Psyllid ID: psy3261


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340--
TKHSKQDLYKFYTLPDEVRSAIFELGGITRVFNEQTQIFNESSILIRNCMLELVGYLKSMTNFDRPSPRFVLYGEHGVGKSMALVYALQYAHENNYLLVHIPWVLRWFAYPKEVSHSLTKEGMVDLNIDAAMWLRHFQKQNTKWLEDPRLTTSQEYVWSPREKSEANIPLAALIEHGITRVKYASDVVDVLFTEIKKLSTEGVCRTFVCVDGYNSFFAEKTNCKPEDKSKVLPSRVTLTRSVINLVQSDWNNGAIVLALSPRANLPDRRESHLPLYMLKKAGFESIDPFVPIHVPELNDEEFHNLLNLYESKKWLQTSEGREEIAFLTKRVPQKMYEFCSFK
ccccccccccEEEEcHHHHHHHHHcccccHHHHHHHHHccccEEEEcHHHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHHHHHHHHHccEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHcHHHHccccccccccccccccccccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccEEEEEEcccccccccccccccccccccccccccHHHHHHHHHcccccccEEEEEEccccccccccccccHHHHHHHccccccccccccccccccHHHHHHHHHHHHHccccccccHHHHHHHHHcccHHHHHHHcccc
ccccHccccEEEEccHHHHHHHcccccccHHHHHHHHHcccccEEEcHHHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHHHHHcccEEEEcccHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEccEEccccccccccccHHHHHHHcccccHcHHHHHHHHHHHHHHHcccccccEEEEEcccHHHccccccccccccccccHHHHHHHHHHHHHHcccccccEEEEEEccccccccccHccccHHHHccccccccccccEEEcccccHHHHHHHHHHHHHcccccccccHHHHHHHccccHHHHHHHHccc
tkhskqdlykfytlpdeVRSAIFELGGITRVFNEQTQIFNESSILIRNCMLELVGYLKsmtnfdrpsprfvlygehgvGKSMALVYALQYAHENNYLLVHIPWVlrwfaypkevshsltkegmVDLNIDAAMWLRHFQKQNtkwledprlttsqeyvwsprekseaniPLAALIEHGITRVKYASDVVDVLFTEIKKLSTEGVCRTFVcvdgynsffaektnckpedkskvlpsrvTLTRSVINLVQSDWNNGAIVLalspranlpdrreshlplymlkkagfesidpfvpihvpelndeEFHNLLNLYESkkwlqtsegREEIAFLTKRvpqkmyefcsfk
tkhskqdlykfytlpdevrSAIFELGGITRVFNEQTQIFNESSILIRNCMLELVGYLKSMTNFDRPSPRFVLYGEHGVGKSMALVYALQYAHENNYLLVHIPWVLRWFAYPKEVSHSLTKEGMVDLNIDAAMWLRHFQKqntkwledprlTTSQEyvwsprekseaNIPLAALIEHGITRVKYASDVVDVLFTEIkklstegvcrTFVCVDGYNSFfaektnckpedkskvlpsrvTLTRSVINLVQSDWNNGAIVLALspranlpdRRESHLPLYMLKKAGFESIDPFVPIHVPELNDEEFHNLLNLYESKkwlqtsegREEIafltkrvpqkmyefcsfk
TKHSKQDLYKFYTLPDEVRSAIFELGGITRVFNEQTQIFNESSILIRNCMLELVGYLKSMTNFDRPSPRFVLYGEHGVGKSMALVYALQYAHENNYLLVHIPWVLRWFAYPKEVSHSLTKEGMVDLNIDAAMWLRHFQKQNTKWLEDPRLTTSQEYVWSPREKSEANIPLAALIEHGITRVKYASDVVDVLFTEIKKLSTEGVCRTFVCVDGYNSFFAEKTNCKPEDKSKVLPSRVTLTRSVINLVQSDWNNGAIVLALSPRANLPDRRESHLPLYMLKKAGFESIDPFVPIHVPELNDEEFHNLLNLYESKKWLQTSEGREEIAFLTKRVPQKMYEFCSFK
*******LYKFYTLPDEVRSAIFELGGITRVFNEQTQIFNESSILIRNCMLELVGYLKSMTNFDRPSPRFVLYGEHGVGKSMALVYALQYAHENNYLLVHIPWVLRWFAYPKEVSHSLTKEGMVDLNIDAAMWLRHFQKQNTKWLEDPRLTTSQEYVWSPREKSEANIPLAALIEHGITRVKYASDVVDVLFTEIKKLSTEGVCRTFVCVDGYNSFFAEKTNCK*****KVLPSRVTLTRSVINLVQSDWNNGAIVLALSPRANLP**RESHLPLYMLKKAGFESIDPFVPIHVPELNDEEFHNLLNLYESKKWLQTSEGREEIAFLTKRVPQKMYEFC***
******DLYKFYTLPDEVRSAIFELGGITRVFNEQTQIFNESSILIRNCMLELVGYLKSM****RPSPRFVLYGEHGVGKSMALVYALQYAHENNYLLVHIPWVLRWFAYPKEVSHSLTKEGMVDLNIDAAMWLRHFQKQNTKWLEDPRLTTSQ*************IPLAALIEHGITRVKYASDVVDVLFTEIKKLSTEGVCRTFVCVDGYNSFFAEKTNCKPEDKSKVLPSRVTLTRSVINLVQSDWNNGAIVLALSPRANL*DR*ESHLPLYMLKKAGFESIDPFVPIHVPELNDEEFHNLLNLYESKKWLQT*EGREEIAFLTKRVPQKMYEFCSFK
TKHSKQDLYKFYTLPDEVRSAIFELGGITRVFNEQTQIFNESSILIRNCMLELVGYLKSMTNFDRPSPRFVLYGEHGVGKSMALVYALQYAHENNYLLVHIPWVLRWFAYPKEVSHSLTKEGMVDLNIDAAMWLRHFQKQNTKWLEDPRLTTSQEYVWSPREKSEANIPLAALIEHGITRVKYASDVVDVLFTEIKKLSTEGVCRTFVCVDGYNSFFAEKTNCKPEDKSKVLPSRVTLTRSVINLVQSDWNNGAIVLALSPRANLPDRRESHLPLYMLKKAGFESIDPFVPIHVPELNDEEFHNLLNLYESKKWLQTSEGREEIAFLTKRVPQKMYEFCSFK
******DLYKFYTLPDEVRSAIFELGGITRVFNEQTQIFNESSILIRNCMLELVGYLKSMTNFDRPSPRFVLYGEHGVGKSMALVYALQYAHENNYLLVHIPWVLRWFAYPKEVSHSLTKEGMVDLNIDAAMWLRHFQKQNTKWLEDPRLTTSQEYVWSPREKSEANIPLAALIEHGITRVKYASDVVDVLFTEIKKLSTEGVCRTFVCVDGYNSFFAEKTNCKPEDKSKVLPSRVTLTRSVINLVQSDWNNGAIVLALSPRANLPDRRESHLPLYMLKKAGFESIDPFVPIHVPELNDEEFHNLLNLYESKKWLQTSEGREEIAFLTKRVPQKMYEFCSFK
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TKHSKQDLYKFYTLPDEVRSAIFELGGITRVFNEQTQIFNESSILIRNCMLELVGYLKSMTNFDRPSPRFVLYGEHGVGKSMALVYALQYAHENNYLLVHIPWVLRWFAYPKEVSHSLTKEGMVDLNIDAAMWLRHFQKQNTKWLEDPRLTTSQEYVWSPREKSEANIPLAALIEHGITRVKYASDVVDVLFTEIKKLSTEGVCRTFVCVDGYNSFFAEKTNCKPEDKSKVLPSRVTLTRSVINLVQSDWNNGAIVLALSPRANLPDRRESHLPLYMLKKAGFESIDPFVPIHVPELNDEEFHNLLNLYESKKWLQTSEGREEIAFLTKRVPQKMYEFCSFK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query342 2.2.26 [Sep-21-2011]
P82922397 28S ribosomal protein S29 yes N/A 0.982 0.846 0.349 6e-60
Q9ER88391 28S ribosomal protein S29 yes N/A 0.979 0.856 0.342 3e-59
P51398398 28S ribosomal protein S29 yes N/A 0.982 0.844 0.332 6e-56
>sp|P82922|RT29_BOVIN 28S ribosomal protein S29, mitochondrial OS=Bos taurus GN=DAP3 PE=1 SV=3 Back     alignment and function desciption
 Score =  231 bits (589), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 121/346 (34%), Positives = 203/346 (58%), Gaps = 10/346 (2%)

Query: 1   TKHSKQDLYKFYTLPDEVRSAIFELGGITRVFNEQTQIFNESSILIRNCMLELVGYLKSM 60
            KH +Q + + Y +  +    +F  G   R F  Q + FNE+ +++R   LEL+ YLK+ 
Sbjct: 56  AKHGEQHVGQHYNISIQELKTVFPHGLPPR-FVMQVKTFNEACLMVRKPALELLHYLKN- 113

Query: 61  TNFDRPSPRFVLYGEHGVGKSMALVYALQYAHENNYLLVHIPWVLRWFAYPKEVSHSLTK 120
           TNF  P+ R+VLYGE G GK+++L + + +  + ++L++HIP    W    +++  S   
Sbjct: 114 TNFAHPAVRYVLYGEKGTGKTLSLCHIIHFCAKQDWLILHIPDAHLWVKNCRDLLQSTYN 173

Query: 121 EGMVDLNIDAAMWLRHFQKQNTKWLEDPRLTTSQEYVWSPREKSEANIPLAALIEHGITR 180
           +   D  ++A++WL++F+  N ++L   ++    +YVW+ RE +E   PLA ++E GI R
Sbjct: 174 KQRFDQPLEASIWLKNFKTANERFLS--QIKVQDKYVWNKRESTEKGSPLAEVVEQGIMR 231

Query: 181 VKYASDVVDVLFTEIKKLSTEGVCRTFVCVDGYNSFFAEKTNCKPEDKSKVLPSRVTLTR 240
           V+ A+D V ++  E+K+ S+ GV R  V VDG N+ +  +T  K EDKS + P  + L  
Sbjct: 232 VRNATDAVGIVLKELKRQSSLGVFRLLVAVDGVNALWG-RTTLKREDKSPITPEELALIY 290

Query: 241 SVINLVQSDWNNGAIVLALSPRANLPDRRESHLPLYMLKKAGFESIDPFVPIHVPELNDE 300
           ++  +V++DW  GAIVL +S   +L   R+++LP  +L K GF+++DPF+PI V   N +
Sbjct: 291 NLRKMVKNDWQGGAIVLTVSQTGSLFKPRKAYLPQELLGKEGFDTLDPFIPILVSNYNPK 350

Query: 301 EFHNLLNLYESKKWLQ-----TSEGREEIAFLTKRVPQKMYEFCSF 341
           EF   +  Y    WLQ     T EG++E+ FL+ R P  +   C++
Sbjct: 351 EFEGCIQYYLENNWLQHEKAHTEEGKKELLFLSNRNPGLLERLCAY 396




Involved in mediating interferon-gamma-induced cell death.
Bos taurus (taxid: 9913)
>sp|Q9ER88|RT29_MOUSE 28S ribosomal protein S29, mitochondrial OS=Mus musculus GN=Dap3 PE=2 SV=1 Back     alignment and function description
>sp|P51398|RT29_HUMAN 28S ribosomal protein S29, mitochondrial OS=Homo sapiens GN=DAP3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query342
328697944376 PREDICTED: 28S ribosomal protein S29, mi 0.985 0.896 0.463 1e-90
157116602385 mitochondrial ribosomal protein, S29, pu 0.985 0.875 0.414 3e-82
195585700392 GD25129 [Drosophila simulans] gi|1941946 0.985 0.859 0.417 3e-79
195346722390 GM15640 [Drosophila sechellia] gi|194135 0.985 0.864 0.417 1e-78
17647691392 mitochondrial ribosomal protein S29 [Dro 0.985 0.859 0.411 1e-78
170051615383 mitochondrial 28S ribosomal protein S29 0.988 0.882 0.413 2e-78
27462217390 DAP3 [Drosophila melanogaster] 0.985 0.864 0.411 2e-78
194754910388 GF13020 [Drosophila ananassae] gi|190621 0.985 0.868 0.405 2e-78
195154459392 GL16923 [Drosophila persimilis] gi|19411 0.982 0.857 0.411 3e-78
195488691392 GE11679 [Drosophila yakuba] gi|194178522 0.985 0.859 0.411 3e-78
>gi|328697944|ref|XP_001951372.2| PREDICTED: 28S ribosomal protein S29, mitochondrial-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  339 bits (870), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 157/339 (46%), Positives = 230/339 (67%), Gaps = 2/339 (0%)

Query: 3   HSKQDLYKFYTLPDEVRSAIFELGGITRVFNEQTQIFNESSILIRNCMLELVGYLKSMTN 62
           H  QD+ KFYT+  +  S IF+ GG+ + F EQT +F E++++IR   LE++  LKS T+
Sbjct: 37  HDSQDVSKFYTIDPKTVSNIFQTGGLPKPFTEQTNMFAETALMIRQPALEVINSLKS-TD 95

Query: 63  FDRPSPRFVLYGEHGVGKSMALVYALQYAHENNYLLVHIPWVLRWFAYP-KEVSHSLTKE 121
           F +P+ R++LYG+ G GKS++L + L YA+ + ++L HIP+V  W  Y  KEV+ S +K 
Sbjct: 96  FQKPAVRYLLYGQTGSGKSLSLAHILHYAYSSKFILYHIPYVPIWLKYDRKEVNWSSSKN 155

Query: 122 GMVDLNIDAAMWLRHFQKQNTKWLEDPRLTTSQEYVWSPREKSEANIPLAALIEHGITRV 181
           GM D+ + AA WL+HF  QN   L +  LTTSQ+YVWS RE +     L  L+ HGI R 
Sbjct: 156 GMADIPLIAAQWLKHFVHQNGALLNELNLTTSQDYVWSQRETTPQGTTLNELVTHGINRA 215

Query: 182 KYASDVVDVLFTEIKKLSTEGVCRTFVCVDGYNSFFAEKTNCKPEDKSKVLPSRVTLTRS 241
           KYA D +D+L  E+K   +   C+  V +DG+N+FF EKT+ K ED+ KV P ++T+ ++
Sbjct: 216 KYACDCMDILLNELKAHCSNNRCKMLVAIDGFNAFFNEKTDLKTEDRVKVTPQQITMVQT 275

Query: 242 VINLVQSDWNNGAIVLALSPRANLPDRRESHLPLYMLKKAGFESIDPFVPIHVPELNDEE 301
            ++ V SDWNNGAI++  SPRA L  +RESHLP+Y++ + GFE IDPF+P+ VPEL+  E
Sbjct: 276 GLSAVLSDWNNGAIIMVTSPRAALNTKRESHLPIYLIGRQGFEHIDPFIPVMVPELSTVE 335

Query: 302 FHNLLNLYESKKWLQTSEGREEIAFLTKRVPQKMYEFCS 340
           F+N+L+ YE K+WLQ   GR+E+ FLT ++P  +   C+
Sbjct: 336 FNNMLDYYEEKRWLQKPGGRKELEFLTSKLPADLMARCA 374




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157116602|ref|XP_001658571.1| mitochondrial ribosomal protein, S29, putative [Aedes aegypti] gi|108876397|gb|EAT40622.1| AAEL007668-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|195585700|ref|XP_002082618.1| GD25129 [Drosophila simulans] gi|194194627|gb|EDX08203.1| GD25129 [Drosophila simulans] Back     alignment and taxonomy information
>gi|195346722|ref|XP_002039906.1| GM15640 [Drosophila sechellia] gi|194135255|gb|EDW56771.1| GM15640 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|17647691|ref|NP_523811.1| mitochondrial ribosomal protein S29 [Drosophila melanogaster] gi|7291419|gb|AAF46846.1| mitochondrial ribosomal protein S29 [Drosophila melanogaster] gi|17862624|gb|AAL39789.1| LD41023p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|170051615|ref|XP_001861844.1| mitochondrial 28S ribosomal protein S29 [Culex quinquefasciatus] gi|167872800|gb|EDS36183.1| mitochondrial 28S ribosomal protein S29 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|27462217|gb|AAO15385.1|AF348494_1 DAP3 [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|194754910|ref|XP_001959735.1| GF13020 [Drosophila ananassae] gi|190621033|gb|EDV36557.1| GF13020 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195154459|ref|XP_002018139.1| GL16923 [Drosophila persimilis] gi|194113935|gb|EDW35978.1| GL16923 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|195488691|ref|XP_002092421.1| GE11679 [Drosophila yakuba] gi|194178522|gb|EDW92133.1| GE11679 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query342
FB|FBgn0034727392 mRpS29 "mitochondrial ribosoma 0.979 0.854 0.414 4.5e-75
UNIPROTKB|P82922397 DAP3 "28S ribosomal protein S2 0.979 0.843 0.350 2.2e-57
UNIPROTKB|F1P6P0393 DAP3 "Uncharacterized protein" 0.979 0.852 0.350 4.6e-57
MGI|MGI:1929538391 Dap3 "death associated protein 0.976 0.854 0.343 1.2e-56
UNIPROTKB|H9L0M5398 H9L0M5 "Uncharacterized protei 0.941 0.809 0.373 2e-56
UNIPROTKB|F1RLM4424 LOC100625274 "Uncharacterized 0.979 0.790 0.347 2.5e-56
UNIPROTKB|I3LS10398 LOC100625274 "Uncharacterized 0.979 0.841 0.347 2.5e-56
RGD|1305339391 Dap3 "death associated protein 0.976 0.854 0.343 5.3e-56
UNIPROTKB|P51398398 DAP3 "28S ribosomal protein S2 0.979 0.841 0.333 2.6e-54
ZFIN|ZDB-GENE-051129-2402 dap3 "death associated protein 0.982 0.835 0.339 2.4e-51
FB|FBgn0034727 mRpS29 "mitochondrial ribosomal protein S29" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 757 (271.5 bits), Expect = 4.5e-75, P = 4.5e-75
 Identities = 140/338 (41%), Positives = 212/338 (62%)

Query:     2 KHSKQDLYKFYTLPDEVRSAIFELGGITRVFNEQTQIFNESSILIRNCMLELVGYLKSMT 61
             +HS   + KFYT+P E +  IF  GG+ + + +Q + F E+ +++RN  LEL+ Y+K   
Sbjct:    51 EHSAMQVAKFYTIPAEQKKQIFTGGGLPKQYEQQIKTFTEACLMVRNPALELLQYIKD-G 109

Query:    62 NFDRPSPRFVLYGEHGVGKSMALVYALQYAHENNYLLVHIPWVLRWFAYPKEVSHSLTKE 121
             +  +P  R+VLYGE+G GK++ + + L Y   N++LLVH+PW   W   PKE S++  +E
Sbjct:   110 DLTKPVVRYVLYGENGTGKTLTMAHVLHYGALNDFLLVHVPWAPNWMKRPKEASNAAGQE 169

Query:   122 GMVDLNIDAAMWLRHFQKQNTKWLEDPRLTTSQEYVWSPREKSEANIPLAALIEHGITRV 181
             GM+DL  DAA WL HF+ QN   L+  +L TS+EYVWS RE + A   L  L+EHGI R+
Sbjct:   170 GMIDLPFDAAAWLVHFKTQNGPLLQRLQLKTSKEYVWSKRESTPAGSSLIELVEHGIARI 229

Query:   182 KYASDVVDVLFTEIKKLSTEGVCRTFVCVDGYNSFFAEKTNCKPEDKSKVLPSRVTLTRS 241
             KYAS+    L  E+K+LST G C+  V +DG+N+FF   T    ++K  V P RVTLT+ 
Sbjct:   230 KYASETTAALIAELKQLSTAGQCKVMVAIDGFNAFFHPVTRIFSDNKQLVTPDRVTLTQP 289

Query:   242 VINLVQSDWNNGAIVLALSPRANLPDRRESHLPLYMLKKAGFESIDPFVPIHVPELNDEE 301
              +++   DW NG  +L++   A      +S++P Y+L K GFE +DPFVPIHV    D+E
Sbjct:   290 FLDITNYDWTNGVCILSVDKIAMTEGHMDSYMPRYLLGKEGFEHLDPFVPIHVENYTDKE 349

Query:   302 FHNLLNLYESKKWL-QTSEGREE-IAFLTKRVPQKMYE 337
             FH+ ++ Y  + W+ +T +G EE + F++ + P  + +
Sbjct:   350 FHSYISYYLDRHWINKTPQGFEEQLKFMSNKNPYSLMQ 387




GO:0006412 "translation" evidence=ISS
GO:0003735 "structural constituent of ribosome" evidence=ISS
GO:0005763 "mitochondrial small ribosomal subunit" evidence=ISS
GO:0006915 "apoptotic process" evidence=IEA
UNIPROTKB|P82922 DAP3 "28S ribosomal protein S29, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1P6P0 DAP3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1929538 Dap3 "death associated protein 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|H9L0M5 H9L0M5 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RLM4 LOC100625274 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LS10 LOC100625274 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1305339 Dap3 "death associated protein 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P51398 DAP3 "28S ribosomal protein S29, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-051129-2 dap3 "death associated protein 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P51398RT29_HUMANNo assigned EC number0.33230.98240.8442yesN/A
P82922RT29_BOVINNo assigned EC number0.34970.98240.8463yesN/A
Q9ER88RT29_MOUSENo assigned EC number0.34200.97950.8567yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query342
pfam10236274 pfam10236, DAP3, Mitochondrial ribosomal death-ass 2e-56
>gnl|CDD|220642 pfam10236, DAP3, Mitochondrial ribosomal death-associated protein 3 Back     alignment and domain information
 Score =  183 bits (468), Expect = 2e-56
 Identities = 83/297 (27%), Positives = 129/297 (43%), Gaps = 33/297 (11%)

Query: 45  LIRNCMLELVGYLKSMTNFDRPSPRFVLYGEHGVGKSMALVYALQYAHENNYLLVHIPWV 104
           L+R   LEL   LK   +  +   RFVL GE G GKS+ L  A+ YA    ++++H+P  
Sbjct: 2   LVREETLELTKKLKE-ADASKKVVRFVLTGERGSGKSVLLAQAMAYAFTQGWIVLHVPEA 60

Query: 105 LRWFAYPKEVSHSLTKEGMVDLNIDAAMWLRHFQKQNTKWLEDPRLTTSQEYVWSPREKS 164
             W     + +      G+ D  + AA WL+   K N + L+  +L  S++Y W  RE +
Sbjct: 61  EDWVNGTTDYAPDPGNPGLYDQPMYAAAWLQKILKANEEVLK--KLKLSKDYKWLKREST 118

Query: 165 EANIPLAALIEHGITRVKYASDVVDVLFTEIKKLSTEGVCRTFVCVDGYNSFFAEKTNCK 224
            A   L  L   GI   K A DV   ++ E+K  S        V VDG+N+ F   ++ +
Sbjct: 119 PAGSTLLDLASLGINDPKSAWDVFQAVWKELKAQS--KAPPVLVAVDGFNALF-GPSDYR 175

Query: 225 PEDKSKVLPSRVTLTRSVINLVQ--SDWNNGAIVLALSPRANLPDRRESHLPLYMLKKAG 282
             D   + P  +TL R  ++L+   +D+ NG +V AL+        R             
Sbjct: 176 TPDFKPIHPHDLTLVRLFLDLLSGKNDFPNGGVVTALAATGVSNTPR------------- 222

Query: 283 FESIDPFVPIHVPELNDEEFHNLLNLYESKKWLQ----TSEGREEIAFLTKRVPQKM 335
                   PI VP L+ EE  +L+  Y     L          E+++ L    P ++
Sbjct: 223 --------PIRVPGLSKEEARSLMEYYADSGILLKKVDEELVDEKLSLLGNGNPGEL 271


This is a family of conserved proteins which were originally described as death-associated-protein-3 (DAP-3). The proteins carry a P-loop DNA-binding motif, and induce apoptosis. DAP3 has been shown to be a pro-apoptotic factor in the mitochondrial matrix and to be crucial for mitochondrial biogenesis and so has also been designated as MRP-S29 (mitochondrial ribosomal protein subunit 29). Length = 274

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 342
KOG3928|consensus461 100.0
PF10236309 DAP3: Mitochondrial ribosomal death-associated pro 100.0
PF01637234 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 99.27
PF14516331 AAA_35: AAA-like domain 99.12
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTE 98.73
PRK00411 394 cdc6 cell division control protein 6; Reviewed 98.71
TIGR02928 365 orc1/cdc6 family replication initiation protein. M 98.54
PF05729166 NACHT: NACHT domain 98.41
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Me 98.31
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase 98.24
PTZ00112 1164 origin recognition complex 1 protein; Provisional 98.22
PF07693325 KAP_NTPase: KAP family P-loop domain; InterPro: IP 98.11
PRK04841 903 transcriptional regulator MalT; Provisional 98.11
PF13191185 AAA_16: AAA ATPase domain; PDB: 2V1U_A. 98.1
PF00931287 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is 98.09
TIGR00635305 ruvB Holliday junction DNA helicase, RuvB subunit. 98.01
PF05673249 DUF815: Protein of unknown function (DUF815); Inte 98.01
PRK05896 605 DNA polymerase III subunits gamma and tau; Validat 98.01
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.0
TIGR01241 495 FtsH_fam ATP-dependent metalloprotease FtsH. HflB( 97.99
PRK06645 507 DNA polymerase III subunits gamma and tau; Validat 97.99
PRK00440 319 rfc replication factor C small subunit; Reviewed 97.95
PRK03992389 proteasome-activating nucleotidase; Provisional 97.95
TIGR01242364 26Sp45 26S proteasome subunit P45 family. Many pro 97.94
PRK14960 702 DNA polymerase III subunits gamma and tau; Provisi 97.94
PRK12402 337 replication factor C small subunit 2; Reviewed 97.94
PRK07003 830 DNA polymerase III subunits gamma and tau; Validat 97.91
PRK14963 504 DNA polymerase III subunits gamma and tau; Provisi 97.9
CHL00176 638 ftsH cell division protein; Validated 97.88
PRK14949 944 DNA polymerase III subunits gamma and tau; Provisi 97.87
PRK09112 351 DNA polymerase III subunit delta'; Validated 97.83
PRK14958 509 DNA polymerase III subunits gamma and tau; Provisi 97.83
PRK14956 484 DNA polymerase III subunits gamma and tau; Provisi 97.82
PTZ00454398 26S protease regulatory subunit 6B-like protein; P 97.78
TIGR03689 512 pup_AAA proteasome ATPase. In the Actinobacteria, 97.77
PRK13342 413 recombination factor protein RarA; Reviewed 97.75
PRK08691 709 DNA polymerase III subunits gamma and tau; Validat 97.75
PF13401131 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S 97.73
TIGR00678188 holB DNA polymerase III, delta' subunit. At positi 97.72
PRK07994 647 DNA polymerase III subunits gamma and tau; Validat 97.72
PRK14964 491 DNA polymerase III subunits gamma and tau; Provisi 97.71
PRK14961 363 DNA polymerase III subunits gamma and tau; Provisi 97.7
CHL00195489 ycf46 Ycf46; Provisional 97.64
PRK12323 700 DNA polymerase III subunits gamma and tau; Provisi 97.64
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA r 97.59
TIGR02880284 cbbX_cfxQ probable Rubsico expression protein CbbX 97.57
PRK07471 365 DNA polymerase III subunit delta'; Validated 97.54
PRK14970 367 DNA polymerase III subunits gamma and tau; Provisi 97.52
PRK05563 559 DNA polymerase III subunits gamma and tau; Validat 97.52
TIGR02397 355 dnaX_nterm DNA polymerase III, subunit gamma and t 97.51
PRK14965 576 DNA polymerase III subunits gamma and tau; Provisi 97.48
PRK14971 614 DNA polymerase III subunits gamma and tau; Provisi 97.47
PRK04195 482 replication factor C large subunit; Provisional 97.46
PLN03025 319 replication factor C subunit; Provisional 97.45
PRK14959 624 DNA polymerase III subunits gamma and tau; Provisi 97.44
PRK14951 618 DNA polymerase III subunits gamma and tau; Provisi 97.44
TIGR01243733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 97.43
PRK07133 725 DNA polymerase III subunits gamma and tau; Validat 97.42
PRK07764 824 DNA polymerase III subunits gamma and tau; Validat 97.38
PRK05707 328 DNA polymerase III subunit delta'; Validated 97.32
KOG2228|consensus 408 97.32
PRK14952 584 DNA polymerase III subunits gamma and tau; Provisi 97.31
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 97.31
PRK14962 472 DNA polymerase III subunits gamma and tau; Provisi 97.29
PRK14087 450 dnaA chromosomal replication initiation protein; P 97.28
PTZ00361438 26 proteosome regulatory subunit 4-like protein; P 97.27
PRK14957 546 DNA polymerase III subunits gamma and tau; Provisi 97.27
PRK14969 527 DNA polymerase III subunits gamma and tau; Provisi 97.27
PRK14953 486 DNA polymerase III subunits gamma and tau; Provisi 97.24
PRK08903227 DnaA regulatory inactivator Hda; Validated 97.24
PRK09111 598 DNA polymerase III subunits gamma and tau; Validat 97.21
PRK08084235 DNA replication initiation factor; Provisional 97.2
PRK14950 585 DNA polymerase III subunits gamma and tau; Provisi 97.18
PRK06835329 DNA replication protein DnaC; Validated 97.18
PRK14948 620 DNA polymerase III subunits gamma and tau; Provisi 97.16
PRK06647 563 DNA polymerase III subunits gamma and tau; Validat 97.12
PF1324576 AAA_19: Part of AAA domain 97.11
PRK07940 394 DNA polymerase III subunit delta'; Validated 97.11
PRK14955 397 DNA polymerase III subunits gamma and tau; Provisi 97.1
cd01393226 recA_like RecA is a bacterial enzyme which has rol 97.06
PF10923416 DUF2791: P-loop Domain of unknown function (DUF279 97.02
KOG0731|consensus 774 97.01
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 96.98
PRK12377248 putative replication protein; Provisional 96.98
PRK08116268 hypothetical protein; Validated 96.95
COG2607287 Predicted ATPase (AAA+ superfamily) [General funct 96.94
PF05621302 TniB: Bacterial TniB protein; InterPro: IPR008868 96.94
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. M 96.92
PF03266168 NTPase_1: NTPase; InterPro: IPR004948 This entry r 96.89
PF01580205 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 96.88
PF13173128 AAA_14: AAA domain 96.88
PRK08451 535 DNA polymerase III subunits gamma and tau; Validat 96.88
PRK08181269 transposase; Validated 96.86
PRK06305 451 DNA polymerase III subunits gamma and tau; Validat 96.85
PRK08058 329 DNA polymerase III subunit delta'; Validated 96.81
PRK06921266 hypothetical protein; Provisional 96.81
PLN03210 1153 Resistant to P. syringae 6; Provisional 96.81
COG2909 894 MalT ATP-dependent transcriptional regulator [Tran 96.8
PRK13341 725 recombination factor protein RarA/unknown domain f 96.78
PRK06851367 hypothetical protein; Provisional 96.78
PF13207121 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 96.78
smart00382148 AAA ATPases associated with a variety of cellular 96.76
COG3267269 ExeA Type II secretory pathway, component ExeA (pr 96.75
PRK09183259 transposase/IS protein; Provisional 96.73
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 96.69
KOG1970|consensus 634 96.69
PF01695178 IstB_IS21: IstB-like ATP binding protein; InterPro 96.68
TIGR01243 733 CDC48 AAA family ATPase, CDC48 subfamily. This sub 96.67
PRK14954 620 DNA polymerase III subunits gamma and tau; Provisi 96.67
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r 96.66
TIGR00763 775 lon ATP-dependent protease La. This protein is ind 96.66
PRK12608380 transcription termination factor Rho; Provisional 96.66
PRK06871 325 DNA polymerase III subunit delta'; Validated 96.65
CHL00206 2281 ycf2 Ycf2; Provisional 96.63
PRK06526254 transposase; Provisional 96.63
PRK05642234 DNA replication initiation factor; Validated 96.6
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 96.6
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subuni 96.56
PRK07993 334 DNA polymerase III subunit delta'; Validated 96.56
TIGR00362405 DnaA chromosomal replication initiator protein Dna 96.54
cd01120165 RecA-like_NTPases RecA-like NTPases. This family i 96.53
PRK08727233 hypothetical protein; Validated 96.48
PRK06893229 DNA replication initiation factor; Validated 96.47
PF13086236 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV 96.46
cd01124187 KaiC KaiC is a circadian clock protein primarily f 96.45
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 96.44
KOG0734|consensus 752 96.44
KOG2543|consensus 438 96.42
PRK07952244 DNA replication protein DnaC; Validated 96.42
TIGR02639 731 ClpA ATP-dependent Clp protease ATP-binding subuni 96.41
PF07728139 AAA_5: AAA domain (dynein-related subfamily); Inte 96.41
COG1484254 DnaC DNA replication protein [DNA replication, rec 96.39
cd01128249 rho_factor Transcription termination factor rho is 96.39
PRK07399314 DNA polymerase III subunit delta'; Validated 96.38
COG3899 849 Predicted ATPase [General function prediction only 96.28
PTZ00202550 tuzin; Provisional 96.27
CHL00095 821 clpC Clp protease ATP binding subunit 96.24
COG1618179 Predicted nucleotide kinase [Nucleotide transport 96.24
COG4619223 ABC-type uncharacterized transport system, ATPase 96.2
TIGR00750300 lao LAO/AO transport system ATPase. Mutations have 96.15
PRK08939306 primosomal protein DnaI; Reviewed 96.15
PF00004132 AAA: ATPase family associated with various cellula 96.14
PRK08533230 flagellar accessory protein FlaH; Reviewed 96.13
PF03205140 MobB: Molybdopterin guanine dinucleotide synthesis 96.1
PF13604196 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL 96.06
PRK00149450 dnaA chromosomal replication initiation protein; R 96.01
PF13521163 AAA_28: AAA domain; PDB: 1LW7_A. 96.01
COG0467260 RAD55 RecA-superfamily ATPases implicated in signa 96.01
TIGR03878259 thermo_KaiC_2 KaiC domain protein, AF_0795 family. 95.99
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexame 95.99
PRK08769 319 DNA polymerase III subunit delta'; Validated 95.98
KOG2859|consensus293 95.94
PRK04296190 thymidine kinase; Provisional 95.93
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'- 95.91
PLN00020413 ribulose bisphosphate carboxylase/oxygenase activa 95.9
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational 95.84
TIGR03881229 KaiC_arch_4 KaiC domain protein, PAE1156 family. M 95.8
COG1066456 Sms Predicted ATP-dependent serine protease [Postt 95.78
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf f 95.75
cd03115173 SRP The signal recognition particle (SRP) mediates 95.75
TIGR02237209 recomb_radB DNA repair and recombination protein R 95.73
PRK12422445 chromosomal replication initiation protein; Provis 95.71
TIGR03880224 KaiC_arch_3 KaiC domain protein, AF_0351 family. T 95.7
cd01394218 radB RadB. The archaeal protein radB shares simila 95.69
TIGR03877237 thermo_KaiC_1 KaiC domain protein, Ph0284 family. 95.63
PRK09435332 membrane ATPase/protein kinase; Provisional 95.56
PRK07667193 uridine kinase; Provisional 95.56
PRK13695174 putative NTPase; Provisional 95.54
PRK06964 342 DNA polymerase III subunit delta'; Validated 95.53
PRK09087226 hypothetical protein; Validated 95.53
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway 95.53
CHL00181287 cbbX CbbX; Provisional 95.53
cd03281213 ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS 95.51
PF13479213 AAA_24: AAA domain 95.51
PF00448196 SRP54: SRP54-type protein, GTPase domain; InterPro 95.5
PRK09361225 radB DNA repair and recombination protein RadB; Pr 95.49
PRK14088440 dnaA chromosomal replication initiation protein; P 95.49
PRK04328249 hypothetical protein; Provisional 95.47
PRK05973237 replicative DNA helicase; Provisional 95.44
PF12846304 AAA_10: AAA-like domain 95.44
PF08423256 Rad51: Rad51; InterPro: IPR013632 This domain is f 95.41
PF13481193 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. 95.4
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also k 95.37
COG0541 451 Ffh Signal recognition particle GTPase [Intracellu 95.37
TIGR02012321 tigrfam_recA protein RecA. This model describes or 95.37
PHA03133368 thymidine kinase; Provisional 95.35
PRK06067234 flagellar accessory protein FlaH; Validated 95.32
PRK14974336 cell division protein FtsY; Provisional 95.31
PF13671143 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 95.3
TIGR00064272 ftsY signal recognition particle-docking protein F 95.3
PF03215 519 Rad17: Rad17 cell cycle checkpoint protein 95.29
PRK06696223 uridine kinase; Validated 95.28
PF10443 431 RNA12: RNA12 protein; InterPro: IPR018850 Mitochon 95.27
PF1355562 AAA_29: P-loop containing region of AAA domain 95.25
PF03193161 DUF258: Protein of unknown function, DUF258; Inter 95.22
KOG0780|consensus 483 95.22
PF08477119 Miro: Miro-like protein; InterPro: IPR013684 Mitoc 95.19
COG4088261 Predicted nucleotide kinase [Nucleotide transport 95.18
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) cat 95.16
PRK06851367 hypothetical protein; Provisional 95.13
PRK06620214 hypothetical protein; Validated 95.12
cd00046144 DEXDc DEAD-like helicases superfamily. A diverse f 95.07
PRK13764602 ATPase; Provisional 95.05
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This 95.05
PHA03135343 thymidine kinase; Provisional 95.03
TIGR02881261 spore_V_K stage V sporulation protein K. Members o 95.03
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucle 95.02
KOG0743|consensus457 95.01
PF06745226 KaiC: KaiC; InterPro: IPR014774 This entry represe 94.98
cd03114148 ArgK-like The function of this protein family is u 94.97
cd00983325 recA RecA is a bacterial enzyme which has roles in 94.95
TIGR00235207 udk uridine kinase. Model contains a number of lon 94.94
TIGR02640262 gas_vesic_GvpN gas vesicle protein GvpN. Members o 94.94
PRK00889175 adenylylsulfate kinase; Provisional 94.92
PF00910107 RNA_helicase: RNA helicase; InterPro: IPR000605 He 94.91
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA 94.91
PF13476202 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V 94.9
PF05496233 RuvB_N: Holliday junction DNA helicase ruvB N-term 94.89
PF03308266 ArgK: ArgK protein; InterPro: IPR005129 Bacterial 94.88
PF04851184 ResIII: Type III restriction enzyme, res subunit; 94.88
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 94.87
PRK102631355 DNA translocase FtsK; Provisional 94.86
PF00158168 Sigma54_activat: Sigma-54 interaction domain; Inte 94.86
PRK09270229 nucleoside triphosphate hydrolase domain-containin 94.83
PF05970364 PIF1: PIF1-like helicase; InterPro: IPR010285 This 94.82
PRK06090 319 DNA polymerase III subunit delta'; Validated 94.81
PRK09354349 recA recombinase A; Provisional 94.79
PRK09519 790 recA DNA recombination protein RecA; Reviewed 94.79
PF12775272 AAA_7: P-loop containing dynein motor region D3; P 94.78
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein 94.76
PRK01184184 hypothetical protein; Provisional 94.76
TIGR02655484 circ_KaiC circadian clock protein KaiC. Members of 94.75
PHA03138340 thymidine kinase; Provisional 94.73
KOG0735|consensus 952 94.71
PRK11823446 DNA repair protein RadA; Provisional 94.7
PRK14086617 dnaA chromosomal replication initiation protein; P 94.68
PF00437270 T2SE: Type II/IV secretion system protein; InterPr 94.65
KOG1514|consensus 767 94.64
TIGR01313163 therm_gnt_kin carbohydrate kinase, thermoresistant 94.63
TIGR00176155 mobB molybdopterin-guanine dinucleotide biosynthes 94.62
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 94.6
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phospho 94.6
PRK07261171 topology modulation protein; Provisional 94.58
PRK00771437 signal recognition particle protein Srp54; Provisi 94.58
TIGR00416454 sms DNA repair protein RadA. The gene protuct code 94.58
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a var 94.58
PHA00729226 NTP-binding motif containing protein 94.57
PRK10416318 signal recognition particle-docking protein FtsY; 94.54
PRK14532188 adenylate kinase; Provisional 94.54
TIGR02533486 type_II_gspE general secretory pathway protein E. 94.52
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversibl 94.52
PF13238129 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB 94.51
PHA03134340 thymidine kinase; Provisional 94.49
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 94.49
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 94.46
PF02492178 cobW: CobW/HypB/UreG, nucleotide-binding domain; I 94.44
PRK08118167 topology modulation protein; Reviewed 94.42
KOG0736|consensus 953 94.39
PRK14738206 gmk guanylate kinase; Provisional 94.32
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 94.32
PF00005137 ABC_tran: ABC transporter This structure is on hol 94.3
KOG0727|consensus408 94.28
PRK05480209 uridine/cytidine kinase; Provisional 94.28
PRK10536262 hypothetical protein; Provisional 94.27
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 94.25
TIGR00041195 DTMP_kinase thymidylate kinase. Function: phosphor 94.23
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provis 94.21
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1 94.2
TIGR01359183 UMP_CMP_kin_fam UMP-CMP kinase family. This subfam 94.2
KOG0741|consensus 744 94.2
TIGR03238 504 dnd_assoc_3 dnd system-associated protein 3. cereu 94.19
PRK05541176 adenylylsulfate kinase; Provisional 94.18
TIGR01360188 aden_kin_iso1 adenylate kinase, isozyme 1 subfamil 94.18
PF00270169 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 94.16
PRK13900332 type IV secretion system ATPase VirB11; Provisiona 94.15
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPC 94.14
PLN03187344 meiotic recombination protein DMC1 homolog; Provis 94.13
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 94.13
TIGR01420343 pilT_fam pilus retraction protein PilT. This model 94.08
PRK00279215 adk adenylate kinase; Reviewed 94.06
KOG0741|consensus744 94.05
PF06414199 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This e 94.04
COG1136226 SalX ABC-type antimicrobial peptide transport syst 94.03
KOG2749|consensus415 94.03
PF05127177 Helicase_RecD: Helicase; InterPro: IPR007807 This 94.02
TIGR02782299 TrbB_P P-type conjugative transfer ATPase TrbB. Th 94.02
TIGR02238313 recomb_DMC1 meiotic recombinase Dmc1. This model d 94.02
PRK10436462 hypothetical protein; Provisional 94.01
COG1703323 ArgK Putative periplasmic protein kinase ArgK and 94.0
PHA02544316 44 clamp loader, small subunit; Provisional 94.0
PRK14530215 adenylate kinase; Provisional 93.99
TIGR02236310 recomb_radA DNA repair and recombination protein R 93.99
TIGR00665434 DnaB replicative DNA helicase. This model describe 93.97
PRK00131175 aroK shikimate kinase; Reviewed 93.97
TIGR01618220 phage_P_loop phage nucleotide-binding protein. Thi 93.96
TIGR00231161 small_GTP small GTP-binding protein domain. This m 93.95
PRK03846198 adenylylsulfate kinase; Provisional 93.94
PHA02244383 ATPase-like protein 93.93
TIGR02538564 type_IV_pilB type IV-A pilus assembly ATPase PilB. 93.93
cd03283199 ABC_MutS-like MutS-like homolog in eukaryotes. The 93.9
PRK06547172 hypothetical protein; Provisional 93.84
PF09820284 AAA-ATPase_like: Predicted AAA-ATPase; InterPro: I 93.83
PF08433270 KTI12: Chromatin associated protein KTI12 ; InterP 93.83
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem 93.81
PF04665241 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 93.8
cd03243202 ABC_MutS_homologs The MutS protein initiates DNA m 93.79
cd01130186 VirB11-like_ATPase Type IV secretory pathway compo 93.79
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1. 93.76
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 93.75
PF01926116 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: I 93.75
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the 93.73
TIGR00376 637 DNA helicase, putative. The gene product may repre 93.71
smart00487201 DEXDc DEAD-like helicases superfamily. 93.71
PRK06762166 hypothetical protein; Provisional 93.68
TIGR01425429 SRP54_euk signal recognition particle protein SRP5 93.66
COG1126240 GlnQ ABC-type polar amino acid transport system, A 93.66
PRK00698205 tmk thymidylate kinase; Validated 93.65
TIGR02525372 plasmid_TraJ plasmid transfer ATPase TraJ. Members 93.63
TIGR00455184 apsK adenylylsulfate kinase (apsK). Important resi 93.6
TIGR02788308 VirB11 P-type DNA transfer ATPase VirB11. The VirB 93.6
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 93.59
PRK00300205 gmk guanylate kinase; Provisional 93.57
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 93.56
COG0468279 RecA RecA/RadA recombinase [DNA replication, recom 93.55
PRK02496184 adk adenylate kinase; Provisional 93.54
PRK10751173 molybdopterin-guanine dinucleotide biosynthesis pr 93.45
TIGR00150133 HI0065_YjeE ATPase, YjeE family. Members of this f 93.44
PRK09825176 idnK D-gluconate kinase; Provisional 93.44
COG0593408 DnaA ATPase involved in DNA replication initiation 93.44
PF09848352 DUF2075: Uncharacterized conserved protein (DUF207 93.43
COG3911183 Predicted ATPase [General function prediction only 93.41
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 93.4
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 93.4
COG4778235 PhnL ABC-type phosphonate transport system, ATPase 93.36
PF01583156 APS_kinase: Adenylylsulphate kinase; InterPro: IPR 93.36
PRK14531183 adenylate kinase; Provisional 93.34
TIGR01351210 adk adenylate kinases. Adenylate kinase (EC 2.7.4. 93.33
PRK13700 732 conjugal transfer protein TraD; Provisional 93.32
PRK03839180 putative kinase; Provisional 93.32
PRK05439311 pantothenate kinase; Provisional 93.32
PRK13768253 GTPase; Provisional 93.3
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subun 93.27
PHA03136378 thymidine kinase; Provisional 93.27
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 93.27
cd00154159 Rab Rab family. Rab GTPases form the largest famil 93.27
cd03280200 ABC_MutS2 MutS2 homologs in bacteria and eukaryote 93.27
PTZ00088229 adenylate kinase 1; Provisional 93.25
PRK04301317 radA DNA repair and recombination protein RadA; Va 93.24
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are 93.24
PRK10867433 signal recognition particle protein; Provisional 93.23
cd02034116 CooC The accessory protein CooC, which contains a 93.23
PF05707193 Zot: Zonular occludens toxin (Zot); InterPro: IPR0 93.22
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamil 93.19
PRK08233182 hypothetical protein; Provisional 93.19
TIGR00764 608 lon_rel lon-related putative ATP-dependent proteas 93.14
KOG0989|consensus346 93.13
cd00879190 Sar1 Sar1 subfamily. Sar1 is an essential componen 93.13
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubu 93.13
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related prote 93.12
PF00025175 Arf: ADP-ribosylation factor family The prints ent 93.09
TIGR02655 484 circ_KaiC circadian clock protein KaiC. Members of 93.06
PRK08099399 bifunctional DNA-binding transcriptional repressor 93.05
PF03796259 DnaB_C: DnaB-like helicase C terminal domain; Inte 92.99
PRK04040188 adenylate kinase; Provisional 92.97
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family 92.94
PF00580315 UvrD-helicase: UvrD/REP helicase N-terminal domain 92.9
PRK05703424 flhF flagellar biosynthesis regulator FlhF; Valida 92.89
PF14532138 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 92.88
cd00157171 Rho Rho (Ras homology) family. Members of the Rho 92.88
PHA02774613 E1; Provisional 92.87
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, 92.84
KOG0781|consensus587 92.73
TIGR02524358 dot_icm_DotB Dot/Icm secretion system ATPase DotB. 92.72
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in 92.68
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti 92.67
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subf 92.66
cd01853249 Toc34_like Toc34-like (Translocon at the Outer-env 92.66
TIGR02903 615 spore_lon_C ATP-dependent protease, Lon family. Me 92.64
cd03234226 ABCG_White The White subfamily represents ABC tran 92.62
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.2 92.62
PF03029238 ATP_bind_1: Conserved hypothetical ATP binding pro 92.59
TIGR02768744 TraA_Ti Ti-type conjugative transfer relaxase TraA 92.57
PRK06217183 hypothetical protein; Validated 92.56
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor su 92.54
PLN02200234 adenylate kinase family protein 92.52
PRK14528186 adenylate kinase; Provisional 92.52
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 92.52
PF01443234 Viral_helicase1: Viral (Superfamily 1) RNA helicas 92.49
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 92.47
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in ev 92.46
cd00876160 Ras Ras family. The Ras family of the Ras superfam 92.44
CHL00081350 chlI Mg-protoporyphyrin IX chelatase 92.44
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) 92.41
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases ar 92.4
PF09439181 SRPRB: Signal recognition particle receptor beta s 92.39
COG4136213 ABC-type uncharacterized transport system, ATPase 92.39
PF01935229 DUF87: Domain of unknown function DUF87; InterPro: 92.39
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 92.36
cd04163168 Era Era subfamily. Era (E. coli Ras-like protein) 92.36
COG1119257 ModF ABC-type molybdenum transport system, ATPase 92.34
TIGR03743 634 SXT_TraD conjugative coupling factor TraD, SXT/TOL 92.33
cd03269210 ABC_putative_ATPase This subfamily is involved in 92.33
PRK11608326 pspF phage shock protein operon transcriptional ac 92.31
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 92.31
TIGR01650327 PD_CobS cobaltochelatase, CobS subunit. This model 92.3
) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309127 Torsin: Torsin; InterPro: IPR010448 This family co 92.25
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in m 92.25
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicat 92.25
KOG0730|consensus693 92.25
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in th 92.24
PRK14526211 adenylate kinase; Provisional 92.23
PRK13833323 conjugal transfer protein TrbB; Provisional 92.22
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Yp 92.22
PRK08154309 anaerobic benzoate catabolism transcriptional regu 92.18
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 92.18
PRK09302 509 circadian clock protein KaiC; Reviewed 92.17
cd04136163 Rap_like Rap-like subfamily. The Rap subfamily con 92.16
PRK06761282 hypothetical protein; Provisional 92.15
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 92.14
TIGR00959428 ffh signal recognition particle protein. This mode 92.14
PRK14527191 adenylate kinase; Provisional 92.13
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 92.11
PRK14722374 flhF flagellar biosynthesis regulator FlhF; Provis 92.11
PTZ00132215 GTP-binding nuclear protein Ran; Provisional 92.11
PF01745233 IPT: Isopentenyl transferase; InterPro: IPR002648 92.1
KOG0090|consensus238 92.08
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzy 92.07
PRK08506472 replicative DNA helicase; Provisional 92.06
PRK05416288 glmZ(sRNA)-inactivating NTPase; Provisional 92.06
PRK13973213 thymidylate kinase; Provisional 92.06
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was id 92.05
cd01134369 V_A-ATPase_A V/A-type ATP synthase catalytic subun 92.03
PHA02624647 large T antigen; Provisional 92.0
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 92.0
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 91.98
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 91.97
cd01878204 HflX HflX subfamily. A distinct conserved domain w 91.96
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase th 91.96
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 91.92
cd03246173 ABCC_Protease_Secretion This family represents the 91.91
PRK07429327 phosphoribulokinase; Provisional 91.91
PRK14730195 coaE dephospho-CoA kinase; Provisional 91.9
PRK10463290 hydrogenase nickel incorporation protein HypB; Pro 91.89
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 91.89
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 91.87
PTZ00133182 ADP-ribosylation factor; Provisional 91.86
TIGR00602 637 rad24 checkpoint protein rad24. This family is bas 91.86
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 91.86
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 91.86
KOG0086|consensus214 91.85
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 91.84
cd04113161 Rab4 Rab4 subfamily. Rab4 has been implicated in n 91.84
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 91.83
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 91.82
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 91.81
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 91.8
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 91.8
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily 91.8
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 91.78
PHA02530300 pseT polynucleotide kinase; Provisional 91.76
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 91.75
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phos 91.75
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involve 91.74
PRK14493274 putative bifunctional molybdopterin-guanine dinucl 91.73
cd04129187 Rho2 Rho2 subfamily. Rho2 is a fungal GTPase that 91.73
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 91.73
TIGR00767415 rho transcription termination factor Rho. Members 91.72
cd01866168 Rab2 Rab2 subfamily. Rab2 is localized on cis-Golg 91.7
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 a 91.69
cd03116159 MobB Molybdenum is an essential trace element in t 91.69
TIGR00991313 3a0901s02IAP34 GTP-binding protein (Chloroplast En 91.69
cd01860163 Rab5_related Rab5-related subfamily. This subfamil 91.68
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 91.68
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associa 91.66
COG1117253 PstB ABC-type phosphate transport system, ATPase c 91.65
COG1643 845 HrpA HrpA-like helicases [DNA replication, recombi 91.64
cd03216163 ABC_Carb_Monos_I This family represents the domain 91.64
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 91.63
PLN02674244 adenylate kinase 91.63
PF02456369 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR 91.61
PRK09302509 circadian clock protein KaiC; Reviewed 91.6
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 91.57
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associat 91.57
COG3842352 PotA ABC-type spermidine/putrescine transport syst 91.56
KOG0733|consensus 802 91.56
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 91.55
PRK14235267 phosphate transporter ATP-binding protein; Provisi 91.55
PF02562205 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH 91.55
PRK14731208 coaE dephospho-CoA kinase; Provisional 91.55
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 91.54
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 91.53
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 91.52
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 91.52
PRK13949169 shikimate kinase; Provisional 91.52
PRK05595444 replicative DNA helicase; Provisional 91.51
COG0563178 Adk Adenylate kinase and related kinases [Nucleoti 91.51
PRK05748448 replicative DNA helicase; Provisional 91.5
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 91.5
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 91.5
cd03215182 ABC_Carb_Monos_II This family represents domain II 91.49
>KOG3928|consensus Back     alignment and domain information
Probab=100.00  E-value=5.7e-82  Score=602.17  Aligned_cols=337  Identities=33%  Similarity=0.575  Sum_probs=321.1

Q ss_pred             CCCccCcceEEEeCHHHHHHhhhcCCCChhhHHhhhhcCCceEEechhHHHHHHHHHhccCCCCCCCeEEEEccCCCcHH
Q psy3261           2 KHSKQDLYKFYTLPDEVRSAIFELGGITRVFNEQTQIFNESSILIRNCMLELVGYLKSMTNFDRPSPRFVLYGEHGVGKS   81 (342)
Q Consensus         2 ~h~~~~~g~~~~~~~~~~~~l~~~g~l~~~~~~~~~~~~~~~~lvR~~t~el~~~l~~~~~~~~~~~r~vL~G~~GsGKS   81 (342)
                      .|+..++|++|+||++++++++++ |+|..+.|++++|.|+++|||++++|+.++++. .+...|..||||||+.|||||
T Consensus       116 ~~ssk~~gk~~~i~~~~lk~l~~~-G~p~~~~~q~~tf~ea~lLVRkpalel~~~~r~-~d~~~P~~r~vL~Ge~GtGKS  193 (461)
T KOG3928|consen  116 FHSSKTEGKVFKISEEQLKQLNPL-GLPFKKSQQFKTFTEAVLLVRKPALELLLYKRL-VDPMHPVKRFVLDGEPGTGKS  193 (461)
T ss_pred             ccccccccceeecCHHHHHhhccC-CCchHHHHHHHhhhcchheechHHHHHHHHhhh-ccccCcceEEEEeCCCCCchh
Confidence            489999999999999999999999 559999999999999999999999999999777 888889999999999999999


Q ss_pred             HHHHHHHHHHHhCCeEEEEeCCccccccCCcceeccCCCCCccccHHHHHHHHHHHHHhCccccCCCCcccccceecCCC
Q psy3261          82 MALVYALQYAHENNYLLVHIPWVLRWFAYPKEVSHSLTKEGMVDLNIDAAMWLRHFQKQNTKWLEDPRLTTSQEYVWSPR  161 (342)
Q Consensus        82 ~~L~q~~~~A~~~gwiVl~vP~~~~~~~~~~~~~~s~~~~~~~~qP~~a~~~L~~~~~~N~~~L~~~~l~~s~~~~~~~~  161 (342)
                      ++|+|++|||..++|||||||+|..|++++++|.++....|+||||++|+.||++|+++|++.|++ +|+++++|+|+++
T Consensus       194 iaL~qa~h~a~~~~wlIlhip~a~~w~~~~~~~~y~~~~kg~~dqP~~a~~~L~~fkk~N~~~L~~-~lkt~~~yvwsk~  272 (461)
T KOG3928|consen  194 IALAQAVHYAADQKWLILHIPYAELWTNGRKDYSYDSDLKGLWDQPLYAKKILKNFKKTNEPALKK-QLKTSKDYVWSKR  272 (461)
T ss_pred             hHHHHHHHHHhcCCeEEEECCcHHHhhhccccccccccccccccChhHHHHHHHHHHhhccHHHHH-Hhccccceeeccc
Confidence            999999999999999999999999999999999999988999999999999999999999999984 5999999999999


Q ss_pred             CCCCCCCCHHHHHHhhcccccchhHHHHHHHHHHhccccCCCceEEEEEeCccccccCCCcCCCCCCCcccCCccchHHH
Q psy3261         162 EKSEANIPLAALIEHGITRVKYASDVVDVLFTEIKKLSTEGVCRTFVCVDGYNSFFAEKTNCKPEDKSKVLPSRVTLTRS  241 (342)
Q Consensus       162 e~~~~g~tL~dlv~~gi~~~~~a~~~~~~l~~EL~~~~~~~~~pVLvavD~~n~~~~~s~~y~~~~~~~I~~~~l~l~~~  241 (342)
                      |++++|++|.+|++.||.+...|++++++|++||+.++..+++|||||||+||+||+.+. |++.++++|+|.+|+++++
T Consensus       273 e~t~kG~pl~ei~e~gI~~i~~a~~~vg~llrelk~~s~~~~~kVLvaID~~n~l~~~T~-~k~~~~~~v~P~dl~li~~  351 (461)
T KOG3928|consen  273 ESTLKGKPLVEIVETGIASIKNAPDAVGILLRELKRLSVQSKVKVLVAIDNFNSLFTVTA-YKSEDNKPVTPLDLTLIHL  351 (461)
T ss_pred             CCccCCCcchhhHHhhhhhhccchHHHHHHHHHHHHhhhhcCccEEEEEcCcchheeeee-eeccccCcCCchhhhHHHH
Confidence            999999999999999999999999999999999999999999999999999999999766 9999999999999999999


Q ss_pred             HHHhhcCCCCCeEEEEEeC--CCCCCCCCc--cCcchhHHhhhcCCCCCCCcceeecCCCCHHHHHHHHHHHHhCCCcc-
Q psy3261         242 VINLVQSDWNNGAIVLALS--PRANLPDRR--ESHLPLYMLKKAGFESIDPFVPIHVPELNDEEFHNLLNLYESKKWLQ-  316 (342)
Q Consensus       242 ~~~~~~~~~~~G~vv~AtS--~~~~~~~~~--~~~~p~~llg~~g~~~~dP~~~i~v~~~s~~E~~~ll~yy~~~~~l~-  316 (342)
                      ++++++|+|.+|+||+|+|  ...+.....  ..+.|++++|+.|||.+|||+||+|++|+++|++++++||.+++|+. 
T Consensus       352 ~~~~i~ndwt~g~vi~a~s~~~~~~a~~h~gv~~y~pr~llg~egfe~lqpf~pi~v~nYt~~E~~~~i~YYl~~nwl~k  431 (461)
T KOG3928|consen  352 LRDIISNDWTFGSVIMAISGVTTPSAFGHLGVAPYVPRKLLGEEGFEALQPFVPIEVENYTLDEFEALIDYYLQSNWLLK  431 (461)
T ss_pred             HHHHHhcccccceEEEEecccccchhccccccccCCchHhcCccchhhccCcCccccCCCCHHHHHHHHHHHHHhhHHHh
Confidence            9999999999999999999  554444444  58899999999999999999999999999999999999999999998 


Q ss_pred             ---CcchHHHHHHhhCCCHHHHhhhccCC
Q psy3261         317 ---TSEGREEIAFLTKRVPQKMYEFCSFK  342 (342)
Q Consensus       317 ---~e~~~~el~~lSgGNP~~l~~lc~~~  342 (342)
                         +|++..|++|||||||..++++|+++
T Consensus       432 kv~~Ee~~kql~fLSngNP~l~~~lca~~  460 (461)
T KOG3928|consen  432 KVPGEENIKQLYFLSNGNPSLMERLCAFL  460 (461)
T ss_pred             hcCcccchhhhhhhcCCCHHHHHHHHHhc
Confidence               57789999999999999999999974



>PF10236 DAP3: Mitochondrial ribosomal death-associated protein 3; InterPro: IPR019368 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP Back     alignment and domain information
>PF14516 AAA_35: AAA-like domain Back     alignment and domain information
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK00411 cdc6 cell division control protein 6; Reviewed Back     alignment and domain information
>TIGR02928 orc1/cdc6 family replication initiation protein Back     alignment and domain information
>PF05729 NACHT: NACHT domain Back     alignment and domain information
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00112 origin recognition complex 1 protein; Provisional Back     alignment and domain information
>PF07693 KAP_NTPase: KAP family P-loop domain; InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>PF13191 AAA_16: AAA ATPase domain; PDB: 2V1U_A Back     alignment and domain information
>PF00931 NB-ARC: NB-ARC domain; InterPro: IPR002182 This is the NB-ARC domain, a novel signalling motif found in bacteria and eukaryotes, shared by plant resistance gene products and regulators of cell death in animals [] Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit Back     alignment and domain information
>PF05673 DUF815: Protein of unknown function (DUF815); InterPro: IPR008533 This domain consists of several bacterial proteins of unknown function Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR01241 FtsH_fam ATP-dependent metalloprotease FtsH Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK00440 rfc replication factor C small subunit; Reviewed Back     alignment and domain information
>PRK03992 proteasome-activating nucleotidase; Provisional Back     alignment and domain information
>TIGR01242 26Sp45 26S proteasome subunit P45 family Back     alignment and domain information
>PRK14960 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK12402 replication factor C small subunit 2; Reviewed Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14963 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00176 ftsH cell division protein; Validated Back     alignment and domain information
>PRK14949 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14958 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14956 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional Back     alignment and domain information
>TIGR03689 pup_AAA proteasome ATPase Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B Back     alignment and domain information
>TIGR00678 holB DNA polymerase III, delta' subunit Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK14964 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14961 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>CHL00195 ycf46 Ycf46; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX Back     alignment and domain information
>PRK07471 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14970 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau Back     alignment and domain information
>PRK14965 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14971 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK04195 replication factor C large subunit; Provisional Back     alignment and domain information
>PLN03025 replication factor C subunit; Provisional Back     alignment and domain information
>PRK14959 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14951 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05707 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2228|consensus Back     alignment and domain information
>PRK14952 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PRK14962 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14087 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PTZ00361 26 proteosome regulatory subunit 4-like protein; Provisional Back     alignment and domain information
>PRK14957 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14969 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK14953 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK08903 DnaA regulatory inactivator Hda; Validated Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08084 DNA replication initiation factor; Provisional Back     alignment and domain information
>PRK14950 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK14948 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK07940 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK14955 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>PF10923 DUF2791: P-loop Domain of unknown function (DUF2791); InterPro: IPR021228 This is a family of proteins found in archaea and bacteria Back     alignment and domain information
>KOG0731|consensus Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>COG2607 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins Back     alignment and domain information
>TIGR03345 VI_ClpV1 type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] Back     alignment and domain information
>PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies Back     alignment and domain information
>PF13173 AAA_14: AAA domain Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08058 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK06921 hypothetical protein; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>KOG1970|consensus Back     alignment and domain information
>PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif Back     alignment and domain information
>TIGR01243 CDC48 AAA family ATPase, CDC48 subfamily Back     alignment and domain information
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B Back     alignment and domain information
>TIGR00763 lon ATP-dependent protease La Back     alignment and domain information
>PRK12608 transcription termination factor Rho; Provisional Back     alignment and domain information
>PRK06871 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>CHL00206 ycf2 Ycf2; Provisional Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>PRK05642 DNA replication initiation factor; Validated Back     alignment and domain information
>PRK10733 hflB ATP-dependent metalloprotease; Reviewed Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>PRK07993 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>TIGR00362 DnaA chromosomal replication initiator protein DnaA Back     alignment and domain information
>cd01120 RecA-like_NTPases RecA-like NTPases Back     alignment and domain information
>PRK08727 hypothetical protein; Validated Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A Back     alignment and domain information
>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>KOG0734|consensus Back     alignment and domain information
>KOG2543|consensus Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] Back     alignment and domain information
>COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase Back     alignment and domain information
>PRK07399 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>COG3899 Predicted ATPase [General function prediction only] Back     alignment and domain information
>PTZ00202 tuzin; Provisional Back     alignment and domain information
>CHL00095 clpC Clp protease ATP binding subunit Back     alignment and domain information
>COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase Back     alignment and domain information
>PRK08939 primosomal protein DnaI; Reviewed Back     alignment and domain information
>PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport Back     alignment and domain information
>PRK08533 flagellar accessory protein FlaH; Reviewed Back     alignment and domain information
>PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A Back     alignment and domain information
>PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A Back     alignment and domain information
>PRK00149 dnaA chromosomal replication initiation protein; Reviewed Back     alignment and domain information
>PF13521 AAA_28: AAA domain; PDB: 1LW7_A Back     alignment and domain information
>COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] Back     alignment and domain information
>TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family Back     alignment and domain information
>cd00984 DnaB_C DnaB helicase C terminal domain Back     alignment and domain information
>PRK08769 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG2859|consensus Back     alignment and domain information
>PRK04296 thymidine kinase; Provisional Back     alignment and domain information
>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases Back     alignment and domain information
>PLN00020 ribulose bisphosphate carboxylase/oxygenase activase -RuBisCO activase (RCA); Provisional Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family Back     alignment and domain information
>COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB Back     alignment and domain information
>PRK12422 chromosomal replication initiation protein; Provisional Back     alignment and domain information
>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family Back     alignment and domain information
>cd01394 radB RadB Back     alignment and domain information
>TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family Back     alignment and domain information
>PRK09435 membrane ATPase/protein kinase; Provisional Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>PRK06964 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09087 hypothetical protein; Validated Back     alignment and domain information
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) Back     alignment and domain information
>CHL00181 cbbX CbbX; Provisional Back     alignment and domain information
>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes Back     alignment and domain information
>PF13479 AAA_24: AAA domain Back     alignment and domain information
>PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>PRK09361 radB DNA repair and recombination protein RadB; Provisional Back     alignment and domain information
>PRK14088 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PRK04328 hypothetical protein; Provisional Back     alignment and domain information
>PRK05973 replicative DNA helicase; Provisional Back     alignment and domain information
>PF12846 AAA_10: AAA-like domain Back     alignment and domain information
>PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 Back     alignment and domain information
>PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C Back     alignment and domain information
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02012 tigrfam_recA protein RecA Back     alignment and domain information
>PHA03133 thymidine kinase; Provisional Back     alignment and domain information
>PRK06067 flagellar accessory protein FlaH; Validated Back     alignment and domain information
>PRK14974 cell division protein FtsY; Provisional Back     alignment and domain information
>PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY Back     alignment and domain information
>PF03215 Rad17: Rad17 cell cycle checkpoint protein Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>PF10443 RNA12: RNA12 protein; InterPro: IPR018850 Mitochondrial escape protein 2 (also known as RNA12) plays a role in maintaining the mitochondrial genome and in controlling mtDNA escape [, ] Back     alignment and domain information
>PF13555 AAA_29: P-loop containing region of AAA domain Back     alignment and domain information
>PF03193 DUF258: Protein of unknown function, DUF258; InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis Back     alignment and domain information
>KOG0780|consensus Back     alignment and domain information
>PF08477 Miro: Miro-like protein; InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases Back     alignment and domain information
>COG4088 Predicted nucleotide kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS) Back     alignment and domain information
>PRK06851 hypothetical protein; Provisional Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>cd00046 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK13764 ATPase; Provisional Back     alignment and domain information
>cd01121 Sms Sms (bacterial radA) DNA repair protein Back     alignment and domain information
>PHA03135 thymidine kinase; Provisional Back     alignment and domain information
>TIGR02881 spore_V_K stage V sporulation protein K Back     alignment and domain information
>cd01131 PilT Pilus retraction ATPase PilT Back     alignment and domain information
>KOG0743|consensus Back     alignment and domain information
>PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response Back     alignment and domain information
>TIGR00235 udk uridine kinase Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PF00910 RNA_helicase: RNA helicase; InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5) Back     alignment and domain information
>smart00763 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>PF13476 AAA_23: AAA domain; PDB: 3AV0_B 3AUY_B 3AUX_A 2O5V_A 3QG5_B 3QF7_A 3THO_A Back     alignment and domain information
>PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair Back     alignment and domain information
>PF03308 ArgK: ArgK protein; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>PRK10263 DNA translocase FtsK; Provisional Back     alignment and domain information
>PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor Back     alignment and domain information
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK09354 recA recombinase A; Provisional Back     alignment and domain information
>PRK09519 recA DNA recombination protein RecA; Reviewed Back     alignment and domain information
>PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PHA03138 thymidine kinase; Provisional Back     alignment and domain information
>KOG0735|consensus Back     alignment and domain information
>PRK11823 DNA repair protein RadA; Provisional Back     alignment and domain information
>PRK14086 dnaA chromosomal replication initiation protein; Provisional Back     alignment and domain information
>PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] Back     alignment and domain information
>KOG1514|consensus Back     alignment and domain information
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB Back     alignment and domain information
>PRK10787 DNA-binding ATP-dependent protease La; Provisional Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>TIGR00416 sms DNA repair protein RadA Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>PHA00729 NTP-binding motif containing protein Back     alignment and domain information
>PRK10416 signal recognition particle-docking protein FtsY; Provisional Back     alignment and domain information
>PRK14532 adenylate kinase; Provisional Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C Back     alignment and domain information
>PHA03134 thymidine kinase; Provisional Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>KOG0736|consensus Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems Back     alignment and domain information
>KOG0727|consensus Back     alignment and domain information
>PRK05480 uridine/cytidine kinase; Provisional Back     alignment and domain information
>PRK10536 hypothetical protein; Provisional Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00041 DTMP_kinase thymidylate kinase Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>TIGR03238 dnd_assoc_3 dnd system-associated protein 3 Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily Back     alignment and domain information
>PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases Back     alignment and domain information
>PRK13900 type IV secretion system ATPase VirB11; Provisional Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PLN03187 meiotic recombination protein DMC1 homolog; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01420 pilT_fam pilus retraction protein PilT Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>KOG0741|consensus Back     alignment and domain information
>PF06414 Zeta_toxin: Zeta toxin; InterPro: IPR010488 This entry represents a domain originally identified in bacterial zeta toxin proteins, where it comprises the whole protein [] Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>KOG2749|consensus Back     alignment and domain information
>PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase Back     alignment and domain information
>TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB Back     alignment and domain information
>TIGR02238 recomb_DMC1 meiotic recombinase Dmc1 Back     alignment and domain information
>PRK10436 hypothetical protein; Provisional Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>PHA02544 44 clamp loader, small subunit; Provisional Back     alignment and domain information
>PRK14530 adenylate kinase; Provisional Back     alignment and domain information
>TIGR02236 recomb_radA DNA repair and recombination protein RadA Back     alignment and domain information
>TIGR00665 DnaB replicative DNA helicase Back     alignment and domain information
>PRK00131 aroK shikimate kinase; Reviewed Back     alignment and domain information
>TIGR01618 phage_P_loop phage nucleotide-binding protein Back     alignment and domain information
>TIGR00231 small_GTP small GTP-binding protein domain Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB Back     alignment and domain information
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>PF09820 AAA-ATPase_like: Predicted AAA-ATPase; InterPro: IPR018631 This entry is predicted to be an AAA-ATPase domain [] Back     alignment and domain information
>PF08433 KTI12: Chromatin associated protein KTI12 ; InterPro: IPR013641 This is a family of chromatin associated proteins which interact with the Elongator complex, a component of the elongating form of RNA polymerase II [] Back     alignment and domain information
>TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal Back     alignment and domain information
>PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein Back     alignment and domain information
>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch Back     alignment and domain information
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PF01926 MMR_HSR1: 50S ribosome-binding GTPase; InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse Back     alignment and domain information
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs) Back     alignment and domain information
>TIGR00376 DNA helicase, putative Back     alignment and domain information
>smart00487 DEXDc DEAD-like helicases superfamily Back     alignment and domain information
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54 Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ Back     alignment and domain information
>TIGR00455 apsK adenylylsulfate kinase (apsK) Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>TIGR00150 HI0065_YjeE ATPase, YjeE family Back     alignment and domain information
>PRK09825 idnK D-gluconate kinase; Provisional Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function Back     alignment and domain information
>COG3911 Predicted ATPase [General function prediction only] Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PF01583 APS_kinase: Adenylylsulphate kinase; InterPro: IPR002891 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>PRK14531 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01351 adk adenylate kinases Back     alignment and domain information
>PRK13700 conjugal transfer protein TraD; Provisional Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PHA03136 thymidine kinase; Provisional Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes Back     alignment and domain information
>PTZ00088 adenylate kinase 1; Provisional Back     alignment and domain information
>PRK04301 radA DNA repair and recombination protein RadA; Validated Back     alignment and domain information
>cd04154 Arl2 Arl2 subfamily Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00764 lon_rel lon-related putative ATP-dependent protease Back     alignment and domain information
>KOG0989|consensus Back     alignment and domain information
>cd00879 Sar1 Sar1 subfamily Back     alignment and domain information
>cd01861 Rab6 Rab6 subfamily Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>PF00025 Arf: ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins; InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases Back     alignment and domain information
>TIGR02655 circ_KaiC circadian clock protein KaiC Back     alignment and domain information
>PRK08099 bifunctional DNA-binding transcriptional repressor/ NMN adenylyltransferase; Provisional Back     alignment and domain information
>PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily Back     alignment and domain information
>PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PF14532 Sigma54_activ_2: Sigma-54 interaction domain; PDB: 3CO5_B 3N70_H Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>PHA02774 E1; Provisional Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>KOG0781|consensus Back     alignment and domain information
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic Back     alignment and domain information
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily Back     alignment and domain information
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts) Back     alignment and domain information
>TIGR02903 spore_lon_C ATP-dependent protease, Lon family Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity Back     alignment and domain information
>TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>cd04156 ARLTS1 ARLTS1 subfamily Back     alignment and domain information
>PLN02200 adenylate kinase family protein Back     alignment and domain information
>PRK14528 adenylate kinase; Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily Back     alignment and domain information
>cd00876 Ras Ras family Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>PF09439 SRPRB: Signal recognition particle receptor beta subunit; InterPro: IPR019009 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>cd04163 Era Era subfamily Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>TIGR01650 PD_CobS cobaltochelatase, CobS subunit Back     alignment and domain information
>PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>KOG0730|consensus Back     alignment and domain information
>cd00464 SK Shikimate kinase (SK) is the fifth enzyme in the shikimate pathway, a seven-step biosynthetic pathway which converts erythrose-4-phosphate to chorismic acid, found in bacteria, fungi and plants Back     alignment and domain information
>PRK14526 adenylate kinase; Provisional Back     alignment and domain information
>PRK13833 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2 Back     alignment and domain information
>PRK08154 anaerobic benzoate catabolism transcriptional regulator; Reviewed Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>cd04136 Rap_like Rap-like subfamily Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein Back     alignment and domain information
>PRK14527 adenylate kinase; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PTZ00132 GTP-binding nuclear protein Ran; Provisional Back     alignment and domain information
>PF01745 IPT: Isopentenyl transferase; InterPro: IPR002648 Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid [] Back     alignment and domain information
>KOG0090|consensus Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>PRK08506 replicative DNA helicase; Provisional Back     alignment and domain information
>PRK05416 glmZ(sRNA)-inactivating NTPase; Provisional Back     alignment and domain information
>PRK13973 thymidylate kinase; Provisional Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd01134 V_A-ATPase_A V/A-type ATP synthase catalytic subunit A Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>cd01878 HflX HflX subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>PRK14730 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PTZ00133 ADP-ribosylation factor; Provisional Back     alignment and domain information
>TIGR00602 rad24 checkpoint protein rad24 Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>KOG0086|consensus Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd04113 Rab4 Rab4 subfamily Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd04124 RabL2 RabL2 subfamily Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional Back     alignment and domain information
>cd04129 Rho2 Rho2 subfamily Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>TIGR00767 rho transcription termination factor Rho Back     alignment and domain information
>cd01866 Rab2 Rab2 subfamily Back     alignment and domain information
>cd01868 Rab11_like Rab11-like Back     alignment and domain information
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes Back     alignment and domain information
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase) Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd04114 Rab30 Rab30 subfamily Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PLN02674 adenylate kinase Back     alignment and domain information
>PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] Back     alignment and domain information
>PRK09302 circadian clock protein KaiC; Reviewed Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0733|consensus Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] Back     alignment and domain information
>PRK14731 coaE dephospho-CoA kinase; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13949 shikimate kinase; Provisional Back     alignment and domain information
>PRK05595 replicative DNA helicase; Provisional Back     alignment and domain information
>COG0563 Adk Adenylate kinase and related kinases [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK05748 replicative DNA helicase; Provisional Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query342
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-14
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
 Score = 74.5 bits (182), Expect = 1e-14
 Identities = 62/368 (16%), Positives = 121/368 (32%), Gaps = 94/368 (25%)

Query: 6   QDLYKFYTLPDEVRSAIFELGGITRVFNEQ-TQIFNESSIL-------------IRNCML 51
           +  YKF  L   +++   +   +TR++ EQ  +++N++ +              +R  +L
Sbjct: 88  RINYKF--LMSPIKTEQRQPSMMTRMYIEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALL 145

Query: 52  ELVGYLKSMTNFDRPSPRFVLYGEHGVGKSMALVYALQYAHENNYLLVHIPWVLRWFAYP 111
           EL           RP+   ++ G  G GK+     AL     +  +   + + + W    
Sbjct: 146 EL-----------RPAKNVLIDGVLGSGKT---WVALD-VCLSYKVQCKMDFKIFWLNLK 190

Query: 112 KEVSHSLTKEGMVDL--NIDAAMWLRHFQKQNTK----WLEDP--RLTTSQEY------- 156
              S     E +  L   ID     R     N K     ++    RL  S+ Y       
Sbjct: 191 NCNSPETVLEMLQKLLYQIDPNWTSRSDHSSNIKLRIHSIQAELRRLLKSKPYENCLLVL 250

Query: 157 --VWSPREKSEANIPLAALIEHGITRVKYASDVVDVLFTEIKKLSTEGVCRTFVCVDGYN 214
             V + +  +  N+    L+    TR K  +D +    T    +S +    T    +   
Sbjct: 251 LNVQNAKAWNAFNLSCKILL---TTRFKQVTDFLSAATT--THISLDHHSMTLTPDEV-K 304

Query: 215 SFFAEKTNCKPEDKSKVLPSRVT----LTRSVINLVQSD----WNN-------------G 253
           S   +  +C+P+D    LP  V        S+I     D    W+N              
Sbjct: 305 SLLLKYLDCRPQD----LPREVLTTNPRRLSIIAESIRDGLATWDNWKHVNCDKLTTIIE 360

Query: 254 AIVLALSPRANLPDRRESHLPLYMLKKAGFESIDPFVPIHV-----PELNDEEFHNLLNL 308
           + +  L P     + R+    L +            +P  +      ++   +   ++N 
Sbjct: 361 SSLNVLEP----AEYRKMFDRLSVFPP------SAHIPTILLSLIWFDVIKSDVMVVVNK 410

Query: 309 YESKKWLQ 316
                 ++
Sbjct: 411 LHKYSLVE 418


Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query342
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 98.87
1njg_A250 DNA polymerase III subunit gamma; rossman-like fol 98.81
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 98.8
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 98.74
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 98.72
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 98.69
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 98.68
2chg_A226 Replication factor C small subunit; DNA-binding pr 98.66
2fna_A 357 Conserved hypothetical protein; structural genomic 98.6
3bos_A242 Putative DNA replication factor; P-loop containing 98.38
3h4m_A285 Proteasome-activating nucleotidase; ATPase, PAN, A 98.37
3uk6_A368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 98.35
4b4t_J405 26S protease regulatory subunit 8 homolog; hydrola 98.26
3te6_A318 Regulatory protein SIR3; heterochromatin, gene sil 98.26
1xwi_A322 SKD1 protein; VPS4B, AAA ATPase, protein transport 98.26
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 98.24
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 98.23
3eie_A322 Vacuolar protein sorting-associated protein 4; AAA 98.2
4b4t_H467 26S protease regulatory subunit 7 homolog; hydrola 98.16
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 98.16
2chq_A 319 Replication factor C small subunit; DNA-binding pr 98.15
4b4t_L437 26S protease subunit RPT4; hydrolase, AAA-atpases, 98.13
4b4t_M434 26S protease regulatory subunit 6A; hydrolase, AAA 98.12
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 98.09
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 98.08
4b4t_K428 26S protease regulatory subunit 6B homolog; hydrol 98.03
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural 98.03
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 98.02
2qp9_X355 Vacuolar protein sorting-associated protein 4; ATP 98.02
1lv7_A257 FTSH; alpha/beta domain, four helix bundle, hydrol 98.0
4b4t_I437 26S protease regulatory subunit 4 homolog; hydrola 98.0
2zan_A444 Vacuolar protein sorting-associating protein 4B; S 97.99
1l8q_A324 Chromosomal replication initiator protein DNAA; AA 97.92
2c9o_A456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 97.91
1a5t_A 334 Delta prime, HOLB; zinc finger, DNA replication; 2 97.89
3d8b_A357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 97.86
3vfd_A389 Spastin; ATPase, microtubule severing, hydrolase; 97.8
3syl_A309 Protein CBBX; photosynthesis, rubisco activase, AA 97.79
3cf0_A301 Transitional endoplasmic reticulum ATPase; AAA, P9 97.78
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 97.77
3pvs_A 447 Replication-associated recombination protein A; ma 97.75
3b9p_A297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 97.68
1ofh_A310 ATP-dependent HSL protease ATP-binding subunit HSL 97.67
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 97.63
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 97.63
3hu3_A489 Transitional endoplasmic reticulum ATPase; VCP, tr 97.62
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 97.55
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 97.54
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 97.5
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 97.5
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 97.49
1d2n_A272 N-ethylmaleimide-sensitive fusion protein; hexamer 97.47
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 97.41
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 97.3
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 97.28
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 97.27
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 97.18
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 97.12
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.98
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 96.98
2p65_A187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.98
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 96.87
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 96.8
2orw_A184 Thymidine kinase; TMTK, TP4A, transferase; HET: 4T 96.72
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 96.69
2kjq_A149 DNAA-related protein; solution structure, NESG, st 96.54
3uie_A200 Adenylyl-sulfate kinase 1, chloroplastic; rossmann 96.44
2b8t_A223 Thymidine kinase; deoxyribonucleoside kinase, zinc 96.3
2qgz_A308 Helicase loader, putative primosome component; str 96.22
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.15
1knq_A175 Gluconate kinase; ALFA/beta structure, transferase 96.0
2dr3_A247 UPF0273 protein PH0284; RECA superfamily ATPase, h 95.94
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, str 95.93
3io5_A333 Recombination and repair protein; storage dimer, i 95.87
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 95.84
3hr8_A356 Protein RECA; alpha and beta proteins (A/B, A+B), 95.8
2zts_A251 Putative uncharacterized protein PH0186; KAIC like 95.75
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 95.7
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 95.67
2z0h_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 95.66
3bh0_A315 DNAB-like replicative helicase; ATPase, replicatio 95.66
3lw7_A179 Adenylate kinase related protein (ADKA-like); AMP, 95.65
2bjv_A265 PSP operon transcriptional activator; AAA, transcr 95.59
2zr9_A349 Protein RECA, recombinase A; recombination, RECA m 95.59
1tue_A212 Replication protein E1; helicase, replication, E1E 95.58
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 95.5
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 95.48
2iut_A574 DNA translocase FTSK; nucleotide-binding, chromoso 95.43
3a4m_A260 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 95.41
1ly1_A181 Polynucleotide kinase; PNK, phosphatase, transfera 95.41
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 95.36
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 95.36
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 95.31
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 95.3
1kag_A173 SKI, shikimate kinase I; transferase, structural g 95.29
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 95.29
2cvh_A220 DNA repair and recombination protein RADB; filamen 95.28
4b3f_X 646 DNA-binding protein smubp-2; hydrolase, helicase; 95.27
2pbr_A195 DTMP kinase, thymidylate kinase; transferase, nucl 95.24
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural g 95.23
3tlx_A243 Adenylate kinase 2; structural genomics, structura 95.15
3t15_A293 Ribulose bisphosphate carboxylase/oxygenase activ 95.1
1xx6_A191 Thymidine kinase; NESG, northeast structural genom 95.06
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 95.04
1u0j_A267 DNA replication protein; AAA+ protein, P-loop atpa 94.98
1u94_A356 RECA protein, recombinase A; homologous recombinat 94.96
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 94.96
2rhm_A193 Putative kinase; P-loop containing nucleoside trip 94.96
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 94.88
3bgw_A444 DNAB-like replicative helicase; ATPase, replicatio 94.86
3c8u_A208 Fructokinase; YP_612366.1, putative fructose trans 94.79
1w4r_A195 Thymidine kinase; type II, human, cytosolic, phosp 94.79
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 94.78
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 94.77
4a1f_A338 DNAB helicase, replicative DNA helicase; hydrolase 94.75
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 94.71
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 94.71
1y63_A184 LMAJ004144AAA protein; structural genomics, protei 94.7
3t61_A202 Gluconokinase; PSI-biology, structural genomics, p 94.68
2if2_A204 Dephospho-COA kinase; alpha-beta protein, structur 94.6
3vaa_A199 Shikimate kinase, SK; structural genomics, center 94.59
1xp8_A366 RECA protein, recombinase A; recombination, radior 94.59
1nlf_A279 Regulatory protein REPA; replicative DNA helicase 94.57
1xjc_A169 MOBB protein homolog; structural genomics, midwest 94.57
4a74_A231 DNA repair and recombination protein RADA; hydrola 94.54
2z43_A324 DNA repair and recombination protein RADA; archaea 94.51
1ojl_A304 Transcriptional regulatory protein ZRAR; response 94.5
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 94.48
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 94.48
3co5_A143 Putative two-component system transcriptional RES 94.48
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 94.45
1uf9_A203 TT1252 protein; P-loop, nucleotide binding domain, 94.41
2c95_A196 Adenylate kinase 1; transferase, AP4A, nucleotide 94.41
2r8r_A228 Sensor protein; KDPD, PFAM02702, MCSG, structural 94.38
1aky_A220 Adenylate kinase; ATP:AMP phosphotransferase, myok 94.36
4fcw_A311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 94.35
3cm0_A186 Adenylate kinase; ATP-binding, cytoplasm, nucleoti 94.35
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 94.27
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 94.27
3kb2_A173 SPBC2 prophage-derived uncharacterized protein YOR 94.24
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 94.23
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 94.17
1gtv_A214 TMK, thymidylate kinase; transferase, transferase 94.14
3iij_A180 Coilin-interacting nuclear ATPase protein; alpha a 94.13
1nn5_A215 Similar to deoxythymidylate kinase (thymidylate K; 94.1
1jjv_A206 Dephospho-COA kinase; P-loop nucleotide-binding fo 94.09
2r6a_A454 DNAB helicase, replicative helicase; replication, 94.09
2eyu_A261 Twitching motility protein PILT; pilus retraction 94.08
1tev_A196 UMP-CMP kinase; ploop, NMP binding region, LID reg 94.06
3e1s_A574 Exodeoxyribonuclease V, subunit RECD; alpha and be 94.05
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics 94.05
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 94.04
3hws_A363 ATP-dependent CLP protease ATP-binding subunit CL; 93.99
1v5w_A343 DMC1, meiotic recombination protein DMC1/LIM15 hom 93.93
1e4v_A214 Adenylate kinase; transferase(phosphotransferase); 93.93
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 93.93
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis pr 93.93
3be4_A217 Adenylate kinase; malaria, cryptosporidium parvum 93.91
2cdn_A201 Adenylate kinase; phosphoryl transfer, associative 93.88
2p5t_B253 PEZT; postsegregational killing system, phosphoryl 93.87
3trf_A185 Shikimate kinase, SK; amino acid biosynthesis, tra 93.87
2wwf_A212 Thymidilate kinase, putative; transferase, malaria 93.86
1zd8_A227 GTP:AMP phosphotransferase mitochondrial; ATP:AMP 93.85
1via_A175 Shikimate kinase; structural genomics, transferase 93.84
2plr_A213 DTMP kinase, probable thymidylate kinase; TMP-bind 93.84
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 93.84
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 93.83
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, s 93.82
2ged_A193 SR-beta, signal recognition particle receptor beta 93.8
2bwj_A199 Adenylate kinase 5; phosphoryl transfer reaction, 93.8
2hf9_A226 Probable hydrogenase nickel incorporation protein 93.77
2px0_A296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 93.72
1q57_A503 DNA primase/helicase; dntpase, DNA replication, tr 93.69
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 93.67
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 93.64
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 93.62
3pxg_A468 Negative regulator of genetic competence CLPC/MEC; 93.6
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 93.6
1qf9_A194 UMP/CMP kinase, protein (uridylmonophosphate/cytid 93.59
2j9r_A214 Thymidine kinase; TK1, DNK, lasso, transferase, AT 93.56
1e6c_A173 Shikimate kinase; phosphoryl transfer, ADP, shikim 93.55
1ko7_A314 HPR kinase/phosphatase; protein kinase, phosphotra 93.54
1cke_A227 CK, MSSA, protein (cytidine monophosphate kinase); 93.53
2q6t_A444 DNAB replication FORK helicase; hydrolase; 2.90A { 93.53
2r62_A268 Cell division protease FTSH homolog; ATPase domain 93.51
1qhx_A178 CPT, protein (chloramphenicol phosphotransferase); 93.49
1vht_A218 Dephospho-COA kinase; structural genomics, transfe 93.49
2v54_A204 DTMP kinase, thymidylate kinase; nucleotide biosyn 93.48
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 93.38
2iyv_A184 Shikimate kinase, SK; transferase, aromatic amino 93.37
1vma_A306 Cell division protein FTSY; TM0570, structural gen 93.34
1ukz_A203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 93.32
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 93.3
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 93.27
2xb4_A223 Adenylate kinase; ATP-binding, nucleotide-binding, 93.23
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 93.2
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 93.18
3llm_A235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 93.15
2i1q_A322 DNA repair and recombination protein RADA; ATPase, 93.13
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 93.11
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 93.11
1um8_A376 ATP-dependent CLP protease ATP-binding subunit CL; 93.1
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal r 93.03
2wsm_A221 Hydrogenase expression/formation protein (HYPB); m 93.02
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 93.01
3dm5_A443 SRP54, signal recognition 54 kDa protein; protein- 93.0
2jaq_A205 Deoxyguanosine kinase; transferase, deoxyribonucle 92.97
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 92.92
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 92.87
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 92.85
2pt5_A168 Shikimate kinase, SK; aromatic amino acid biosynth 92.85
3tqf_A181 HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co 92.84
1z2a_A168 RAS-related protein RAB-23; RAB GTPase, vesicular 92.82
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 92.82
1ky3_A182 GTP-binding protein YPT7P; vesicular traffic, GTP 92.82
1u8z_A168 RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNH 92.76
2dyk_A161 GTP-binding protein; GTPase, ribosome-binding prot 92.75
4ag6_A392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 92.74
1fzq_A181 ADP-ribosylation factor-like protein 3; protein-GD 92.72
2erx_A172 GTP-binding protein DI-RAS2; GTP hydrolysis, trans 92.71
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 92.68
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 92.67
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 92.67
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 92.67
2lkc_A178 Translation initiation factor IF-2; NMR {Geobacill 92.66
2www_A349 Methylmalonic aciduria type A protein, mitochondri 92.64
1p9r_A418 General secretion pathway protein E; bacterial typ 92.63
1zcb_A362 G alpha I/13; GTP-binding, lipoprotein, membrane, 92.61
2ewv_A372 Twitching motility protein PILT; pilus retraction 92.58
2f9l_A199 RAB11B, member RAS oncogene family; RAB11B GTPase, 92.58
2ce2_X166 GTPase HRAS; signaling protein, guanine nucleotide 92.57
2nzj_A175 GTP-binding protein REM 1; GDP/GTP binding, GTP hy 92.55
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, re 92.53
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 92.52
1svi_A195 GTP-binding protein YSXC; ENGB, GTPase, GDP, hydro 92.52
1kao_A167 RAP2A; GTP-binding protein, small G protein, GDP, 92.52
3pqc_A195 Probable GTP-binding protein ENGB; rossmann fold, 92.51
1oix_A191 RAS-related protein RAB-11A; small G protein, intr 92.5
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 92.5
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 92.48
1ek0_A170 Protein (GTP-binding protein YPT51); vesicular tra 92.42
1tf7_A525 KAIC; homohexamer, hexamer, circadian clock protei 92.41
2gj8_A172 MNME, tRNA modification GTPase TRME; G-domain dime 92.38
2r44_A331 Uncharacterized protein; putative ATPase, structur 92.36
1upt_A171 ARL1, ADP-ribosylation factor-like protein 1; hydr 92.36
2zej_A184 Dardarin, leucine-rich repeat kinase 2; parkinson' 92.34
1m2o_B190 GTP-binding protein SAR1, GTP binding protein; zin 92.33
1moz_A183 ARL1, ADP-ribosylation factor-like protein 1; GTP- 92.31
1g8p_A350 Magnesium-chelatase 38 kDa subunit; parallel beta 92.29
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 92.27
3tqc_A321 Pantothenate kinase; biosynthesis of cofactors, pr 92.24
1z08_A170 RAS-related protein RAB-21; RAB GTPase, vesicular 92.23
2vli_A183 Antibiotic resistance protein; transferase, tunica 92.23
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 92.23
2orv_A234 Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 92.22
1jr3_D 343 DNA polymerase III, delta subunit; processivity, p 92.21
3ice_A422 Transcription termination factor RHO; transcriptio 92.2
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleoti 92.19
1wms_A177 RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, p 92.18
1nrj_B218 SR-beta, signal recognition particle receptor beta 92.17
2fn4_A181 P23, RAS-related protein R-RAS; GDP/GTP binding, G 92.16
4e22_A252 Cytidylate kinase; P-loop, CMP/ATP binding, transf 92.15
2wji_A165 Ferrous iron transport protein B homolog; membrane 92.14
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase 92.14
1b0u_A262 Histidine permease; ABC transporter, transport pro 92.1
4edh_A213 DTMP kinase, thymidylate kinase; structural genomi 92.1
3q72_A166 GTP-binding protein RAD; G-domain, CAV2 beta, sign 92.09
1sgw_A214 Putative ABC transporter; structural genomics, P p 92.08
1z0j_A170 RAB-22, RAS-related protein RAB-22A; RAB GTPase, R 92.04
1g16_A170 RAS-related protein SEC4; G protein RAB, signaling 92.04
2f6r_A281 COA synthase, bifunctional coenzyme A synthase; 18 92.01
2wjg_A188 FEOB, ferrous iron transport protein B homolog; me 92.01
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 92.0
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 92.0
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 91.98
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 91.98
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 91.97
4gzl_A204 RAS-related C3 botulinum toxin substrate 1; rossma 91.95
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 91.94
3def_A262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 91.93
2bme_A186 RAB4A, RAS-related protein RAB4A; GTP-binding prot 91.93
2ghi_A260 Transport protein; multidrug resistance protein, M 91.91
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 91.9
1vg8_A207 RAS-related protein RAB-7; GTP-binding protein, pr 91.88
1ji0_A240 ABC transporter; ATP binding protein, structural g 91.87
4dsu_A189 GTPase KRAS, isoform 2B; small G-protein, signalin 91.87
1ak2_A233 Adenylate kinase isoenzyme-2; nucleoside monophosp 91.85
1f6b_A198 SAR1; gtpases, N-terminal helix, Mg-containing com 91.81
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 91.81
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 91.8
3ihw_A184 Centg3; RAS, centaurin, GTPase, structural genomic 91.8
3q85_A169 GTP-binding protein REM 2; G-domain, CAV2 beta, si 91.8
2og2_A359 Putative signal recognition particle receptor; nuc 91.79
1odf_A290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 91.79
2y8e_A179 RAB-protein 6, GH09086P, RAB6; hydrolase, nucleoti 91.78
3tw8_B181 RAS-related protein RAB-35; longin domain, RAB GTP 91.75
3clv_A208 RAB5 protein, putative; malaria, GTPase, structura 91.74
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 91.73
1g6h_A257 High-affinity branched-chain amino acid transport 91.72
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 91.71
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 91.69
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 91.67
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 91.66
1r2q_A170 RAS-related protein RAB-5A; GTPase, GNP, atomic re 91.65
1z0f_A179 RAB14, member RAS oncogene family; RAB GTPase, ves 91.64
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 91.63
3kkq_A183 RAS-related protein M-RAS; GTP-binding, GTPase, si 91.62
1c1y_A167 RAS-related protein RAP-1A; GTP-binding proteins, 91.59
1h65_A270 Chloroplast outer envelope protein OEP34; GTPase, 91.57
1r8s_A164 ADP-ribosylation factor 1; protein transport/excha 91.56
3kta_A182 Chromosome segregation protein SMC; structural mai 91.55
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 91.55
3bwd_D182 RAC-like GTP-binding protein ARAC6; G domain, cyto 91.53
1jwy_B315 Dynamin A GTPase domain; dynamin, GTPase, GDP, myo 91.53
2vhj_A331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 91.52
2cxx_A190 Probable GTP-binding protein ENGB; structural geno 91.5
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 91.49
1svm_A377 Large T antigen; AAA+ fold, viral protein; HET: AT 91.49
1zuh_A168 Shikimate kinase; alpha-beta protein, transferase; 91.45
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 91.44
3bc1_A195 RAS-related protein RAB-27A; RAB27, GTPase, RAB, s 91.44
3hjn_A197 DTMP kinase, thymidylate kinase; ATP-binding, nucl 91.43
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 91.41
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 91.4
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 91.4
2hxs_A178 RAB-26, RAS-related protein RAB-28; GTPase, signal 91.39
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 91.38
2efe_B181 Small GTP-binding protein-like; GEF, GTPase, VPS9, 91.34
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 91.32
2g6b_A180 RAS-related protein RAB-26; G-protein, GTP analogu 91.31
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 91.29
1uj2_A252 Uridine-cytidine kinase 2; alpha/beta mononucleoti 91.28
1yrb_A262 ATP(GTP)binding protein; GTPase, P-loop, rossman f 91.26
2grj_A192 Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp 91.24
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 91.21
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 91.17
2aka_B299 Dynamin-1; fusion protein, GTPase domain, myosin, 91.14
2gf0_A199 GTP-binding protein DI-RAS1; GDP/GTP binding, GTP 91.13
2a9k_A187 RAS-related protein RAL-A; bacterial ADP-ribosyltr 91.13
3qks_A203 DNA double-strand break repair RAD50 ATPase; RECA- 91.13
3tkl_A196 RAS-related protein RAB-1A; vesicle trafficking, p 91.12
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 91.11
3nwj_A250 ATSK2; P loop, shikimate, nucleoside monophosphate 91.11
1j8m_F297 SRP54, signal recognition 54 kDa protein; signalin 91.1
1mh1_A186 RAC1; GTP-binding, GTPase, small G-protein, RHO fa 91.08
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 91.07
1zj6_A187 ADP-ribosylation factor-like protein 5; ARL, GTP-b 91.06
2vp4_A230 Deoxynucleoside kinase; ATP-binding, DNA synthesis 91.03
1pui_A210 ENGB, probable GTP-binding protein ENGB; structura 91.02
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 91.01
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 91.0
2atv_A196 RERG, RAS-like estrogen-regulated growth inhibitor 90.98
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 90.91
3con_A190 GTPase NRAS; structural genomics consortium, SGC, 90.91
2gno_A 305 DNA polymerase III, gamma subunit-related protein; 90.91
1m7b_A184 RND3/RHOE small GTP-binding protein; small GTPase, 90.88
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 90.87
3lxx_A239 GTPase IMAP family member 4; structural genomics c 90.86
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 90.85
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 90.83
3t5g_A181 GTP-binding protein RHEB; immunoglobulin-like beta 90.83
1z06_A189 RAS-related protein RAB-33B; RAB GTPase, RAB33B GT 90.79
2ocp_A241 DGK, deoxyguanosine kinase; protein-nucleotide com 90.79
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 90.78
3cph_A213 RAS-related protein SEC4; RAB GTPase, prenylation, 90.78
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 90.76
1q3t_A236 Cytidylate kinase; nucleotide monophosphate kinase 90.75
2oil_A193 CATX-8, RAS-related protein RAB-25; G-protein, GDP 90.74
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 90.74
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 90.71
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 90.7
1ls1_A295 Signal recognition particle protein; FFH, SRP54, S 90.68
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 90.67
1zd9_A188 ADP-ribosylation factor-like 10B; transport protei 90.66
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 90.66
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl 90.65
2h17_A181 ADP-ribosylation factor-like protein 5A; GDP, GTPa 90.64
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 90.64
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 90.62
2fh5_B214 SR-beta, signal recognition particle receptor beta 90.62
1ksh_A186 ARF-like protein 2; small GTPase, small GTP-bindin 90.61
2x77_A189 ADP-ribosylation factor; GTP-binding protein, smal 90.58
4tmk_A213 Protein (thymidylate kinase); ATP:DTMP phosphotran 90.58
2iwr_A178 Centaurin gamma 1; ANK repeat, zinc-finger, GTP-bi 90.57
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 90.56
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 90.56
3dz8_A191 RAS-related protein RAB-3B; GDP, GTPase, structura 90.55
2wjy_A 800 Regulator of nonsense transcripts 1; nonsense medi 90.53
2bov_A206 RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, 90.52
2a5j_A191 RAS-related protein RAB-2B; GTPase, signal transdu 90.51
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 90.51
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 90.46
2gxq_A207 Heat resistant RNA dependent ATPase; RNA helicase, 90.41
2fg5_A192 RAB-22B, RAS-related protein RAB-31; G-protein, GT 90.4
2b6h_A192 ADP-ribosylation factor 5; membrane trafficking, G 90.35
3c5c_A187 RAS-like protein 12; GDP, GTPase, structural genom 90.35
1of1_A376 Thymidine kinase; transferase, antiviral drug, enz 90.33
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 90.3
1x3s_A195 RAS-related protein RAB-18; GTPase, GNP, structura 90.29
2p67_A341 LAO/AO transport system kinase; ARGK, structural G 90.28
1qde_A224 EIF4A, translation initiation factor 4A; DEAD box 90.26
2xxa_A433 Signal recognition particle protein; protein trans 90.26
2gf9_A189 RAS-related protein RAB-3D; G-protein, structural 90.25
3dkp_A245 Probable ATP-dependent RNA helicase DDX52; DEAD, A 90.2
4bas_A199 ADP-ribosylation factor, putative (small GTPase, p 90.2
2va8_A 715 SSO2462, SKI2-type helicase; hydrolase, DNA repair 90.19
2p5s_A199 RAS and EF-hand domain containing; G-protein, RAB, 90.18
2fz4_A237 DNA repair protein RAD25; RECA-like domain, DNA da 90.18
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 90.17
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 90.15
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 90.14
1e2k_A331 Thymidine kinase; transferase, antiviral drug, enz 90.12
2cjw_A192 GTP-binding protein GEM; nucleotide-binding, small 90.11
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 90.07
3lfu_A 647 DNA helicase II; SF1 helicase, ATP-binding, DNA da 90.05
1zbd_A203 Rabphilin-3A; G protein, effector, RABCDR, synapti 90.05
3lxw_A247 GTPase IMAP family member 1; immunity, structural 90.04
3l0o_A427 Transcription termination factor RHO; helicase, RH 90.02
2bcg_Y206 Protein YP2, GTP-binding protein YPT1; RABGTPase, 89.98
3lv8_A236 DTMP kinase, thymidylate kinase; structural genomi 89.96
2o52_A200 RAS-related protein RAB-4B; G-protein, GDP, struct 89.95
2qu8_A228 Putative nucleolar GTP-binding protein 1; GTPase, 89.9
3b6e_A216 Interferon-induced helicase C domain-containing P; 89.9
1gwn_A205 RHO-related GTP-binding protein RHOE; GTPase, inac 89.89
3reg_A194 RHO-like small GTPase; cytoskeleton, nucleotide-bi 89.88
3r20_A233 Cytidylate kinase; structural genomics, seattle st 89.83
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 89.82
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 89.81
3e2i_A219 Thymidine kinase; Zn-binding, ATP-binding, DNA syn 89.78
2xtp_A260 GTPase IMAP family member 2; immune system, G prot 89.75
3oes_A201 GTPase rhebl1; small GTPase, structural genomics, 89.73
3t34_A360 Dynamin-related protein 1A, linker, dynamin-relat 89.73
3pxi_A758 Negative regulator of genetic competence CLPC/MEC; 89.72
3t1o_A198 Gliding protein MGLA; G domain containing protein, 89.71
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 89.68
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 89.64
1sky_E473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 89.64
2ga8_A359 Hypothetical 39.9 kDa protein; YFR007W, YFH7, unkn 89.63
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 89.63
2q3h_A201 RAS homolog gene family, member U; GTPase, structu 89.6
3sr0_A206 Adenylate kinase; phosphoryl transfer analogue, AL 89.5
2oap_1511 GSPE-2, type II secretion system protein; hexameri 89.49
3tmk_A216 Thymidylate kinase; phosphotransferase; HET: T5A; 89.46
2r2a_A199 Uncharacterized protein; zonular occludens toxin, 89.43
2ew1_A201 RAS-related protein RAB-30; G-protein, GTP analogu 89.39
3llu_A196 RAS-related GTP-binding protein C; structural geno 89.39
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 89.38
2v6i_A 431 RNA helicase; membrane, hydrolase, transmembrane, 89.35
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 89.28
2il1_A192 RAB12; G-protein, GDP, GTPase, predicted, structur 89.26
2f7s_A217 C25KG, RAS-related protein RAB-27B; G-protein, str 89.24
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, 89.22
2h57_A190 ADP-ribosylation factor-like protein 6; GTP, GTPas 89.2
2h92_A219 Cytidylate kinase; rossmann fold, transferase; HET 89.19
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 89.1
2j1l_A214 RHO-related GTP-binding protein RHOD; GTPase, memb 89.09
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 89.05
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 89.01
3k53_A271 Ferrous iron transport protein B; GTPase fold, hel 88.99
2c61_A469 A-type ATP synthase non-catalytic subunit B; hydro 88.98
2fv8_A207 H6, RHO-related GTP-binding protein RHOB; GDP/GTP 88.97
2gco_A201 H9, RHO-related GTP-binding protein RHOC; GTPase,s 88.92
4dhe_A223 Probable GTP-binding protein ENGB; melioidosis, RA 88.88
3ake_A208 Cytidylate kinase; CMP kinase, CMP complex, open c 88.87
2fu5_C183 RAS-related protein RAB-8A; MSS4:RAB8 protein comp 88.8
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 88.8
1p5z_B263 DCK, deoxycytidine kinase; nucleoside kinase, P-lo 88.76
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 88.75
3ly5_A262 ATP-dependent RNA helicase DDX18; alpha-beta, stru 88.68
2xzl_A 802 ATP-dependent helicase NAM7; hydrolase-RNA complex 88.67
3iby_A256 Ferrous iron transport protein B; G protein, G dom 88.66
1qvr_A854 CLPB protein; coiled coil, AAA ATPase, chaperone; 88.6
3cbq_A195 GTP-binding protein REM 2; FLJ38964A, structural g 88.57
3q3j_B214 RHO-related GTP-binding protein RHO6; RAS-binding 88.55
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 88.53
2g3y_A211 GTP-binding protein GEM; small GTPase, GDP, inacti 88.52
2atx_A194 Small GTP binding protein TC10; GTPase, P-loop, al 88.52
2j0v_A212 RAC-like GTP-binding protein ARAC7; nucleotide-bin 88.46
3umf_A217 Adenylate kinase; rossmann fold, transferase; 2.05 88.39
1hv8_A367 Putative ATP-dependent RNA helicase MJ0669; RNA-bi 88.33
3ld9_A223 DTMP kinase, thymidylate kinase; ssgcid, NIH, niai 88.3
2hup_A201 RAS-related protein RAB-43; G-protein, GDP, struct 88.28
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 88.28
3pey_A395 ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A 88.27
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 88.14
2pl3_A236 Probable ATP-dependent RNA helicase DDX10; DEAD, s 88.1
1g41_A444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 88.08
1osn_A341 Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, tra 88.02
4dkx_A216 RAS-related protein RAB-6A; GTP binding fold, memb 87.98
1knx_A312 Probable HPR(Ser) kinase/phosphatase; HPR kinase, 87.98
2z0m_A337 337AA long hypothetical ATP-dependent RNA helicase 87.96
1vec_A206 ATP-dependent RNA helicase P54; DEAD-box protein, 87.94
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2. 87.89
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 87.82
3gqb_B464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 87.69
3cpj_B223 GTP-binding protein YPT31/YPT8; RAB GTPase, prenyl 87.54
2zpa_A 671 Uncharacterized protein YPFI; RNA modification enz 87.53
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 87.53
2p6r_A 702 Afuhel308 helicase; protein-DNA complex, SF2 helic 87.51
3vr4_D465 V-type sodium ATPase subunit D; V-ATPase, rotary m 87.49
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
Probab=98.87  E-value=1.1e-07  Score=90.56  Aligned_cols=211  Identities=12%  Similarity=0.078  Sum_probs=116.1

Q ss_pred             ech-hHHHHHHHHHhccCCCCCCCeEEEEccCCCcHHHHHHHHHHHHHhC------CeEEEEeCCccccccCCcceeccC
Q psy3261          46 IRN-CMLELVGYLKSMTNFDRPSPRFVLYGEHGVGKSMALVYALQYAHEN------NYLLVHIPWVLRWFAYPKEVSHSL  118 (342)
Q Consensus        46 vR~-~t~el~~~l~~~~~~~~~~~r~vL~G~~GsGKS~~L~q~~~~A~~~------gwiVl~vP~~~~~~~~~~~~~~s~  118 (342)
                      -|+ ...+|.+.++. .-.......++|+|++|||||+++..+.......      ++.++++.....            
T Consensus        23 gr~~~~~~l~~~l~~-~~~~~~~~~vll~G~~G~GKT~l~~~~~~~~~~~~~~~~~~~~~~~i~~~~~------------   89 (387)
T 2v1u_A           23 HREAELRRLAEVLAP-ALRGEKPSNALLYGLTGTGKTAVARLVLRRLEARASSLGVLVKPIYVNARHR------------   89 (387)
T ss_dssp             TCHHHHHHHHHTTGG-GTSSCCCCCEEECBCTTSSHHHHHHHHHHHHHHHHHHHTCCEEEEEEETTTS------------
T ss_pred             CHHHHHHHHHHHHHH-HHcCCCCCcEEEECCCCCCHHHHHHHHHHHHHHHHhccCCCeEEEEEECCcC------------
Confidence            365 33444555555 3223456789999999999999999888876554      788887732211            


Q ss_pred             CCCCccccHHHHHHHHHHHHHhCccccCCCCcccccceecCCCCCCCCCCCHHHHHHhhcccccchhHHHHHHHHHHhcc
Q psy3261         119 TKEGMVDLNIDAAMWLRHFQKQNTKWLEDPRLTTSQEYVWSPREKSEANIPLAALIEHGITRVKYASDVVDVLFTEIKKL  198 (342)
Q Consensus       119 ~~~~~~~qP~~a~~~L~~~~~~N~~~L~~~~l~~s~~~~~~~~e~~~~g~tL~dlv~~gi~~~~~a~~~~~~l~~EL~~~  198 (342)
                           .........++..+        .   ...           ...|.+..              ..+..+.+.+.. 
T Consensus        90 -----~~~~~~~~~l~~~l--------~---~~~-----------~~~~~~~~--------------~~~~~l~~~l~~-  127 (387)
T 2v1u_A           90 -----ETPYRVASAIAEAV--------G---VRV-----------PFTGLSVG--------------EVYERLVKRLSR-  127 (387)
T ss_dssp             -----CSHHHHHHHHHHHH--------S---CCC-----------CSSCCCHH--------------HHHHHHHHHHTT-
T ss_pred             -----CCHHHHHHHHHHHh--------C---CCC-----------CCCCCCHH--------------HHHHHHHHHHhc-
Confidence                 00011223333333        1   100           01122222              234445555543 


Q ss_pred             ccCCCceEEEEEeCccccccCC-CcCCCCCCCcccCCccchHHHHHHhhcCC--CCCeEEEEEeCCCCCCCCCccCcchh
Q psy3261         199 STEGVCRTFVCVDGYNSFFAEK-TNCKPEDKSKVLPSRVTLTRSVINLVQSD--WNNGAIVLALSPRANLPDRRESHLPL  275 (342)
Q Consensus       199 ~~~~~~pVLvavD~~n~~~~~s-~~y~~~~~~~I~~~~l~l~~~~~~~~~~~--~~~G~vv~AtS~~~~~~~~~~~~~p~  275 (342)
                         ...|++|.|||+..+.... .              ..+...+++.....  -.+..+|++++... ...    .+..
T Consensus       128 ---~~~~~vlilDEi~~l~~~~~~--------------~~~l~~l~~~~~~~~~~~~~~~I~~t~~~~-~~~----~l~~  185 (387)
T 2v1u_A          128 ---LRGIYIIVLDEIDFLPKRPGG--------------QDLLYRITRINQELGDRVWVSLVGITNSLG-FVE----NLEP  185 (387)
T ss_dssp             ---SCSEEEEEEETTTHHHHSTTH--------------HHHHHHHHHGGGCC-----CEEEEECSCST-TSS----SSCH
T ss_pred             ---cCCeEEEEEccHhhhcccCCC--------------ChHHHhHhhchhhcCCCceEEEEEEECCCc-hHh----hhCH
Confidence               2569999999998775431 1              23333334433321  22334555554331 111    1222


Q ss_pred             HHhhhcCCCCCCCcceeecCCCCHHHHHHHHHHHHhCC----CccCcchHHHHHHhhC---CCHHHHhhhcc
Q psy3261         276 YMLKKAGFESIDPFVPIHVPELNDEEFHNLLNLYESKK----WLQTSEGREEIAFLTK---RVPQKMYEFCS  340 (342)
Q Consensus       276 ~llg~~g~~~~dP~~~i~v~~~s~~E~~~ll~yy~~~~----~l~~e~~~~el~~lSg---GNP~~l~~lc~  340 (342)
                      .+..+.+.      ..+.++.|+.+|...++......+    .+ +++....+.-.++   |||+.+.++|.
T Consensus       186 ~l~~r~~~------~~i~l~~l~~~~~~~il~~~~~~~~~~~~~-~~~~~~~l~~~~~~~~G~~r~~~~~l~  250 (387)
T 2v1u_A          186 RVKSSLGE------VELVFPPYTAPQLRDILETRAEEAFNPGVL-DPDVVPLCAALAAREHGDARRALDLLR  250 (387)
T ss_dssp             HHHTTTTS------EECCBCCCCHHHHHHHHHHHHHHHBCTTTB-CSSHHHHHHHHHHSSSCCHHHHHHHHH
T ss_pred             HHHhcCCC------eEEeeCCCCHHHHHHHHHHHHHhhccCCCC-CHHHHHHHHHHHHHhccCHHHHHHHHH
Confidence            33332111      247899999999999998876542    22 4555556777888   99999888763



>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* Back     alignment and structure
>2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* Back     alignment and structure
>2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} Back     alignment and structure
>3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* Back     alignment and structure
>1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A Back     alignment and structure
>2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} Back     alignment and structure
>1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} Back     alignment and structure
>1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 Back     alignment and structure
>3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} Back     alignment and structure
>3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 Back     alignment and structure
>2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A Back     alignment and structure
>2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} Back     alignment and structure
>1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* Back     alignment and structure
>3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A Back     alignment and structure
>1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* Back     alignment and structure
>1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A Back     alignment and structure
>3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} Back     alignment and structure
>2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* Back     alignment and structure
>1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* Back     alignment and structure
>1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 Back     alignment and structure
>2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* Back     alignment and structure
>2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Back     alignment and structure
>1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* Back     alignment and structure
>1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A Back     alignment and structure
>2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} Back     alignment and structure
>3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} Back     alignment and structure
>1z2a_A RAS-related protein RAB-23; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 1.90A {Mus musculus} SCOP: c.37.1.8 PDB: 1z22_A* Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>1ky3_A GTP-binding protein YPT7P; vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase, endocytosis/exocytosis complex; HET: GDP; 1.35A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ky2_A* Back     alignment and structure
>1u8z_A RAS-related protein RAL-A; GNP, GTP, GMPPNP, GPPNHP, GDP, GTPase, signaling protein; HET: GDP; 1.50A {Saguinus oedipus} SCOP: c.37.1.8 PDB: 1u8y_A* 1u90_A* 1uad_A* 1zc3_A* 1zc4_A* 2kwi_A* 2ke5_A* Back     alignment and structure
>2dyk_A GTP-binding protein; GTPase, ribosome-binding protein, structural genomics; HET: GDP; 1.96A {Thermus thermophilus} Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>1fzq_A ADP-ribosylation factor-like protein 3; protein-GDP complex without magnesium, ARF family, RAS superfamily, G-domain, signaling protein; HET: MES GDP; 1.70A {Mus musculus} SCOP: c.37.1.8 PDB: 3bh7_A* 3bh6_A* Back     alignment and structure
>2erx_A GTP-binding protein DI-RAS2; GTP hydrolysis, transport protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>2lkc_A Translation initiation factor IF-2; NMR {Geobacillus stearothermophilus} PDB: 2lkd_A* Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2f9l_A RAB11B, member RAS oncogene family; RAB11B GTPase, vesicle transport, hydrolase; HET: GDP; 1.55A {Homo sapiens} SCOP: c.37.1.8 PDB: 2f9m_A* 1yzk_A* 2hv8_A* 2gzd_A* 2gzh_A* 2d7c_A* 3bfk_A* Back     alignment and structure
>2ce2_X GTPase HRAS; signaling protein, guanine nucleotide binding protein, fluor membrane, lipoprotein, palmitate, prenylation; HET: GDP XY2; 1.0A {Homo sapiens} PDB: 2cl0_X* 2cl6_X* 2cl7_X* 2clc_X* 2evw_X* 2cld_X* 1aa9_A* 1ioz_A* 1q21_A* 6q21_A* 3k9l_A* 3k9n_A* 1ctq_A* 1bkd_R 1crp_A* 1crq_A* 1crr_A* 121p_A* 1gnp_A* 1gnq_A* ... Back     alignment and structure
>2nzj_A GTP-binding protein REM 1; GDP/GTP binding, GTP hydrolysis, RAD and GEM like GTP protein 1, structural genomics; HET: GDP; 2.50A {Homo sapiens} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1svi_A GTP-binding protein YSXC; ENGB, GTPase, GDP, hydrolase; HET: GDP; 1.95A {Bacillus subtilis} SCOP: c.37.1.8 PDB: 1sul_A* 1svw_A* Back     alignment and structure
>1kao_A RAP2A; GTP-binding protein, small G protein, GDP, RAS; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2rap_A* 3rap_R* Back     alignment and structure
>3pqc_A Probable GTP-binding protein ENGB; rossmann fold, GTPase, cell cycle, hydrolase; HET: GDP; 1.90A {Thermotoga maritima} PDB: 3pr1_A Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>1ek0_A Protein (GTP-binding protein YPT51); vesicular traffic, GTP hydrolysis, YPT/RAB protein, endocytosis, hydrolase; HET: MHO GNP GDP; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2gj8_A MNME, tRNA modification GTPase TRME; G-domain dimer, alpha-beta-sandwich, hydrolase; HET: GDP; 1.70A {Escherichia coli BL21} SCOP: c.37.1.8 PDB: 2gj9_A* 2gja_A* 1rfl_A Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1upt_A ARL1, ADP-ribosylation factor-like protein 1; hydrolase/protein-binding, complex (GTPase/golgin), golgin-245, GRIP, golgin, GTPase, G-protein; HET: GTP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1r4a_A* Back     alignment and structure
>2zej_A Dardarin, leucine-rich repeat kinase 2; parkinson'S disease, LRRK2, ROC, GTPase, ROCO, ATP-B disease mutation, GTP-binding, GTPase activation; HET: GDP; 2.00A {Homo sapiens} PDB: 3d6t_B* Back     alignment and structure
>1m2o_B GTP-binding protein SAR1, GTP binding protein; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 2qtv_B* Back     alignment and structure
>1moz_A ARL1, ADP-ribosylation factor-like protein 1; GTP-binding, protein binding; HET: GDP; 3.17A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1z08_A RAS-related protein RAB-21; RAB GTPase, vesicular trafficking, protein transport; HET: GNP; 1.80A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ot3_B 1yzu_A* 1z0i_A 1yzt_A* Back     alignment and structure
>2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Back     alignment and structure
>1jr3_D DNA polymerase III, delta subunit; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1jqj_C* 1xxh_A* 1xxi_A* 3glf_A* 3glg_A* 3glh_A* 3gli_A* Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>1wms_A RAB-9, RAB9, RAS-related protein RAB-9A; GTPase, protein transport; HET: GDP; 1.25A {Homo sapiens} SCOP: c.37.1.8 PDB: 1s8f_A* 1yzl_A* 2ocb_A* Back     alignment and structure
>1nrj_B SR-beta, signal recognition particle receptor beta subunit; transmembrane, endoplasmic reticulum, GTP-binding; HET: GTP; 1.70A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2fn4_A P23, RAS-related protein R-RAS; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 1.65A {Homo sapiens} SCOP: c.37.1.8 PDB: 2ery_A* Back     alignment and structure
>4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} Back     alignment and structure
>2wji_A Ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GNP; 1.90A {Methanocaldococcus jannaschii} PDB: 2wjj_A* 2wjh_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* Back     alignment and structure
>3q72_A GTP-binding protein RAD; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.66A {Homo sapiens} SCOP: c.37.1.8 PDB: 3q7p_A* 3q7q_A* 2gjs_A* 2dpx_A* Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>1z0j_A RAB-22, RAS-related protein RAB-22A; RAB GTPase, RAB22 GTPase, rabenosyn, endosomal trafficking; HET: GTP; 1.32A {Mus musculus} SCOP: c.37.1.8 PDB: 1yvd_A* Back     alignment and structure
>1g16_A RAS-related protein SEC4; G protein RAB, signaling protein, endocytosis/exocytosis complex; HET: GDP; 1.80A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1g17_A* 2ocy_C 2eqb_A Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>2wjg_A FEOB, ferrous iron transport protein B homolog; membrane G-proteins, cell membrane, ION transport, transmembrane; HET: GDP; 2.20A {Methanocaldococcus jannaschii} Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>2bme_A RAB4A, RAS-related protein RAB4A; GTP-binding protein, vesicular transport, endocytosis, prenylation, protein transport, transport; HET: GNP; 1.57A {Homo sapiens} SCOP: c.37.1.8 PDB: 2bmd_A* 1yu9_A* 1z0k_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1vg8_A RAS-related protein RAB-7; GTP-binding protein, protein transport; HET: GNP; 1.70A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 1vg0_B* 3law_A* 1t91_A* 1yhn_A* 1vg1_A* 1vg9_B* Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>4dsu_A GTPase KRAS, isoform 2B; small G-protein, signaling, hydrolase; HET: GDP; 1.70A {Homo sapiens} PDB: 4dsn_A* 4dst_A* 4dso_A* Back     alignment and structure
>1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* Back     alignment and structure
>1f6b_A SAR1; gtpases, N-terminal helix, Mg-containing complex, protein transport; HET: GDP; 1.70A {Cricetulus griseus} SCOP: c.37.1.8 PDB: 2fmx_A* 2fa9_A* 2gao_A* Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>3ihw_A Centg3; RAS, centaurin, GTPase, structural genomics, structural genomics consortium, SGC, alternative splicing, ANK repeat, cytoplasm, GTP-binding; 1.92A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>3q85_A GTP-binding protein REM 2; G-domain, CAV2 beta, signaling protein; HET: GNP; 1.76A {Mus musculus} SCOP: c.37.1.8 PDB: 4aii_A* Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2y8e_A RAB-protein 6, GH09086P, RAB6; hydrolase, nucleotide binding, GTP binding; HET: GNP; 1.39A {Drosophila melanogaster} PDB: 3cwz_A* 1yzq_A* 2gil_A* 2e9s_A* 2fe4_A* 2ffq_A* 1d5c_A* Back     alignment and structure
>3tw8_B RAS-related protein RAB-35; longin domain, RAB GTPase, guanine exchange factor; 2.10A {Homo sapiens} Back     alignment and structure
>3clv_A RAB5 protein, putative; malaria, GTPase, structural genomics, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>1r2q_A RAS-related protein RAB-5A; GTPase, GNP, atomic resolution, protein transport; HET: GNP; 1.05A {Homo sapiens} SCOP: c.37.1.8 PDB: 1n6h_A* 1tu4_A* 1tu3_A* 1n6k_A* 1n6i_A* 1n6l_A* 1n6o_A* 1n6p_A* 1n6n_A* 1n6r_A* 3mjh_A* 1z0d_A* 1huq_A* 2hei_A* 1z07_A* Back     alignment and structure
>1z0f_A RAB14, member RAS oncogene family; RAB GTPase, vesicular trafficking, protein transport; HET: GDP; 2.15A {Homo sapiens} SCOP: c.37.1.8 PDB: 2aed_A* 4drz_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3kkq_A RAS-related protein M-RAS; GTP-binding, GTPase, signaling protein; HET: GDP; 1.20A {Mus musculus} SCOP: c.37.1.8 PDB: 3kkp_A* 3kko_A* 3pit_A* 3pir_A* 1x1r_A* 1x1s_A* Back     alignment and structure
>1c1y_A RAS-related protein RAP-1A; GTP-binding proteins, protein-protein complex, effectors, signaling protein; HET: GTP; 1.90A {Homo sapiens} SCOP: c.37.1.8 PDB: 3kuc_A* 1gua_A* 3cf6_R* 3brw_D* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>1r8s_A ADP-ribosylation factor 1; protein transport/exchange factor, protein transport-exchang complex; HET: GDP; 1.46A {Bos taurus} SCOP: c.37.1.8 PDB: 1re0_A* 1s9d_A* 1u81_A* 1r8q_A* 1rrf_A* 1rrg_A* 1hur_A* 1o3y_A* 1j2j_A* 2j59_A* 1mr3_F* 2k5u_A* 3lrp_A* 3tjz_A* 3rd1_A* 2ksq_A* 2a5d_A* 2a5f_A* 2j5x_A* 1e0s_A* ... Back     alignment and structure
>3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3bwd_D RAC-like GTP-binding protein ARAC6; G domain, cytoplasm, lipoprotein, membrane, methylation, nucleotide-binding, prenylation, ----; HET: GDP; 1.53A {Arabidopsis thaliana} PDB: 2nty_C* 2wbl_C Back     alignment and structure
>1jwy_B Dynamin A GTPase domain; dynamin, GTPase, GDP, myosin, fusion-protein, hydrolase; HET: BGC ADP GDP; 2.30A {Dictyostelium discoideum} SCOP: c.37.1.8 PDB: 1jx2_B* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>2cxx_A Probable GTP-binding protein ENGB; structural genomics, NPPSFA, national P protein structural and functional analyses; HET: GDP; 1.70A {Pyrococcus horikoshii} SCOP: c.37.1.8 Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>3bc1_A RAS-related protein RAB-27A; RAB27, GTPase, RAB, signaling protein, GDPNP, SLP2A, exophil GTP-binding, lipoprotein, membrane, methylation; HET: GNP; 1.80A {Mus musculus} PDB: 2iey_A* 2if0_A* 2zet_A* Back     alignment and structure
>3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>2hxs_A RAB-26, RAS-related protein RAB-28; GTPase, signaling protein; HET: G3D; 1.10A {Homo sapiens} PDB: 2hy4_A* 3e5h_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>2efe_B Small GTP-binding protein-like; GEF, GTPase, VPS9, nucleotide, transport protein; HET: GNH; 2.08A {Arabidopsis thaliana} PDB: 2efd_B 2efc_B* 2efh_B* Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2g6b_A RAS-related protein RAB-26; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, unknown function; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1uj2_A Uridine-cytidine kinase 2; alpha/beta mononucleotide-binding HOLD, transferase; HET: C5P ADP; 1.80A {Homo sapiens} SCOP: c.37.1.6 PDB: 1uei_A* 1uej_A* 1udw_A 1ufq_A* 1xrj_A* Back     alignment and structure
>1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* Back     alignment and structure
>2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>2aka_B Dynamin-1; fusion protein, GTPase domain, myosin, contractIle protein; 1.90A {Rattus norvegicus} SCOP: c.37.1.8 PDB: 3l43_A* Back     alignment and structure
>2gf0_A GTP-binding protein DI-RAS1; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC, transport protein; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2a9k_A RAS-related protein RAL-A; bacterial ADP-ribosyltransferase, RAL, RHO, GD binding; HET: GDP NAD; 1.73A {Homo sapiens} SCOP: c.37.1.8 PDB: 2a78_A* Back     alignment and structure
>3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* Back     alignment and structure
>3tkl_A RAS-related protein RAB-1A; vesicle trafficking, protein transport-protein binding compl; HET: GTP; 2.18A {Homo sapiens} Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>1mh1_A RAC1; GTP-binding, GTPase, small G-protein, RHO family, RAS super family; HET: GNP; 1.38A {Homo sapiens} SCOP: c.37.1.8 PDB: 1hh4_A* 2p2l_A* 2h7v_A* 1g4u_R* 1i4d_D* 1i4l_D* 2vrw_A 1e96_A* 1i4t_D* 2rmk_A* 2yin_C 1ryf_A* 1ryh_A* 3su8_A* 3sua_A* 2fju_A* 1he1_C* 2nz8_A 1foe_B 3bji_C ... Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>1zj6_A ADP-ribosylation factor-like protein 5; ARL, GTP-binding, transport protein; HET: G3D; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2vp4_A Deoxynucleoside kinase; ATP-binding, DNA synthesis, phosphoprotein, feedback inhibition, deoxyribonucleoside kinase, salvage pathway; HET: DCP; 2.20A {Drosophila melanogaster} SCOP: c.37.1.1 PDB: 1j90_A* 2jj8_A* 2vp2_A* 1oe0_A* 2vp5_A* 2vp6_A* 2vp9_A* 2vpp_A* 2vqs_A* 2vp0_A* 1ot3_A* 2jcs_A* 1zm7_A* 1zmx_A* Back     alignment and structure
>1pui_A ENGB, probable GTP-binding protein ENGB; structural genomics, nysgxrc T16, GTPase, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.37.1.8 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2atv_A RERG, RAS-like estrogen-regulated growth inhibitor; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3con_A GTPase NRAS; structural genomics consortium, SGC, GDP, oncogene, disease mutation, golgi apparatus, GTP-binding, lipoprotein membrane, methylation; HET: GDP; 1.65A {Homo sapiens} PDB: 2pmx_A* 3gft_A* 4q21_A* Back     alignment and structure
>2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1m7b_A RND3/RHOE small GTP-binding protein; small GTPase, signaling protein; HET: GTP; 2.00A {Homo sapiens} SCOP: c.37.1.8 PDB: 2v55_B* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>3t5g_A GTP-binding protein RHEB; immunoglobulin-like beta sandwitch, PDE delta, RHEB; HET: GDP FAR; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 1xtq_A* 1xtr_A* 1xts_A* 2l0x_A* 3sea_A* Back     alignment and structure
>1z06_A RAS-related protein RAB-33B; RAB GTPase, RAB33B GTPase, vesicular trafficking, protein transport; HET: GNP; 1.81A {Mus musculus} SCOP: c.37.1.8 PDB: 2g77_B* Back     alignment and structure
>2ocp_A DGK, deoxyguanosine kinase; protein-nucleotide complex, transferase; HET: DTP; 2.80A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>3cph_A RAS-related protein SEC4; RAB GTPase, prenylation, vesicular transport, cytoplasm, cytoplasmic vesicle, exocytosis, GTP-binding; HET: GDP; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.8 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1q3t_A Cytidylate kinase; nucleotide monophosphate kinase, CMP kinase, transferase; NMR {Streptococcus pneumoniae} SCOP: c.37.1.1 Back     alignment and structure
>2oil_A CATX-8, RAS-related protein RAB-25; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.30A {Homo sapiens} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>1zd9_A ADP-ribosylation factor-like 10B; transport protein, GDP-binding, membrane trafficking, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2al7_A* 2h18_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>2h17_A ADP-ribosylation factor-like protein 5A; GDP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GDP; 1.70A {Homo sapiens} PDB: 2h16_A* 1z6y_A* 1yzg_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2fh5_B SR-beta, signal recognition particle receptor beta subunit; endomembrane targeting, GTPase, GAP, longin domain, SEDL, transport protein; HET: GTP; 2.45A {Mus musculus} SCOP: c.37.1.8 PDB: 2go5_2 Back     alignment and structure
>1ksh_A ARF-like protein 2; small GTPase, small GTP-binding protein, ARF family; HET: CME GDP; 1.80A {Mus musculus} SCOP: c.37.1.8 PDB: 1ksg_A* 1ksj_A* 3doe_A* 3dof_A* Back     alignment and structure
>2x77_A ADP-ribosylation factor; GTP-binding protein, small GTPase, nucleotide-binding; HET: GDP; 2.10A {Leishmania major} Back     alignment and structure
>4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* Back     alignment and structure
>2iwr_A Centaurin gamma 1; ANK repeat, zinc-finger, GTP-binding, polymorphism, nucleotide-binding, alternative splicing, protein transport; HET: CAF; 1.5A {Homo sapiens} PDB: 2bmj_A Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>3dz8_A RAS-related protein RAB-3B; GDP, GTPase, structural genomics consortium, SGC, cell GTP-binding, lipoprotein, membrane, methylation; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A Back     alignment and structure
>2bov_A RAla, RAS-related protein RAL-A; C3BOT, exoenzyme, RAla, GTPase, ribosylating toxin, GTP-binding, lipoprotein, prenylation; HET: GDP; 2.66A {Homo sapiens} Back     alignment and structure
>2a5j_A RAS-related protein RAB-2B; GTPase, signal transduction, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.50A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z0a_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Back     alignment and structure
>2fg5_A RAB-22B, RAS-related protein RAB-31; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.80A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>3c5c_A RAS-like protein 12; GDP, GTPase, structural genomics consortium, SGC, limited proteolysis, GTP-binding, nucleotide-binding, signaling protein; HET: GDP; 1.85A {Homo sapiens} Back     alignment and structure
>1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>1x3s_A RAS-related protein RAB-18; GTPase, GNP, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GNP; 1.32A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>2gf9_A RAS-related protein RAB-3D; G-protein, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 1.53A {Homo sapiens} PDB: 3rab_A* Back     alignment and structure
>3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Back     alignment and structure
>4bas_A ADP-ribosylation factor, putative (small GTPase, putative); hydrolase; HET: GNP; 2.00A {Trypanosoma brucei TREU927} Back     alignment and structure
>2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2p5s_A RAS and EF-hand domain containing; G-protein, RAB, GDP, structural genomics, SGC, structural genomics consortium, signaling protein; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1e2k_A Thymidine kinase; transferase, antiviral drug, enzyme-prodrug gene therapy, sugar ring pucker; HET: TMC; 1.7A {Herpes simplex virus} SCOP: c.37.1.1 PDB: 1e2i_A* 1e2h_A* 1e2m_A* 1e2n_A* 1e2p_A* 1ki2_A* 1ki3_A* 1ki4_A* 1ki6_B* 1ki7_A* 1ki8_A* 3rdp_A* 2ki5_A* 1kim_A* 1qhi_A* 1p7c_A* 1vtk_A* 2vtk_A* 3vtk_A* 3f0t_A* ... Back     alignment and structure
>2cjw_A GTP-binding protein GEM; nucleotide-binding, small GTPase, conformational change, cysteine-modified, G-protein hydrolase; HET: GDP; 2.10A {Homo sapiens} PDB: 2cjw_B* 2ht6_A* Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>1zbd_A Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: c.37.1.8 Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>2bcg_Y Protein YP2, GTP-binding protein YPT1; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.37.1.8 PDB: 1ukv_Y* 3cue_F* 1yzn_A* 3sfv_A* 2wwx_A 2fol_A* 3nkv_A* 3jza_A* 2rhd_A* Back     alignment and structure
>3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* Back     alignment and structure
>2o52_A RAS-related protein RAB-4B; G-protein, GDP, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.20A {Homo sapiens} Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Back     alignment and structure
>1gwn_A RHO-related GTP-binding protein RHOE; GTPase, inactive GTPase, signal transduction; HET: GTP; 2.1A {Mus musculus} SCOP: c.37.1.8 Back     alignment and structure
>3reg_A RHO-like small GTPase; cytoskeleton, nucleotide-binding, GTP-binding, signaling Pro lipoprotein, prenylation; HET: GSP; 1.80A {Entamoeba histolytica} PDB: 3ref_B* 4dvg_A* Back     alignment and structure
>3r20_A Cytidylate kinase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ADP, DCMP, D transferase; 2.00A {Mycobacterium smegmatis} SCOP: c.37.1.0 PDB: 3r8c_A 4die_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Back     alignment and structure
>2xtp_A GTPase IMAP family member 2; immune system, G protein; HET: MSE; 1.50A {Homo sapiens} PDB: 2xto_A* 2xtm_A* 2xtn_A* 3p1j_A Back     alignment and structure
>3oes_A GTPase rhebl1; small GTPase, structural genomics, structural genomics conso SGC, hydrolase; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3t1o_A Gliding protein MGLA; G domain containing protein, bacterial GTPase, bacterial POL motility, POLE localisation, alpha/beta protein; HET: GDP; 1.90A {Thermus thermophilus} PDB: 3t12_A* 3t1q_A* 3t1t_A* 3t1v_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>2ga8_A Hypothetical 39.9 kDa protein; YFR007W, YFH7, unknown function; HET: CME; 1.77A {Saccharomyces cerevisiae} PDB: 2gaa_A* Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>2q3h_A RAS homolog gene family, member U; GTPase, structural genomics, structural genomics consortium,; HET: GDP; 1.73A {Homo sapiens} Back     alignment and structure
>3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3tmk_A Thymidylate kinase; phosphotransferase; HET: T5A; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 2tmk_A* 1tmk_A* Back     alignment and structure
>2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} Back     alignment and structure
>2ew1_A RAS-related protein RAB-30; G-protein, GTP analogue, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GNP; 2.00A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>3llu_A RAS-related GTP-binding protein C; structural genomics consortium, SGC, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; HET: GNP; 1.40A {Homo sapiens} PDB: 2q3f_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2il1_A RAB12; G-protein, GDP, GTPase, predicted, structural genomics, structural genomics consortium, SGC, protein transport; HET: GDP; 2.10A {Homo sapiens} Back     alignment and structure
>2f7s_A C25KG, RAS-related protein RAB-27B; G-protein, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.70A {Homo sapiens} SCOP: c.37.1.8 PDB: 2iez_A* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2h57_A ADP-ribosylation factor-like protein 6; GTP, GTPase, membrane trafficking, structural genomics consortium, SGC, transport protein; HET: GTP; 2.00A {Homo sapiens} Back     alignment and structure
>2h92_A Cytidylate kinase; rossmann fold, transferase; HET: C5P PG4; 2.30A {Staphylococcus aureus} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>3k53_A Ferrous iron transport protein B; GTPase fold, helical bundle, G-protein, prokaryote, GTP-BIND nucleotide-binding, metal transport; 2.70A {Pyrococcus furiosus} Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>2fv8_A H6, RHO-related GTP-binding protein RHOB; GDP/GTP binding, GTP hydrolysis, structural genomics, structural genomics consortium, SGC; HET: GDP; 1.90A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2gco_A H9, RHO-related GTP-binding protein RHOC; GTPase,signaling protein, signaling Pro; HET: GNP; 1.40A {Homo sapiens} PDB: 2gcn_A* 2gcp_A* 1z2c_A* 1x86_B 2rgn_C* 1lb1_B 1s1c_A* 3kz1_E* 3lxr_A* 3lwn_A* 3lw8_A* 1cxz_A* 1a2b_A* 1ow3_B* 1ftn_A* 1cc0_A* 3msx_A* 1xcg_B 3t06_B 1tx4_B* ... Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>3ake_A Cytidylate kinase; CMP kinase, CMP complex, open conformation, nucleotide metab transferase; HET: C5P; 1.50A {Thermus thermophilus} PDB: 3akc_A* 3akd_A* Back     alignment and structure
>2fu5_C RAS-related protein RAB-8A; MSS4:RAB8 protein complex, GEF:GTPase nucleotide free complex; 2.00A {Mus musculus} SCOP: c.37.1.8 PDB: 3qbt_A* 3tnf_A* Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Back     alignment and structure
>2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3iby_A Ferrous iron transport protein B; G protein, G domain, iron uptake, cell inner membrane, cell GTP-binding, ION transport, membrane; 2.50A {Legionella pneumophila} Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3cbq_A GTP-binding protein REM 2; FLJ38964A, structural genomics consortium, SGC, GDP, membrane, nucleotide-binding, nucleotide binding protein; HET: GDP; 1.82A {Homo sapiens} Back     alignment and structure
>3q3j_B RHO-related GTP-binding protein RHO6; RAS-binding domain, plexin, small GTPase, structural genomic consortium, SGC; HET: GNP; 1.97A {Homo sapiens} PDB: 2rex_B* 2cls_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2atx_A Small GTP binding protein TC10; GTPase, P-loop, alpha-beta, hydrolase; HET: GNP; 2.65A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2j0v_A RAC-like GTP-binding protein ARAC7; nucleotide-binding protein, ROP9, atrac7, membrane, palmitate, RHO GTPase; HET: GDP; 1.78A {Arabidopsis thaliana} Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>1osn_A Thymidine kinase, VZV-TK; chickenpox, BVDU-MP, transferase; HET: BVP ADP; 3.20A {Human herpesvirus 3} SCOP: c.37.1.1 Back     alignment and structure
>4dkx_A RAS-related protein RAB-6A; GTP binding fold, membrane trafficking, GTP, cytosol, protei transport; HET: GDP; 1.90A {Homo sapiens} PDB: 3bbp_A* Back     alignment and structure
>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Back     alignment and structure
>1a7j_A Phosphoribulokinase; transferase, calvin cycle; 2.50A {Rhodobacter sphaeroides} SCOP: c.37.1.6 Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>3cpj_B GTP-binding protein YPT31/YPT8; RAB GTPase, prenylation, vesicular transport, acetylation, golgi apparatus, lipoprotein, membrane; HET: GDP; 2.35A {Saccharomyces cerevisiae} Back     alignment and structure
>2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query342
d2fnaa2283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 99.05
d1lv7a_256 AAA domain of cell division protein FtsH {Escheric 98.65
d1ixza_247 AAA domain of cell division protein FtsH {Thermus 98.6
d1fnna2276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 98.33
d1e32a2258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.29
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 98.23
d1sxje2252 Replication factor C5 {Baker's yeast (Saccharomyce 98.18
d2a5yb3277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 98.16
d1njfa_239 delta prime subunit of DNA polymerase III, N-domai 97.94
d1a5ta2207 delta prime subunit of DNA polymerase III, N-domai 97.8
d1iqpa2231 Replication factor C {Archaeon Pyrococcus furiosus 97.73
d1sxjb2224 Replication factor C4 {Baker's yeast (Saccharomyce 97.65
d1sxjc2227 Replication factor C3 {Baker's yeast (Saccharomyce 97.63
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 97.52
d1r6bx2268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 97.47
d1sxjd2237 Replication factor C2 {Baker's yeast (Saccharomyce 97.47
d1sxja2253 Replication factor C1 {Baker's yeast (Saccharomyce 97.44
d2i3ba1189 Cancer-related NTPase, C1orf57 {Human (Homo sapien 97.34
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis pr 97.05
d1d2na_246 Hexamerization domain of N-ethylmalemide-sensitive 96.87
d1tf7a2242 Circadian clock protein KaiC {Synechococcus sp. st 96.81
d1in4a2238 Holliday junction helicase RuvB {Thermotoga mariti 96.78
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 96.78
d1xp8a1268 RecA protein, ATPase-domain {Deinococcus radiodura 96.73
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 96.7
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 96.64
d1tf7a1242 Circadian clock protein KaiC {Synechococcus sp. st 96.62
d1ixsb2239 Holliday junction helicase RuvB {Thermus thermophi 96.53
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 96.1
d1y63a_174 Probable kinase LmjF30.1890 {Leishmania major [Tax 96.03
d1n0wa_242 DNA repair protein Rad51, catalytic domain {Human 96.03
d1xjca_165 Molybdopterin-guanine dinucleotide biosynthesis pr 95.98
d1ak2a1190 Adenylate kinase {Cow (Bos taurus), mitochondrial 95.95
d1ly1a_152 Polynucleotide kinase, kinase domain {Bacteriophag 95.93
d1rkba_173 Adenylate kinase {Human (Homo sapiens), isoenzyme 95.9
d1rz3a_198 Hypothetical protein rbstp0775 {Bacillus stearothe 95.89
d1cr2a_277 Gene 4 protein (g4p, DNA primase), helicase domain 95.86
d1lw7a2192 Transcriptional regulator NadR, ribosylnicotinamid 95.84
d1khta_190 Adenylate kinase {Archaeon Methanococcus voltae [T 95.79
d1u94a1263 RecA protein, ATPase-domain {Escherichia coli [Tax 95.77
d1kaga_169 Shikimate kinase (AroK) {Escherichia coli [TaxId: 95.74
d1okkd2207 GTPase domain of the signal recognition particle r 95.7
d1vmaa2213 GTPase domain of the signal recognition particle r 95.62
d1ls1a2207 GTPase domain of the signal sequence recognition p 95.59
d1qf9a_194 UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 95.57
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefa 95.57
d1yj5a2172 5' polynucleotide kinase-3' phosphatase, C-termina 95.56
d2eyqa3233 Transcription-repair coupling factor, TRCF {Escher 95.56
d2qm8a1323 Metallochaperone MeaB {Methylobacterium extorquens 95.55
d1yrba1244 ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss 95.55
d2p67a1327 LAO/AO transport system kinase ArgK {Escherichia c 95.54
d2bdta1176 Hypothetical protein BH3686 {Bacillus halodurans [ 95.54
d1yksa1140 YFV helicase domain {Yellow fever virus [TaxId: 11 95.44
d1nksa_194 Adenylate kinase {Archaeon Sulfolobus acidocaldari 95.41
d3adka_194 Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} 95.34
d1zina1182 Adenylate kinase {Bacillus stearothermophilus [Tax 95.32
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 95.32
d2iyva1165 Shikimate kinase (AroK) {Mycobacterium tuberculosi 95.26
d1j8yf2211 GTPase domain of the signal sequence recognition p 95.22
d1f6ba_186 SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 95.2
d1akya1180 Adenylate kinase {Baker's yeast (Saccharomyces cer 95.15
d1r8sa_160 ADP-ribosylation factor {Human (Homo sapiens), ARF 95.07
d1zaka1189 Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} 95.04
d1mo6a1269 RecA protein, ATPase-domain {Mycobacterium tubercu 95.04
d1szpa2251 DNA repair protein Rad51, catalytic domain {Baker' 94.98
d1ukza_196 Uridylate kinase {Baker's yeast (Saccharomyces cer 94.95
d1ofha_309 HslU {Haemophilus influenzae [TaxId: 727]} 94.92
d1pzna2254 DNA repair protein Rad51, catalytic domain {Archae 94.88
d1zj6a1177 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.87
d1qhxa_178 Chloramphenicol phosphotransferase {Streptomyces v 94.84
d1fzqa_176 ADP-ribosylation factor {Mouse (Mus musculus), ARL 94.84
d2qy9a2211 GTPase domain of the signal recognition particle r 94.83
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus 94.83
d1s3ga1182 Adenylate kinase {Bacillus globisporus [TaxId: 145 94.74
d2i1qa2258 DNA repair protein Rad51, catalytic domain {Archae 94.7
d1teva_194 UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] 94.67
d1v5wa_258 Meiotic recombination protein DMC1/LIM15 homolog { 94.65
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 94.64
d1h65a_257 Chloroplast protein translocon GTPase Toc34 {Garde 94.63
d2cdna1181 Adenylate kinase {Mycobacterium tuberculosis [TaxI 94.54
d1svma_362 Papillomavirus large T antigen helicase domain {Si 94.53
d1gsia_208 Thymidylate kinase {Mycobacterium tuberculosis [Ta 94.45
d1upta_169 ADP-ribosylation factor {Human (Homo sapiens), ARL 94.44
d1xtqa1167 GTP-binding protein RheB {Human (Homo sapiens) [Ta 94.31
d2ak3a1189 Adenylate kinase {Cow (Bos taurus), mitochondrial 94.3
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [Tax 94.27
d1osna_331 Thymidine kinase {Varicella-zoster virus [TaxId: 1 94.2
d2qtvb1166 SAR1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 94.17
d1mh1a_183 Rac {Human (Homo sapiens) [TaxId: 9606]} 94.11
d1gm5a3264 RecG helicase domain {Thermotoga maritima [TaxId: 94.03
d1e4va1179 Adenylate kinase {Escherichia coli [TaxId: 562]} 93.97
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 93.8
d1m8pa3183 ATP sulfurylase C-terminal domain {Fungus (Penicil 93.78
d1z2aa1164 Rab23 {Mouse (Mus musculus) [TaxId: 10090]} 93.69
d2vp4a1197 Deoxyribonucleoside kinase {Fruit fly (Drosophila 93.66
d1tuea_205 Replication protein E1 helicase domain {Human papi 93.57
d1byia_224 Dethiobiotin synthetase {Escherichia coli [TaxId: 93.55
d1e6ca_170 Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax 93.52
d1p6xa_333 Thymidine kinase {Equine herpesvirus type 4 [TaxId 93.52
d1ksha_165 ADP-ribosylation factor {Mouse (Mus musculus), ARL 93.49
d1jbka_195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 93.47
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 93.47
d2gj8a1161 Probable tRNA modification GTPase TrmE (MnmE), G d 93.44
d1ky3a_175 Rab-related protein ypt7p {Baker's yeast (Saccharo 93.43
d1nlfa_274 Hexameric replicative helicase repA {Escherichia c 93.43
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Hu 93.38
d1nija1222 Hypothetical protein YjiA, N-terminal domain {Esch 93.33
d1zd9a1164 ADP-ribosylation factor {Human (Homo sapiens), ARL 93.29
d1gkub1237 Helicase-like "domain" of reverse gyrase {Archaeon 93.24
d1e0sa_173 ADP-ribosylation factor {Human (Homo sapiens), ARF 93.21
d1vg8a_184 Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} 93.19
d1bifa1213 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata 93.14
d1r2qa_170 Rab5a {Human (Homo sapiens) [TaxId: 9606]} 93.14
d2ew1a1171 Rab30 {Human (Homo sapiens) [TaxId: 9606]} 93.14
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 93.11
d2erya1171 r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 93.11
d2a5ja1173 Rab2b {Human (Homo sapiens) [TaxId: 9606]} 93.1
d1z08a1167 Rab21 {Human (Homo sapiens) [TaxId: 9606]} 93.09
d1z0ja1167 Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} 93.02
d1z06a1165 Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} 92.99
d1ek0a_170 Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [T 92.97
d1kaoa_167 Rap2a {Human (Homo sapiens) [TaxId: 9606]} 92.96
d1ctqa_166 cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9 92.95
d1viaa_161 Shikimate kinase (AroK) {Campylobacter jejuni [Tax 92.95
d2atva1168 Ras-like estrogen-regulated growth inhibitor, RERG 92.94
d1yzqa1164 Rab6 {Human (Homo sapiens) [TaxId: 9606]} 92.92
d2erxa1171 di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} 92.9
d1a1va1136 HCV helicase domain {Human hepatitis C virus (HCV) 92.88
d1moza_182 ADP-ribosylation factor {Baker's yeast (Saccharomy 92.86
d3raba_169 Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} 92.82
d1nrjb_209 Signal recognition particle receptor beta-subunit 92.77
d2fn4a1173 r-Ras {Human (Homo sapiens) [TaxId: 9606]} 92.75
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 92.67
d1kmqa_177 RhoA {Human (Homo sapiens) [TaxId: 9606]} 92.65
d4tmka_210 Thymidylate kinase {Escherichia coli [TaxId: 562]} 92.61
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 92.6
d1ny5a2247 Transcriptional activator sigm54 (NtrC1), C-termin 92.6
d1odfa_286 Hypothetical protein Ygr205W {Baker's yeast (Sacch 92.52
d1q3ta_223 CMP kinase {Streptococcus pneumoniae [TaxId: 1313] 92.5
d1wmsa_174 Rab9a {Human (Homo sapiens) [TaxId: 9606]} 92.47
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneu 92.47
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 92.44
d1z0fa1166 Rab14 {Human (Homo sapiens) [TaxId: 9606]} 92.34
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 92.28
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 92.28
d2bmea1174 Rab4a {Human (Homo sapiens) [TaxId: 9606]} 92.26
d2bcgy1194 GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisi 92.24
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus c 92.24
d1e2ka_329 Thymidine kinase {Herpes simplex virus type 1, dif 92.21
d2awna2232 Maltose transport protein MalK, N-terminal domain 92.18
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 92.15
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 92.12
d1c1ya_167 Rap1A {Human (Homo sapiens) [TaxId: 9606]} 92.07
d1x1ra1169 Ras-related protein M-Ras (XRas) {Mouse (Mus muscu 92.04
d1nn5a_209 Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 92.04
d1u8za_168 Ras-related protein RalA {Cotton-top tamarin (Sagu 92.02
d2hyda1255 Putative multidrug export ATP-binding/permease pro 92.01
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 91.97
d2jdid3276 Central domain of beta subunit of F1 ATP synthase 91.94
d2f7sa1186 Rab27b {Human (Homo sapiens) [TaxId: 9606]} 91.92
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 91.87
d2f9la1175 Rab11b {Human (Homo sapiens) [TaxId: 9606]} 91.87
d1w36d1359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 91.83
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 91.81
d2gjsa1168 Rad {Human (Homo sapiens) [TaxId: 9606]} 91.77
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 91.75
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 91.64
d2g3ya1172 GTP-binding protein GEM {Human (Homo sapiens) [Tax 91.64
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 91.59
d1g16a_166 Rab-related protein Sec4 {Baker's yeast (Saccharom 91.56
d2ngra_191 CDC42 {Human (Homo sapiens) [TaxId: 9606]} 91.55
d1p5zb_241 Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 91.53
d2p6ra3202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 91.52
d2atxa1185 RhoQ {Human (Homo sapiens) [TaxId: 9606]} 91.52
d1x3sa1177 Rab18 {Human (Homo sapiens) [TaxId: 9606]} 91.5
d1m7ba_179 RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} 91.41
d2g6ba1170 Rab26 {Human (Homo sapiens) [TaxId: 9606]} 91.4
d1mkya1171 Probable GTPase Der, N-terminal and middle domains 91.38
d2bmja1175 Centaurin gamma 1, G domain {Human (Homo sapiens) 91.37
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 91.34
d1svia_195 Probable GTPase EngB {Bacillus subtilis [TaxId: 14 91.26
d1ckea_225 CMP kinase {Escherichia coli [TaxId: 562]} 91.25
d1vhta_208 Dephospho-CoA kinase {Escherichia coli [TaxId: 562 91.23
d1xpua3289 Transcription termination factor Rho, ATPase domai 91.17
d1g2912240 Maltose transport protein MalK, N-terminal domain 91.13
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 91.05
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 91.03
d1tmka_214 Thymidylate kinase {Baker's yeast (Saccharomyces c 90.98
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 90.92
d1g6oa_323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 90.74
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 90.72
g1xew.1329 Smc head domain {Pyrococcus furiosus [TaxId: 2261] 90.7
d2ocpa1241 Deoxyguanosine kinase {Human (Homo sapiens) [TaxId 90.67
d1ihua2279 Arsenite-translocating ATPase ArsA {Escherichia co 90.51
d2fh5b1207 Signal recognition particle receptor beta-subunit 90.44
d2fu5c1173 Rab8a {Mouse (Mus musculus) [TaxId: 10090]} 90.42
d1i2ma_170 Ran {Human (Homo sapiens) [TaxId: 9606]} 90.32
d1zcba2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 90.3
d1svsa1195 Transducin (alpha subunit) {Rat (Rattus norvegicus 90.17
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus 90.17
d2bmfa2305 Dengue virus helicase {Dengue virus type 2 [TaxId: 90.04
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 89.99
d1puia_188 Probable GTPase EngB {Escherichia coli [TaxId: 562 89.6
d1deka_241 Deoxynucleoside monophosphate kinase {Bacteriophag 89.58
d1uf9a_191 Dephospho-CoA kinase {Thermus thermophilus [TaxId: 89.45
d1jjva_205 Dephospho-CoA kinase {Haemophilus influenzae [TaxI 89.29
d2cxxa1184 GTP-binding protein engB {Pyrococcus horikoshii [T 89.29
d1w44a_321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 89.12
d1mkya2186 Probable GTPase Der, N-terminal and middle domains 89.01
d1f5na2277 Interferon-induced guanylate-binding protein 1 (GB 88.93
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 88.92
d1uj2a_213 Uridine-cytidine kinase 2 {Human (Homo sapiens) [T 88.64
d1qhla_222 Cell division protein MukB {Escherichia coli [TaxI 88.61
d1tq4a_400 Interferon-inducible GTPase {Mouse (Mus musculus) 88.42
d1g8pa_333 ATPase subunit of magnesium chelatase, BchI {Rhodo 88.4
d2fz4a1206 DNA repair protein RAD25 {Archaeoglobus fulgidus [ 88.38
d2bcjq2200 Transducin (alpha subunit) {Mouse (Mus musculus) [ 88.31
d1cp2a_269 Nitrogenase iron protein {Clostridium pasteurianum 88.21
d2gnoa2198 gamma subunit of DNA polymerase III, N-domain {The 88.02
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fu 87.97
d1wp9a1200 putative ATP-dependent RNA helicase PF2015 {Pyroco 87.94
d1r6bx3315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 87.78
d1fx0a3276 Central domain of alpha subunit of F1 ATP synthase 87.77
d1wb9a2234 DNA repair protein MutS, the C-terminal domain {Es 87.76
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 87.27
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 87.08
d1azta2221 Transducin (alpha subunit) {Cow (Bos taurus) [TaxI 87.06
d1xzpa2160 TrmE GTPase domain {Thermotoga maritima [TaxId: 23 86.6
g1qhh.1 623 DEXX box DNA helicase {Bacillus stearothermophilus 86.49
d1wf3a1178 GTPase Era, N-terminal domain {Thermus thermophilu 86.24
d1egaa1179 GTPase Era, N-terminal domain {Escherichia coli [T 86.21
d1t9ha2231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 86.02
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 85.72
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 84.91
d1ewqa2224 DNA repair protein MutS, the C-terminal domain {Th 84.49
d2akab1299 Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 84.41
d1u0ja_267 Rep 40 protein helicase domain {Adeno-associated v 84.33
d1lnza2185 Obg GTP-binding protein middle domain {Bacillus su 84.01
d1xbta1133 Thymidine kinase, TK1, N-terminal domain {Human (H 83.77
d1w1wa_ 427 Smc head domain {Baker's yeast (Saccharomyces cere 83.1
d1jwyb_306 Dynamin G domain {Dictyostelium discoideum [TaxId: 82.46
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 82.14
d2afhe1289 Nitrogenase iron protein {Azotobacter vinelandii [ 82.06
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 81.92
d2jdia3285 Central domain of alpha subunit of F1 ATP synthase 81.66
d1udxa2180 Obg GTP-binding protein middle domain {Thermus the 81.14
d1ihua1296 Arsenite-translocating ATPase ArsA {Escherichia co 80.52
d1a7ja_288 Phosphoribulokinase {Rhodobacter sphaeroides [TaxI 80.5
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Extended AAA-ATPase domain
domain: Archaeal ATPase SSO1545
species: Sulfolobus solfataricus [TaxId: 2287]
Probab=99.05  E-value=7.8e-10  Score=97.93  Aligned_cols=123  Identities=12%  Similarity=0.064  Sum_probs=73.1

Q ss_pred             HHHHHHHHhccccCCCceEEEEEeCccccccCCCcCCCCCCCcccCCccchHHHHHHhhcCCCCCeEEEEEeCCCCCCCC
Q psy3261         188 VDVLFTEIKKLSTEGVCRTFVCVDGYNSFFAEKTNCKPEDKSKVLPSRVTLTRSVINLVQSDWNNGAIVLALSPRANLPD  267 (342)
Q Consensus       188 ~~~l~~EL~~~~~~~~~pVLvavD~~n~~~~~s~~y~~~~~~~I~~~~l~l~~~~~~~~~~~~~~G~vv~AtS~~~~~~~  267 (342)
                      +..+++.+...   .+.++++++|++..+.....              ..+...+..+......- ..+++.+...    
T Consensus       123 ~~~~l~~l~~~---~~~~~~i~id~~~~~~~~~~--------------~~~~~~l~~~~~~~~~~-~~i~~~~~~~----  180 (283)
T d2fnaa2         123 FANLLESFEQA---SKDNVIIVLDEAQELVKLRG--------------VNLLPALAYAYDNLKRI-KFIMSGSEMG----  180 (283)
T ss_dssp             HHHHHHHHHHT---CSSCEEEEEETGGGGGGCTT--------------CCCHHHHHHHHHHCTTE-EEEEEESSHH----
T ss_pred             HHHHHHHHHhh---cccccccccchhhhhcccch--------------HHHHHHHHHHHHhhhhh-hhhhccccch----
Confidence            44455566554   37789999999987765543              34566666666544333 3333333221    


Q ss_pred             CccCcchhHHhhhcCCC---CCCCcceeecCCCCHHHHHHHHHHHH-hCCCccCcchHHHHHHhhCCCHHHHhhhc
Q psy3261         268 RRESHLPLYMLKKAGFE---SIDPFVPIHVPELNDEEFHNLLNLYE-SKKWLQTSEGREEIAFLTKRVPQKMYEFC  339 (342)
Q Consensus       268 ~~~~~~p~~llg~~g~~---~~dP~~~i~v~~~s~~E~~~ll~yy~-~~~~l~~e~~~~el~~lSgGNP~~l~~lc  339 (342)
                           .+..+.......   .-..+.++.+++|+.+|+..++.-.. ..+ + +.+..++++-.|||+|.-|..+|
T Consensus       181 -----~~~~~~~~~~~~~~~~~~~~~~i~L~~l~~~e~~~~l~~~~~~~~-~-~~~~~~~i~~~~~G~P~~L~~~~  249 (283)
T d2fnaa2         181 -----LLYDYLRVEDPESPLFGRAFSTVELKPFSREEAIEFLRRGFQEAD-I-DFKDYEVVYEKIGGIPGWLTYFG  249 (283)
T ss_dssp             -----HHHHHTTTTCTTSTTTTCCCEEEEECCCCHHHHHHHHHHHHHHHT-C-CCCCHHHHHHHHCSCHHHHHHHH
T ss_pred             -----HHHHHHHhhhhcchhcccceeEEeeCCCCHHHHHHHHHhhhhhcC-C-CHHHHHHHHHHhCCCHHHHHHHH
Confidence                 111122111110   01123468999999999999986543 333 3 34456789999999999887776



>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} Back     information, alignment and structure
>d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} Back     information, alignment and structure
>d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} Back     information, alignment and structure
>d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} Back     information, alignment and structure
>d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Back     information, alignment and structure
>d1f6ba_ c.37.1.8 (A:) SAR1 {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1r8sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF1 [TaxId: 9606]} Back     information, alignment and structure
>d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1zj6a1 c.37.1.8 (A:2-178) ADP-ribosylation factor {Human (Homo sapiens), ARL5A [TaxId: 9606]} Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1fzqa_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL3 [TaxId: 10090]} Back     information, alignment and structure
>d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1upta_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARL1 [TaxId: 9606]} Back     information, alignment and structure
>d1xtqa1 c.37.1.8 (A:3-169) GTP-binding protein RheB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1osna_ c.37.1.1 (A:) Thymidine kinase {Varicella-zoster virus [TaxId: 10335]} Back     information, alignment and structure
>d2qtvb1 c.37.1.8 (B:24-189) SAR1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mh1a_ c.37.1.8 (A:) Rac {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1z2aa1 c.37.1.8 (A:8-171) Rab23 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} Back     information, alignment and structure
>d1p6xa_ c.37.1.1 (A:) Thymidine kinase {Equine herpesvirus type 4 [TaxId: 10331]} Back     information, alignment and structure
>d1ksha_ c.37.1.8 (A:) ADP-ribosylation factor {Mouse (Mus musculus), ARL2 [TaxId: 10090]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gj8a1 c.37.1.8 (A:216-376) Probable tRNA modification GTPase TrmE (MnmE), G domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ky3a_ c.37.1.8 (A:) Rab-related protein ypt7p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zd9a1 c.37.1.8 (A:18-181) ADP-ribosylation factor {Human (Homo sapiens), ARL8A [TaxId: 9606]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1e0sa_ c.37.1.8 (A:) ADP-ribosylation factor {Human (Homo sapiens), ARF6 [TaxId: 9606]} Back     information, alignment and structure
>d1vg8a_ c.37.1.8 (A:) Rab7 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r2qa_ c.37.1.8 (A:) Rab5a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ew1a1 c.37.1.8 (A:4-174) Rab30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2erya1 c.37.1.8 (A:10-180) r-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a5ja1 c.37.1.8 (A:9-181) Rab2b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z08a1 c.37.1.8 (A:17-183) Rab21 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z0ja1 c.37.1.8 (A:2-168) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z06a1 c.37.1.8 (A:32-196) Rab-33b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ek0a_ c.37.1.8 (A:) Ypt51 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kaoa_ c.37.1.8 (A:) Rap2a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctqa_ c.37.1.8 (A:) cH-p21 Ras protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d2atva1 c.37.1.8 (A:5-172) Ras-like estrogen-regulated growth inhibitor, RERG {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yzqa1 c.37.1.8 (A:14-177) Rab6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2erxa1 c.37.1.8 (A:6-176) di-Ras2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Back     information, alignment and structure
>d1moza_ c.37.1.8 (A:) ADP-ribosylation factor {Baker's yeast (Saccharomyces cerevisiae), ARL1 [TaxId: 4932]} Back     information, alignment and structure
>d3raba_ c.37.1.8 (A:) Rab3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fn4a1 c.37.1.8 (A:24-196) r-Ras {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kmqa_ c.37.1.8 (A:) RhoA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1wmsa_ c.37.1.8 (A:) Rab9a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1z0fa1 c.37.1.8 (A:8-173) Rab14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bmea1 c.37.1.8 (A:6-179) Rab4a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bcgy1 c.37.1.8 (Y:3-196) GTPase Ytp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1e2ka_ c.37.1.1 (A:) Thymidine kinase {Herpes simplex virus type 1, different strains [TaxId: 10298]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1c1ya_ c.37.1.8 (A:) Rap1A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x1ra1 c.37.1.8 (A:10-178) Ras-related protein M-Ras (XRas) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u8za_ c.37.1.8 (A:) Ras-related protein RalA {Cotton-top tamarin (Saguinus oedipus) [TaxId: 9490]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f7sa1 c.37.1.8 (A:5-190) Rab27b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2f9la1 c.37.1.8 (A:8-182) Rab11b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gjsa1 c.37.1.8 (A:91-258) Rad {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g3ya1 c.37.1.8 (A:73-244) GTP-binding protein GEM {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1g16a_ c.37.1.8 (A:) Rab-related protein Sec4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ngra_ c.37.1.8 (A:) CDC42 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p5zb_ c.37.1.1 (B:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2atxa1 c.37.1.8 (A:9-193) RhoQ {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3sa1 c.37.1.8 (A:2-178) Rab18 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m7ba_ c.37.1.8 (A:) RhoE (RND3) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2g6ba1 c.37.1.8 (A:58-227) Rab26 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mkya1 c.37.1.8 (A:2-172) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bmja1 c.37.1.8 (A:66-240) Centaurin gamma 1, G domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svia_ c.37.1.8 (A:) Probable GTPase EngB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vhta_ c.37.1.1 (A:) Dephospho-CoA kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ocpa1 c.37.1.1 (A:37-277) Deoxyguanosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihua2 c.37.1.10 (A:308-586) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fh5b1 c.37.1.8 (B:63-269) Signal recognition particle receptor beta-subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fu5c1 c.37.1.8 (C:3-175) Rab8a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i2ma_ c.37.1.8 (A:) Ran {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zcba2 c.37.1.8 (A:47-75,A:202-372) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svsa1 c.37.1.8 (A:32-60,A:182-347) Transducin (alpha subunit) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1puia_ c.37.1.8 (A:) Probable GTPase EngB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1deka_ c.37.1.1 (A:) Deoxynucleoside monophosphate kinase {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jjva_ c.37.1.1 (A:) Dephospho-CoA kinase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2cxxa1 c.37.1.8 (A:2-185) GTP-binding protein engB {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1mkya2 c.37.1.8 (A:173-358) Probable GTPase Der, N-terminal and middle domains {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bcjq2 c.37.1.8 (Q:38-66,Q:184-354) Transducin (alpha subunit) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cp2a_ c.37.1.10 (A:) Nitrogenase iron protein {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1azta2 c.37.1.8 (A:35-65,A:202-391) Transducin (alpha subunit) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xzpa2 c.37.1.8 (A:212-371) TrmE GTPase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wf3a1 c.37.1.8 (A:3-180) GTPase Era, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d2akab1 c.37.1.8 (B:6-304) Dynamin G domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d1lnza2 c.37.1.8 (A:158-342) Obg GTP-binding protein middle domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jwyb_ c.37.1.8 (B:) Dynamin G domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2afhe1 c.37.1.10 (E:1-289) Nitrogenase iron protein {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1udxa2 c.37.1.8 (A:157-336) Obg GTP-binding protein middle domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a7ja_ c.37.1.6 (A:) Phosphoribulokinase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure