {Streptococcus pneumoniae} Back     alignment and structure
>4fuu_A Leucine aminopeptidase; phosphorylase/hydrolase like fold, peptidase family M28, STR genomics, joint center for structural genomics; 1.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3cpx_A Aminopeptidase, M42 family; YP_676701.1, putative M42 glutamyl aminopeptidase, structura genomics; 2.39A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3isx_A Endoglucanase; TM1050, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2, hydrolase; HET: MSE; 1.40A {Thermotoga maritima} Back     alignment and structure
>1y7e_A Probable M18-family aminopeptidase 1; aminopeptidase I, borrelia burgdorferi B31, YSCI, structural genomics, PSI; 3.20A {Borrelia burgdorferi} SCOP: b.49.3.1 c.56.5.4 Back     alignment and structure
>2glj_A Probable M18-family aminopeptidase 1; aminopeptidase I, NYSGXRC, structural genomics, PSI, protein structure initiative; 3.20A {Clostridium acetobutylicum} Back     alignment and structure
>2glf_A Probable M18-family aminopeptidase 1; putative, NYSGXRC, structural genomics, PS protein structure initiative; 2.80A {Thermotoga maritima} Back     alignment and structure
>3k9t_A Putative peptidase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2, aminop hydrolase; 2.37A {Clostridium acetobutylicum} Back     alignment and structure
>2ijz_A Probable M18-family aminopeptidase 2; putative aminopeptidase 2, structura genomics, PSI, protein structure initiative; 3.00A {Pseudomonas aeruginosa} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query58
g1q7l.1 280 Aminoacylase-1, catalytic domain {Human (Homo sapi 98.93
d1cg2a1 276 Carboxypeptidase G2, catalytic domain {Pseudomonas 98.92
d1lfwa1272 Aminopeptidase PepV {Lactobacillus delbrueckii [Ta 98.87
d1vgya1 262 Succinyl-diaminopimelate desuccinylase, catalytic 98.75
d1z2la1 293 Allantoate amidohydrolase AllC catalytic domain {E 98.66
d1r3na1 322 Peptidase-like beta-alanine synthase, catalytic do 98.54
d1tkja1 277 Aminopeptidase {Streptomyces griseus [TaxId: 1911] 98.54
d2grea2 233 Deblocking aminopeptidase YhfE {Bacillus cereus [T 98.48
d1rtqa_ 291 Aminopeptidase {Aeromonas proteolytica [TaxId: 671 98.36
d1de4c3 294 Transferrin receptor ectodomain, protease-like dom 97.94
d3bi1a3 304 Glutamate carboxypeptidase II FOLH1 {Human (Homo s 97.84
d2afwa1 329 Glutaminyl-peptide cyclotransferase, QPCT {Human ( 97.78
d1fnoa4295 Peptidase T (tripeptidase), catalytic domain {Salm 97.75
d1vhea2 275 Hypothetical protein YsdC, catalytic domain {Bacil 97.74
d1vhoa2 248 Putative endoglucanase TM1048, catalytic domain {T 97.72
d1yloa2 264 Aminopeptidase YpdE {Shigella flexneri [TaxId: 623 97.53
d2fvga2 255 Endoglucanase TM1049 {Thermotoga maritima [TaxId: 97.46
d1y0ya2 255 Frv operon protein FrvX, catalytic domain {Pyrococ 96.92
d1xmba1 273 IAA-amino acid hydrolase, catalytic domain {Mouse- 95.9
d1ysja1 261 Protein YxeP {Bacillus subtilis [TaxId: 1423]} 95.83
d1y7ea2 322 Probable aminopeptidase ApeA {Borrelia burgdorferi 91.91
>d1cg2a1 c.56.5.4 (A:26-213,A:327-414) Carboxypeptidase G2, catalytic domain {Pseudomonas sp., strain rs-16 [TaxId: 306]} Back     information, alignment and structure
>d1lfwa1 c.56.5.4 (A:1-186,A:383-468) Aminopeptidase PepV {Lactobacillus delbrueckii [TaxId: 1584]} Back     information, alignment and structure
>d1vgya1 c.56.5.4 (A:2-180,A:294-376) Succinyl-diaminopimelate desuccinylase, catalytic domain {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1z2la1 c.56.5.4 (A:4-212,A:330-413) Allantoate amidohydrolase AllC catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r3na1 c.56.5.4 (A:18-247,A:364-455) Peptidase-like beta-alanine synthase, catalytic domain {Yeast (Saccharomyces kluyveri) [TaxId: 4934]} Back     information, alignment and structure
>d1tkja1 c.56.5.4 (A:1-277) Aminopeptidase {Streptomyces griseus [TaxId: 1911]} Back     information, alignment and structure
>d2grea2 c.56.5.4 (A:3-73,A:187-348) Deblocking aminopeptidase YhfE {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1rtqa_ c.56.5.4 (A:) Aminopeptidase {Aeromonas proteolytica [TaxId: 671]} Back     information, alignment and structure
>d1de4c3 c.56.5.5 (C:122-189,C:383-608) Transferrin receptor ectodomain, protease-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bi1a3 c.56.5.5 (A:57-117,A:351-593) Glutamate carboxypeptidase II FOLH1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2afwa1 c.56.5.8 (A:33-361) Glutaminyl-peptide cyclotransferase, QPCT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnoa4 c.56.5.4 (A:1-207,A:321-408) Peptidase T (tripeptidase), catalytic domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1vhea2 c.56.5.4 (A:3-72,A:163-367) Hypothetical protein YsdC, catalytic domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1vhoa2 c.56.5.4 (A:3-69,A:153-333) Putative endoglucanase TM1048, catalytic domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yloa2 c.56.5.4 (A:1-66,A:148-345) Aminopeptidase YpdE {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d2fvga2 c.56.5.4 (A:1-64,A:149-339) Endoglucanase TM1049 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y0ya2 c.56.5.4 (A:164-351,A:6-72) Frv operon protein FrvX, catalytic domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xmba1 c.56.5.4 (A:37-215,A:335-428) IAA-amino acid hydrolase, catalytic domain {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ysja1 c.56.5.4 (A:4-177,A:293-379) Protein YxeP {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y7ea2 c.56.5.4 (A:4-100,A:234-458) Probable aminopeptidase ApeA {Borrelia burgdorferi [TaxId: 139]} Back     information, alignment and structure