Psyllid ID: psy3300
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 97 | ||||||
| 328708867 | 403 | PREDICTED: hypothetical protein LOC10016 | 0.969 | 0.233 | 0.872 | 2e-42 | |
| 270001817 | 602 | hypothetical protein TcasGA2_TC000706 [T | 0.969 | 0.156 | 0.819 | 2e-40 | |
| 383862319 | 533 | PREDICTED: uncharacterized protein LOC10 | 0.969 | 0.176 | 0.829 | 3e-40 | |
| 322778875 | 457 | hypothetical protein SINV_12079 [Solenop | 0.969 | 0.205 | 0.829 | 3e-40 | |
| 307201348 | 441 | Tensin-1 [Harpegnathos saltator] | 0.969 | 0.213 | 0.829 | 3e-40 | |
| 91076848 | 562 | PREDICTED: similar to CG33993 CG33993-PA | 0.969 | 0.167 | 0.819 | 4e-40 | |
| 345490200 | 617 | PREDICTED: hypothetical protein LOC10012 | 0.969 | 0.152 | 0.829 | 5e-40 | |
| 328785357 | 535 | PREDICTED: hypothetical protein LOC40880 | 0.969 | 0.175 | 0.829 | 5e-40 | |
| 307184801 | 510 | Tensin-1 [Camponotus floridanus] | 0.969 | 0.184 | 0.829 | 5e-40 | |
| 340712997 | 572 | PREDICTED: hypothetical protein LOC10064 | 0.969 | 0.164 | 0.829 | 1e-39 |
| >gi|328708867|ref|XP_001942843.2| PREDICTED: hypothetical protein LOC100163483 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
Score = 176 bits (446), Expect = 2e-42, Method: Composition-based stats.
Identities = 82/94 (87%), Positives = 88/94 (93%)
Query: 3 QEITLEVLSQEPVGAFMVRESTTKPGCFALSLRVPKEFHHLGIAHYLILRTAKGYKIKGF 62
+EITLEVL QEPVGAFMVRESTTKPGCFALSLRVP+EFH LGIAHYLILRT KG+KIKGF
Sbjct: 277 REITLEVLGQEPVGAFMVRESTTKPGCFALSLRVPQEFHPLGIAHYLILRTNKGFKIKGF 336
Query: 63 TKEFSSLTSLITHHSVMPELLPCTLSLHRYNPNF 96
TKEF++LT+LITHHSVMPELLPC LSL RYNP F
Sbjct: 337 TKEFTTLTALITHHSVMPELLPCPLSLSRYNPTF 370
|
Source: Acyrthosiphon pisum Species: Acyrthosiphon pisum Genus: Acyrthosiphon Family: Aphididae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270001817|gb|EEZ98264.1| hypothetical protein TcasGA2_TC000706 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|383862319|ref|XP_003706631.1| PREDICTED: uncharacterized protein LOC100880089 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|322778875|gb|EFZ09291.1| hypothetical protein SINV_12079 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|307201348|gb|EFN81183.1| Tensin-1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|91076848|ref|XP_974801.1| PREDICTED: similar to CG33993 CG33993-PA [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|345490200|ref|XP_001604388.2| PREDICTED: hypothetical protein LOC100120785 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|328785357|ref|XP_392334.4| PREDICTED: hypothetical protein LOC408803 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|307184801|gb|EFN71115.1| Tensin-1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|340712997|ref|XP_003395038.1| PREDICTED: hypothetical protein LOC100646619 [Bombus terrestris] gi|350419718|ref|XP_003492279.1| PREDICTED: hypothetical protein LOC100747418 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 97 | ||||||
| FB|FBgn0053993 | 421 | CG33993 [Drosophila melanogast | 0.896 | 0.206 | 0.707 | 8.2e-28 | |
| UNIPROTKB|Q8IZW8 | 715 | TNS4 "Tensin-4" [Homo sapiens | 0.896 | 0.121 | 0.363 | 1.7e-08 | |
| UNIPROTKB|F1MN94 | 716 | TNS4 "Tensin-4" [Bos taurus (t | 0.876 | 0.118 | 0.381 | 4.6e-08 | |
| UNIPROTKB|Q32PJ7 | 716 | TNS4 "Tensin-4" [Bos taurus (t | 0.876 | 0.118 | 0.381 | 4.6e-08 | |
| WB|WBGene00006508 | 1112 | tag-163 [Caenorhabditis elegan | 0.948 | 0.082 | 0.356 | 4.9e-08 | |
| UNIPROTKB|F1RXE4 | 716 | TNS4 "Uncharacterized protein" | 0.876 | 0.118 | 0.381 | 5.8e-08 | |
| MGI|MGI:2144377 | 696 | Tns4 "tensin 4" [Mus musculus | 0.896 | 0.125 | 0.363 | 7.2e-08 | |
| RGD|1562071 | 262 | Sla2 "Src-like-adaptor 2" [Rat | 0.835 | 0.309 | 0.358 | 1.2e-07 | |
| MGI|MGI:1925049 | 259 | Sla2 "Src-like-adaptor 2" [Mus | 0.835 | 0.312 | 0.358 | 1.9e-07 | |
| MGI|MGI:2443012 | 1440 | Tns3 "tensin 3" [Mus musculus | 0.948 | 0.063 | 0.327 | 2.2e-07 |
| FB|FBgn0053993 CG33993 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 311 (114.5 bits), Expect = 8.2e-28, P = 8.2e-28
Identities = 63/89 (70%), Positives = 74/89 (83%)
Query: 3 QEITLEVLSQEPVGAFMVRESTTKPGCFALSLRVPKEFHHLGIAHYLILRTAKGYKIKGF 62
+EI+LE LS++ GAF+VR+S+TKPGCFALSLRVP +AHYLILRT +GYKIKGF
Sbjct: 293 REISLEALSRQSPGAFLVRQSSTKPGCFALSLRVPPPSPR--VAHYLILRTQRGYKIKGF 350
Query: 63 TKEFSSLTSLITHHSVMPELLPCTLSLHR 91
TKEFSSL +LITHHSVMPELLP L+L R
Sbjct: 351 TKEFSSLKALITHHSVMPELLPVPLTLPR 379
|
|
| UNIPROTKB|Q8IZW8 TNS4 "Tensin-4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MN94 TNS4 "Tensin-4" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q32PJ7 TNS4 "Tensin-4" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00006508 tag-163 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RXE4 TNS4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2144377 Tns4 "tensin 4" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1562071 Sla2 "Src-like-adaptor 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1925049 Sla2 "Src-like-adaptor 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2443012 Tns3 "tensin 3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 97 | |||
| cd09927 | 116 | cd09927, SH2_Tensin_like, Src homology 2 domain fo | 1e-14 | |
| smart00252 | 84 | smart00252, SH2, Src homology 2 domains | 2e-14 | |
| cd00173 | 79 | cd00173, SH2, Src homology 2 (SH2) domain | 3e-14 | |
| pfam00017 | 77 | pfam00017, SH2, SH2 domain | 3e-12 | |
| cd10344 | 104 | cd10344, SH2_SLAP, Src homology 2 domain found in | 4e-11 | |
| cd09941 | 95 | cd09941, SH2_Grb2_like, Src homology 2 domain foun | 2e-09 | |
| cd09935 | 94 | cd09935, SH2_ABL, Src homology 2 (SH2) domain foun | 9e-09 | |
| cd09931 | 99 | cd09931, SH2_C-SH2_SHP_like, C-terminal Src homolo | 2e-08 | |
| cd09933 | 101 | cd09933, SH2_Src_family, Src homology 2 (SH2) doma | 1e-07 | |
| cd09944 | 108 | cd09944, SH2_Grb7_family, Src homology 2 (SH2) dom | 2e-07 | |
| cd10353 | 103 | cd10353, SH2_Nterm_RasGAP, N-terminal Src homology | 3e-07 | |
| cd09930 | 104 | cd09930, SH2_cSH2_p85_like, C-terminal Src homolog | 4e-07 | |
| cd10355 | 92 | cd10355, SH2_DAPP1_BAM32_like, Src homology 2 doma | 9e-07 | |
| cd10354 | 77 | cd10354, SH2_Cterm_RasGAP, C-terminal Src homology | 3e-06 | |
| cd10339 | 101 | cd10339, SH2_RIN_family, Src homology 2 (SH2) doma | 3e-06 | |
| cd09942 | 110 | cd09942, SH2_nSH2_p85_like, N-terminal Src homolog | 3e-06 | |
| cd10393 | 101 | cd10393, SH2_RIN1, Src homology 2 (SH2) domain fou | 6e-06 | |
| cd09932 | 104 | cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src | 8e-06 | |
| cd10418 | 101 | cd10418, SH2_Src_Fyn_isoform_a_like, Src homology | 9e-06 | |
| cd10419 | 101 | cd10419, SH2_Src_Fyn_isoform_b_like, Src homology | 1e-05 | |
| cd10361 | 90 | cd10361, SH2_Fps_family, Src homology 2 (SH2) doma | 1e-05 | |
| cd10366 | 101 | cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain | 1e-05 | |
| cd10413 | 108 | cd10413, SH2_Grb7, Src homology 2 (SH2) domain fou | 1e-05 | |
| cd10368 | 101 | cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain | 2e-05 | |
| cd10365 | 101 | cd10365, SH2_Src_Src, Src homology 2 (SH2) domain | 2e-05 | |
| cd10363 | 104 | cd10363, SH2_Src_HCK, Src homology 2 (SH2) domain | 2e-05 | |
| cd10362 | 101 | cd10362, SH2_Src_Lck, Src homology 2 (SH2) domain | 4e-05 | |
| cd09938 | 104 | cd09938, SH2_N-SH2_Zap70_Syk_like, N-terminal Src | 7e-05 | |
| cd10367 | 101 | cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain | 8e-05 | |
| cd10356 | 113 | cd10356, SH2_ShkA_ShkC, Src homology 2 (SH2) domai | 2e-04 | |
| cd10347 | 81 | cd10347, SH2_Nterm_shark_like, N-terminal Src homo | 2e-04 | |
| cd10364 | 101 | cd10364, SH2_Src_Lyn, Src homology 2 (SH2) domain | 4e-04 | |
| cd10370 | 96 | cd10370, SH2_Src_Src42, Src homology 2 (SH2) domai | 5e-04 | |
| cd10341 | 99 | cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src | 5e-04 | |
| cd10369 | 96 | cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain | 7e-04 | |
| cd10388 | 101 | cd10388, SH2_SOCS7, Src homology 2 (SH2) domain fo | 0.001 | |
| cd10414 | 108 | cd10414, SH2_Grb14, Src homology 2 (SH2) domain fo | 0.001 | |
| cd09945 | 98 | cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 | 0.002 | |
| cd10415 | 108 | cd10415, SH2_Grb10, Src homology 2 (SH2) domain fo | 0.002 | |
| cd10340 | 99 | cd10340, SH2_N-SH2_SHP_like, N-terminal Src homolo | 0.002 | |
| cd09934 | 104 | cd09934, SH2_Tec_family, Src homology 2 (SH2) doma | 0.003 | |
| cd09943 | 93 | cd09943, SH2_Nck_family, Src homology 2 (SH2) doma | 0.004 | |
| cd10352 | 91 | cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 | 0.004 |
| >gnl|CDD|198181 cd09927, SH2_Tensin_like, Src homology 2 domain found in Tensin-like proteins | Back alignment and domain information |
|---|
Score = 63.6 bits (155), Expect = 1e-14
Identities = 33/95 (34%), Positives = 50/95 (52%), Gaps = 14/95 (14%)
Query: 9 VLSQEPVGAFMVRESTTKPGCFALSLRV---PKEFHHLGIA---------HYLILRTAKG 56
+L +P G F+VR+STT G + L+++V P + H+LI + KG
Sbjct: 18 LLKDKPPGTFLVRDSTTYKGAYGLAVKVATPPPGVNPFEAKGDPESELVRHFLIEPSPKG 77
Query: 57 YKIKGFTKE--FSSLTSLITHHSVMPELLPCTLSL 89
K+KG E F SL++L+ HS+ P LPC L +
Sbjct: 78 VKLKGCPNEPVFGSLSALVYQHSITPLALPCKLRI 112
|
SH2 domain found in Tensin-like proteins. The Tensins are a family of intracellular proteins that interact with receptor tyrosine kinases (RTKs), integrins, and actin. They are thought act as signaling bridges between the extracellular space and the cytoskeleton. There are four homologues: Tensin1, Tensin2 (TENC1, C1-TEN), Tensin3 and Tensin4 (cten), all of which contain a C-terminal tandem SH2-PTB domain pairing, as well as actin-binding regions that may localize them to focal adhesions. The isoforms of Tensin2 and Tensin3 contain N-terminal C1 domains, which are atypical and not expected to bind to phorbol esters. Tensins 1-3 contain a phosphatase (PTPase) and C2 domain pairing which resembles PTEN (phosphatase and tensin homologue deleted on chromosome 10) protein. PTEN is a lipid phosphatase that dephosphorylates phosphatidylinositol 3,4,5-trisphosphate (PtdIns(3,4,5)P3) to yield phosphatidylinositol 4,5-bisphosphate (PtdIns(4,5)P2). As PtdIns(3,4,5)P3 is the product of phosphatidylinositol 3-kinase (PI3K) activity, PTEN is therefore a key negative regulator of the PI3K pathway. Because of their PTEN-like domains, the Tensins may also possess phosphoinositide-binding or phosphatase capabilities. However, only Tensin2 and Tensin3 have the potential to be phosphatases since only their PTPase domains contain a cysteine residue that is essential for catalytic activity. In general SH2 domains are involved in signal transduction. They typically bind pTyr-containing ligands via two surface pockets, a pTyr and hydrophobic binding pocket, allowing proteins with SH2 domains to localize to tyrosine phosphorylated sites. Length = 116 |
| >gnl|CDD|214585 smart00252, SH2, Src homology 2 domains | Back alignment and domain information |
|---|
| >gnl|CDD|198173 cd00173, SH2, Src homology 2 (SH2) domain | Back alignment and domain information |
|---|
| >gnl|CDD|215658 pfam00017, SH2, SH2 domain | Back alignment and domain information |
|---|
| >gnl|CDD|198207 cd10344, SH2_SLAP, Src homology 2 domain found in Src-like adaptor proteins | Back alignment and domain information |
|---|
| >gnl|CDD|199828 cd09941, SH2_Grb2_like, Src homology 2 domain found in Growth factor receptor-bound protein 2 (Grb2) and similar proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198189 cd09935, SH2_ABL, Src homology 2 (SH2) domain found in Abelson murine lymphosarcoma virus (ABL) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198185 cd09931, SH2_C-SH2_SHP_like, C-terminal Src homology 2 (C-SH2) domain found in SH2 domain Phosphatases (SHP) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|199827 cd09933, SH2_Src_family, Src homology 2 (SH2) domain found in the Src family of non-receptor tyrosine kinases | Back alignment and domain information |
|---|
| >gnl|CDD|198197 cd09944, SH2_Grb7_family, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 7 (Grb7) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198216 cd10353, SH2_Nterm_RasGAP, N-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) | Back alignment and domain information |
|---|
| >gnl|CDD|198184 cd09930, SH2_cSH2_p85_like, C-terminal Src homology 2 (cSH2) domain found in p85 | Back alignment and domain information |
|---|
| >gnl|CDD|198218 cd10355, SH2_DAPP1_BAM32_like, Src homology 2 domain found in dual adaptor for phosphotyrosine and 3-phosphoinositides ( DAPP1)/B lymphocyte adaptor molecule of 32 kDa (Bam32)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198217 cd10354, SH2_Cterm_RasGAP, C-terminal Src homology 2 (SH2) domain found in Ras GTPase-activating protein 1 (GAP) | Back alignment and domain information |
|---|
| >gnl|CDD|198202 cd10339, SH2_RIN_family, Src homology 2 (SH2) domain found in Ras and Rab interactor (RIN)-family | Back alignment and domain information |
|---|
| >gnl|CDD|198195 cd09942, SH2_nSH2_p85_like, N-terminal Src homology 2 (nSH2) domain found in p85 | Back alignment and domain information |
|---|
| >gnl|CDD|198256 cd10393, SH2_RIN1, Src homology 2 (SH2) domain found in Ras and Rab interactor 1 (RIN1)-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198186 cd09932, SH2_C-SH2_PLC_gamma_like, C-terminal Src homology 2 (C-SH2) domain in Phospholipase C gamma | Back alignment and domain information |
|---|
| >gnl|CDD|198281 cd10418, SH2_Src_Fyn_isoform_a_like, Src homology 2 (SH2) domain found in Fyn isoform a like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198282 cd10419, SH2_Src_Fyn_isoform_b_like, Src homology 2 (SH2) domain found in Fyn isoform b like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198224 cd10361, SH2_Fps_family, Src homology 2 (SH2) domain found in feline sarcoma, Fujinami poultry sarcoma, and fes-related (Fes/Fps/Fer) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198229 cd10366, SH2_Src_Yes, Src homology 2 (SH2) domain found in Yes | Back alignment and domain information |
|---|
| >gnl|CDD|198276 cd10413, SH2_Grb7, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 7 (Grb7) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198231 cd10368, SH2_Src_Fyn, Src homology 2 (SH2) domain found in Fyn | Back alignment and domain information |
|---|
| >gnl|CDD|198228 cd10365, SH2_Src_Src, Src homology 2 (SH2) domain found in tyrosine kinase sarcoma (Src) | Back alignment and domain information |
|---|
| >gnl|CDD|198226 cd10363, SH2_Src_HCK, Src homology 2 (SH2) domain found in HCK | Back alignment and domain information |
|---|
| >gnl|CDD|198225 cd10362, SH2_Src_Lck, Src homology 2 (SH2) domain in lymphocyte cell kinase (Lck) | Back alignment and domain information |
|---|
| >gnl|CDD|198191 cd09938, SH2_N-SH2_Zap70_Syk_like, N-terminal Src homology 2 (SH2) domain found in Zeta-chain-associated protein kinase 70 (ZAP-70) and Spleen tyrosine kinase (Syk) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198230 cd10367, SH2_Src_Fgr, Src homology 2 (SH2) domain found in Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog, Fgr | Back alignment and domain information |
|---|
| >gnl|CDD|198219 cd10356, SH2_ShkA_ShkC, Src homology 2 (SH2) domain found in SH2 domain-bearing protein kinases A and C (ShkA and ShkC) | Back alignment and domain information |
|---|
| >gnl|CDD|198210 cd10347, SH2_Nterm_shark_like, N-terminal Src homology 2 (SH2) domain found in SH2 domains, ANK, and kinase domain (shark) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198227 cd10364, SH2_Src_Lyn, Src homology 2 (SH2) domain found in Lyn | Back alignment and domain information |
|---|
| >gnl|CDD|198233 cd10370, SH2_Src_Src42, Src homology 2 (SH2) domain found in the Src oncogene at 42A (Src42) | Back alignment and domain information |
|---|
| >gnl|CDD|199829 cd10341, SH2_N-SH2_PLC_gamma_like, N-terminal Src homology 2 (N-SH2) domain in Phospholipase C gamma | Back alignment and domain information |
|---|
| >gnl|CDD|199831 cd10369, SH2_Src_Frk, Src homology 2 (SH2) domain found in the Fyn-related kinase (Frk) | Back alignment and domain information |
|---|
| >gnl|CDD|198251 cd10388, SH2_SOCS7, Src homology 2 (SH2) domain found in suppressor of cytokine signaling (SOCS) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198277 cd10414, SH2_Grb14, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 14 (Grb14) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198198 cd09945, SH2_SHB_SHD_SHE_SHF_like, Src homology 2 domain found in SH2 domain-containing adapter proteins B, D, E, and F (SHB, SHD, SHE, SHF) | Back alignment and domain information |
|---|
| >gnl|CDD|198278 cd10415, SH2_Grb10, Src homology 2 (SH2) domain found in the growth factor receptor bound, subclass 10 (Grb10) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198203 cd10340, SH2_N-SH2_SHP_like, N-terminal Src homology 2 (N-SH2) domain found in SH2 domain Phosphatases (SHP) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198188 cd09934, SH2_Tec_family, Src homology 2 (SH2) domain found in Tec-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198196 cd09943, SH2_Nck_family, Src homology 2 (SH2) domain found in the Nck family | Back alignment and domain information |
|---|
| >gnl|CDD|198215 cd10352, SH2_a2chimerin_b2chimerin, Src homology 2 (SH2) domain found in alpha2-chimerin and beta2-chimerin proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 97 | |||
| cd00173 | 94 | SH2 Src homology 2 domains; Signal transduction, i | 99.92 | |
| smart00252 | 84 | SH2 Src homology 2 domains. Src homology 2 domains | 99.89 | |
| PF00017 | 77 | SH2: SH2 domain; InterPro: IPR000980 The Src homol | 99.89 | |
| KOG1930|consensus | 483 | 99.83 | ||
| KOG4278|consensus | 1157 | 99.75 | ||
| KOG4637|consensus | 464 | 99.72 | ||
| KOG4637|consensus | 464 | 99.69 | ||
| KOG0197|consensus | 468 | 99.67 | ||
| KOG0790|consensus | 600 | 99.67 | ||
| KOG4226|consensus | 379 | 99.65 | ||
| KOG2996|consensus | 865 | 99.63 | ||
| KOG1264|consensus | 1267 | 99.62 | ||
| KOG4792|consensus | 293 | 99.61 | ||
| KOG1264|consensus | 1267 | 99.58 | ||
| KOG0790|consensus | 600 | 99.45 | ||
| KOG0194|consensus | 474 | 99.3 | ||
| KOG3601|consensus | 222 | 99.11 | ||
| PF14633 | 220 | SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_ | 98.74 | |
| KOG3751|consensus | 622 | 98.54 | ||
| PF14633 | 220 | SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_ | 97.56 | |
| KOG1856|consensus | 1299 | 97.44 | ||
| KOG4566|consensus | 258 | 97.29 | ||
| KOG3697|consensus | 345 | 97.09 | ||
| KOG1856|consensus | 1299 | 96.35 | ||
| PF02762 | 86 | Cbl_N3: CBL proto-oncogene N-terminus, SH2-like do | 96.16 | |
| KOG3667|consensus | 682 | 92.58 | ||
| smart00557 | 93 | IG_FLMN Filamin-type immunoglobulin domains. These | 86.8 | |
| KOG1785|consensus | 563 | 86.29 |
| >cd00173 SH2 Src homology 2 domains; Signal transduction, involved in recognition of phosphorylated tyrosine (pTyr) | Back alignment and domain information |
|---|
Probab=99.92 E-value=2.1e-24 Score=121.52 Aligned_cols=86 Identities=37% Similarity=0.570 Sum_probs=78.0
Q ss_pred CCHHHHHHHhCCCCCceEEEeecCCCCCeeEEEEEecCCCCCCceeEEEEEEeCCcEEEecccCCCCCHHHHHHHhhhCC
Q psy3300 1 MIQEITLEVLSQEPVGAFMVRESTTKPGCFALSLRVPKEFHHLGIAHYLILRTAKGYKIKGFTKEFSSLTSLITHHSVMP 80 (97)
Q Consensus 1 isr~~ae~~L~~~~~G~fLiR~s~~~~~~~~Ls~~~~~~~~~~~v~h~~I~~~~~~~~l~~~~~~F~sl~~Lv~~y~~~~ 80 (97)
|+|++|+++|++.++|+||||.|++.++.|+||++.. +.++||+|...++++.+......|+||.|||+||+.++
T Consensus 7 i~r~~Ae~~L~~~~~G~FLiR~s~~~~~~~~Lsv~~~-----~~v~H~~I~~~~~~~~~~~~~~~f~sl~eLv~~y~~~~ 81 (94)
T cd00173 7 ISREEAEELLKKKPDGTFLVRDSESSPGDYVLSVRVK-----GKVKHYRIERTDDGYYLLGEGRSFPSLPELIEHYQKNP 81 (94)
T ss_pred CCHHHHHHHHhcCCCceEEEEecCCCCCCEEEEEEEC-----CEEEEEEEEECCCCeEEecCCCccCCHHHHHHHHhhCc
Confidence 7899999999988999999999998899999999996 79999999999888776654678999999999999998
Q ss_pred --CCcceeecCCC
Q psy3300 81 --ELLPCTLSLHR 91 (97)
Q Consensus 81 --~~l~~~L~~p~ 91 (97)
+++.+.|+.|+
T Consensus 82 ~~~~~~~~L~~p~ 94 (94)
T cd00173 82 LSDGLGVKLRYPV 94 (94)
T ss_pred cCCCcccEeCCcC
Confidence 78889998884
|
SH2 domains typically bind pTyr-containing ligands via two surface pockets, a pTyr and hydrophobic binding pocket, allowing proteins with SH2 domains to localize to tyrosine phosphorylated sites. |
| >smart00252 SH2 Src homology 2 domains | Back alignment and domain information |
|---|
| >PF00017 SH2: SH2 domain; InterPro: IPR000980 The Src homology 2 (SH2) domain is a protein domain of about 100 amino-acid residues first identified as a conserved sequence region between the oncoproteins Src and Fps [] | Back alignment and domain information |
|---|
| >KOG1930|consensus | Back alignment and domain information |
|---|
| >KOG4278|consensus | Back alignment and domain information |
|---|
| >KOG4637|consensus | Back alignment and domain information |
|---|
| >KOG4637|consensus | Back alignment and domain information |
|---|
| >KOG0197|consensus | Back alignment and domain information |
|---|
| >KOG0790|consensus | Back alignment and domain information |
|---|
| >KOG4226|consensus | Back alignment and domain information |
|---|
| >KOG2996|consensus | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >KOG4792|consensus | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >KOG0790|consensus | Back alignment and domain information |
|---|
| >KOG0194|consensus | Back alignment and domain information |
|---|
| >KOG3601|consensus | Back alignment and domain information |
|---|
| >PF14633 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A | Back alignment and domain information |
|---|
| >KOG3751|consensus | Back alignment and domain information |
|---|
| >PF14633 SH2_2: SH2 domain; PDB: 3GXX_A 3GXW_B 3PJP_B 2XP1_A | Back alignment and domain information |
|---|
| >KOG1856|consensus | Back alignment and domain information |
|---|
| >KOG4566|consensus | Back alignment and domain information |
|---|
| >KOG3697|consensus | Back alignment and domain information |
|---|
| >KOG1856|consensus | Back alignment and domain information |
|---|
| >PF02762 Cbl_N3: CBL proto-oncogene N-terminus, SH2-like domain; InterPro: IPR014742 Cbl (Casitas B-lineage lymphoma) is an adaptor protein that functions as a negative regulator of many signalling pathways that start from receptors at the cell surface | Back alignment and domain information |
|---|
| >KOG3667|consensus | Back alignment and domain information |
|---|
| >smart00557 IG_FLMN Filamin-type immunoglobulin domains | Back alignment and domain information |
|---|
| >KOG1785|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 97 | ||||
| 2kno_A | 131 | Nmr Solution Structure Of Sh2 Domain Of The Human T | 5e-08 | ||
| 2l6k_A | 123 | Solution Structure Of A Nonphosphorylated Peptide R | 5e-08 | ||
| 2ecd_A | 119 | Solution Structure Of The Human Abl2 Sh2 Domain Len | 1e-05 | ||
| 4f59_A | 112 | Triple Mutant Src Sh2 Domain Length = 112 | 3e-05 | ||
| 1jyq_A | 96 | Xray Structure Of Grb2 Sh2 Domain Complexed With A | 4e-05 | ||
| 1gri_A | 217 | Grb2 Length = 217 | 4e-05 | ||
| 2aoa_A | 99 | Crystal Structures Of A High-affinity Macrocyclic P | 5e-05 | ||
| 1ghu_A | 107 | Nmr Solution Structure Of Growth Factor Receptor-Bo | 5e-05 | ||
| 1kc2_A | 103 | Structure Of The Triple (Lys(Beta)d3ala, Asp(Beta)c | 5e-05 | ||
| 1cj1_A | 96 | Growth Factor Receptor Binding Protein Sh2 Domain ( | 5e-05 | ||
| 1bmb_A | 123 | Grb2-Sh2 Domain In Complex With KpfyVnvef (Pkf270-9 | 5e-05 | ||
| 3mxc_A | 101 | Structures Of Grb2-Sh2 Domain And Aicd Peptide Comp | 5e-05 | ||
| 1tze_E | 98 | Signal Transduction Adaptor Growth Factor, Grb2 Sh2 | 5e-05 | ||
| 1zfp_E | 98 | Growth Factor Receptor Binding Protein Sh2 Domain C | 6e-05 | ||
| 1fyr_A | 114 | Dimer Formation Through Domain Swapping In The Crys | 6e-05 | ||
| 1x0n_A | 104 | Nmr Structure Of Growth Factor Receptor Binding Pro | 6e-05 | ||
| 2h46_E | 116 | Native Domain-Swapped Dimer Crystal Structure Of Th | 6e-05 | ||
| 3n84_A | 112 | Crystal Structure Of The Grb2 Sh2 Domain In Complex | 6e-05 | ||
| 3ove_A | 117 | Crystal Structure Of The Grb2 Sh2 Domain In Complex | 6e-05 | ||
| 3imd_A | 117 | Crystal Structure Of The Grb2 Sh2 Domain In Complex | 6e-05 | ||
| 1bm2_A | 117 | Grb2-Sh2 Domain In Complex With Cyclo-[n-Alpha-Acet | 6e-05 | ||
| 1fhs_A | 112 | The Three-Dimensional Solution Structure Of The Src | 6e-05 | ||
| 3uf4_A | 164 | Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn P | 1e-04 | ||
| 1ab2_A | 109 | Three-Dimensional Solution Structure Of The Src Hom | 1e-04 | ||
| 1aot_F | 106 | Nmr Structure Of The Fyn Sh2 Domain Complexed With | 1e-04 | ||
| 1g83_A | 165 | Crystal Structure Of Fyn Sh3-Sh2 Length = 165 | 1e-04 | ||
| 2abl_A | 163 | Sh3-Sh2 Domain Fragment Of Human Bcr-Abl Tyrosine K | 2e-04 | ||
| 3k2m_A | 112 | Crystal Structure Of Monobody Ha4ABL1 SH2 DOMAIN CO | 2e-04 | ||
| 1a1a_A | 107 | C-Src (Sh2 Domain With C188a Mutation) Complexed Wi | 2e-04 | ||
| 1skj_A | 113 | Cocrystal Structure Of Urea-Substituted Phosphopept | 3e-04 | ||
| 1bkm_A | 113 | Cocrystal Structure Of D-Amino Acid Substituted Pho | 3e-04 | ||
| 1bkl_A | 113 | Self-Associated Apo Src Sh2 Domain Length = 113 | 3e-04 | ||
| 1is0_A | 106 | Crystal Structure Of A Complex Of The Src Sh2 Domai | 3e-04 | ||
| 1sha_A | 104 | Crystal Structure Of The Phosphotyrosine Recognitio | 3e-04 | ||
| 1p13_A | 102 | Crystal Structure Of The Src Sh2 Domain Complexed W | 3e-04 | ||
| 1nzl_A | 103 | Crystal Structure Of Src Sh2 Domain Bound To Doubly | 3e-04 | ||
| 1f1w_A | 104 | Src Sh2 Thref1trp Mutant Complexed With The Phospho | 3e-04 | ||
| 3t04_A | 123 | Crystal Structure Of Monobody 7c12ABL1 SH2 DOMAIN C | 3e-04 | ||
| 1opk_A | 495 | Structural Basis For The Auto-Inhibition Of C-Abl T | 3e-04 | ||
| 2fo0_A | 495 | Organization Of The Sh3-Sh2 Unit In Active And Inac | 3e-04 | ||
| 1shd_A | 107 | Peptide Inhibitors Of Src Sh3-Sh2-Phosphoprotein In | 4e-04 | ||
| 1opl_A | 537 | Structural Basis For The Auto-Inhibition Of C-Abl T | 4e-04 | ||
| 1o41_A | 108 | Crystal Structure Of Sh2 In Complex With Ru78300. L | 4e-04 | ||
| 1o4c_A | 108 | Crystal Structure Of Sh2 In Complex With Phosphate. | 4e-04 | ||
| 1bfi_A | 112 | Solution Structure Of The C-Terminal Sh2 Domain Of | 4e-04 | ||
| 1qad_A | 111 | Crystal Structure Of The C-Terminal Sh2 Domain Of T | 5e-04 | ||
| 2ptk_A | 453 | Chicken Src Tyrosine Kinase Length = 453 | 5e-04 | ||
| 1h9o_A | 112 | Phosphatidylinositol 3-Kinase, P85-Alpha Subunit: C | 6e-04 |
| >pdb|2KNO|A Chain A, Nmr Solution Structure Of Sh2 Domain Of The Human Tensin Like C1 Domain Containing Phosphatase (Tenc1) Length = 131 | Back alignment and structure |
|
| >pdb|2L6K|A Chain A, Solution Structure Of A Nonphosphorylated Peptide Recognizing Domain Length = 123 | Back alignment and structure |
| >pdb|2ECD|A Chain A, Solution Structure Of The Human Abl2 Sh2 Domain Length = 119 | Back alignment and structure |
| >pdb|4F59|A Chain A, Triple Mutant Src Sh2 Domain Length = 112 | Back alignment and structure |
| >pdb|1JYQ|A Chain A, Xray Structure Of Grb2 Sh2 Domain Complexed With A Highly Affine Phospho Peptide Length = 96 | Back alignment and structure |
| >pdb|1GRI|A Chain A, Grb2 Length = 217 | Back alignment and structure |
| >pdb|2AOA|A Chain A, Crystal Structures Of A High-affinity Macrocyclic Peptide Mimetic In Complex With The Grb2 Sh2 Domain Length = 99 | Back alignment and structure |
| >pdb|1GHU|A Chain A, Nmr Solution Structure Of Growth Factor Receptor-Bound Protein 2 (Grb2) Sh2 Domain, 24 Structures Length = 107 | Back alignment and structure |
| >pdb|1KC2|A Chain A, Structure Of The Triple (Lys(Beta)d3ala, Asp(Beta)c8ala, Aspcd2ala) Mutant Of The Src Sh2 Domain Bound To The Pqpyeeipi Peptide Length = 103 | Back alignment and structure |
| >pdb|1CJ1|A Chain A, Growth Factor Receptor Binding Protein Sh2 Domain (Human) Complexed With A Phosphotyrosyl Derivative Length = 96 | Back alignment and structure |
| >pdb|1BMB|A Chain A, Grb2-Sh2 Domain In Complex With KpfyVnvef (Pkf270-974) Length = 123 | Back alignment and structure |
| >pdb|3MXC|A Chain A, Structures Of Grb2-Sh2 Domain And Aicd Peptide Complexes Reveal A Conformational Switch And Their Functional Implications. Length = 101 | Back alignment and structure |
| >pdb|1TZE|E Chain E, Signal Transduction Adaptor Growth Factor, Grb2 Sh2 Domain Complexed With Phosphotyrosyl Heptapeptide Lys-Pro-Phe-Ptyr-Val-Asn-Val-Nh2 (Kfppyvnc-Nh2) Length = 98 | Back alignment and structure |
| >pdb|1ZFP|E Chain E, Growth Factor Receptor Binding Protein Sh2 Domain Complexed With A Phosphotyrosyl Pentapeptide Length = 98 | Back alignment and structure |
| >pdb|1FYR|A Chain A, Dimer Formation Through Domain Swapping In The Crystal Structure Of The Grb2-Sh2 Ac-Pyvnv Complex Length = 114 | Back alignment and structure |
| >pdb|1X0N|A Chain A, Nmr Structure Of Growth Factor Receptor Binding Protein Sh2 Domain Complexed With The Inhibitor Length = 104 | Back alignment and structure |
| >pdb|2H46|E Chain E, Native Domain-Swapped Dimer Crystal Structure Of The Grb2 Sh2 Domain Length = 116 | Back alignment and structure |
| >pdb|3N84|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A 23-Membered Macrocyclic Ligand Having The Sequence Pyvnvp Length = 112 | Back alignment and structure |
| >pdb|3OVE|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A Pyxn- Derived Tripeptide Length = 117 | Back alignment and structure |
| >pdb|3IMD|A Chain A, Crystal Structure Of The Grb2 Sh2 Domain In Complex With A Flexible Ac-Py-Q-N-Nh2 Tripeptide Mimic Length = 117 | Back alignment and structure |
| >pdb|1BM2|A Chain A, Grb2-Sh2 Domain In Complex With Cyclo-[n-Alpha-Acetyl-L-Thi Alysyl-O-Phosphotyrosyl-Valyl-Asparagyl-Valyl-Prolyl] (Pkf273-791) Length = 117 | Back alignment and structure |
| >pdb|1FHS|A Chain A, The Three-Dimensional Solution Structure Of The Src Homology Domain-2 Of The Growth Factor Receptor Bound Protein-2, Nmr, 18 Structures Length = 112 | Back alignment and structure |
| >pdb|3UF4|A Chain A, Crystal Structure Of A Sh3 And Sh2 Domains Of Fyn Protein (Proto- Concogene Tyrosine-Protein Kinase Fyn) From Mus Musculus At 1.98 A Resolution Length = 164 | Back alignment and structure |
| >pdb|1AB2|A Chain A, Three-Dimensional Solution Structure Of The Src Homology 2 Domain Of C-Abl Length = 109 | Back alignment and structure |
| >pdb|1AOT|F Chain F, Nmr Structure Of The Fyn Sh2 Domain Complexed With A Phosphotyrosyl Peptide, Minimized Average Structure Length = 106 | Back alignment and structure |
| >pdb|1G83|A Chain A, Crystal Structure Of Fyn Sh3-Sh2 Length = 165 | Back alignment and structure |
| >pdb|2ABL|A Chain A, Sh3-Sh2 Domain Fragment Of Human Bcr-Abl Tyrosine Kinase Length = 163 | Back alignment and structure |
| >pdb|3K2M|A Chain A, Crystal Structure Of Monobody Ha4ABL1 SH2 DOMAIN COMPLEX Length = 112 | Back alignment and structure |
| >pdb|1A1A|A Chain A, C-Src (Sh2 Domain With C188a Mutation) Complexed With Ace-Formyl Phosphotyr-Glu-(N,N-Dipentyl Amine) Length = 107 | Back alignment and structure |
| >pdb|1SKJ|A Chain A, Cocrystal Structure Of Urea-Substituted Phosphopeptide Complex Length = 113 | Back alignment and structure |
| >pdb|1BKM|A Chain A, Cocrystal Structure Of D-Amino Acid Substituted Phosphopeptide Complex Length = 113 | Back alignment and structure |
| >pdb|1BKL|A Chain A, Self-Associated Apo Src Sh2 Domain Length = 113 | Back alignment and structure |
| >pdb|1IS0|A Chain A, Crystal Structure Of A Complex Of The Src Sh2 Domain With Conformationally Constrained Peptide Inhibitor Length = 106 | Back alignment and structure |
| >pdb|1SHA|A Chain A, Crystal Structure Of The Phosphotyrosine Recognition Domain Sh2 Of V-Src Complexed With Tyrosine-Phosphorylated Peptides Length = 104 | Back alignment and structure |
| >pdb|1P13|A Chain A, Crystal Structure Of The Src Sh2 Domain Complexed With Peptide (Sdpyanfk) Length = 102 | Back alignment and structure |
| >pdb|1NZL|A Chain A, Crystal Structure Of Src Sh2 Domain Bound To Doubly Phosphorylated Peptide Pqpyepyipi Length = 103 | Back alignment and structure |
| >pdb|1F1W|A Chain A, Src Sh2 Thref1trp Mutant Complexed With The Phosphopeptide S(Ptr)vnvqn Length = 104 | Back alignment and structure |
| >pdb|3T04|A Chain A, Crystal Structure Of Monobody 7c12ABL1 SH2 DOMAIN COMPLEX Length = 123 | Back alignment and structure |
| >pdb|1OPK|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 495 | Back alignment and structure |
| >pdb|1SHD|A Chain A, Peptide Inhibitors Of Src Sh3-Sh2-Phosphoprotein Interactions Length = 107 | Back alignment and structure |
| >pdb|1OPL|A Chain A, Structural Basis For The Auto-Inhibition Of C-Abl Tyrosine Kinase Length = 537 | Back alignment and structure |
| >pdb|1O41|A Chain A, Crystal Structure Of Sh2 In Complex With Ru78300. Length = 108 | Back alignment and structure |
| >pdb|1O4C|A Chain A, Crystal Structure Of Sh2 In Complex With Phosphate. Length = 108 | Back alignment and structure |
| >pdb|1BFI|A Chain A, Solution Structure Of The C-Terminal Sh2 Domain Of The P85alpha Regulatory Subunit Of Phosphoinositide 3-Kinase, Nmr, 30 Structures Length = 112 | Back alignment and structure |
| >pdb|1QAD|A Chain A, Crystal Structure Of The C-Terminal Sh2 Domain Of The P85 Alpha Regulatory Subunit Of Phosphoinositide 3-Kinase: An Sh2 Domain Mimicking Its Own Substrate Length = 111 | Back alignment and structure |
| >pdb|2PTK|A Chain A, Chicken Src Tyrosine Kinase Length = 453 | Back alignment and structure |
| >pdb|1H9O|A Chain A, Phosphatidylinositol 3-Kinase, P85-Alpha Subunit: C-Terminal Sh2 Domain Complexed With A Tyr751 Phosphopeptide From The Pdgf Receptor, Crystal Structure At 1.79 A Length = 112 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 97 | |||
| 2kno_A | 131 | Tensin-like C1 domain-containing phosphatase; SH2 | 1e-27 | |
| 1aot_F | 106 | FYN protein-tyrosine kinase; SH2 domain, signal tr | 1e-18 | |
| 3eaz_A | 106 | Tyrosine-protein kinase CSK; SH2, disulfide, oxidi | 1e-18 | |
| 1lkk_A | 105 | Human P56 tyrosine kinase; complex (tyrosine kinas | 2e-18 | |
| 3pqz_A | 117 | Growth factor receptor-bound protein 7; SH2, binds | 7e-18 | |
| 2ecd_A | 119 | Tyrosine-protein kinase ABL2; SH2 domain, phosphot | 1e-17 | |
| 3us4_A | 98 | Megakaryocyte-associated tyrosine-protein kinase; | 2e-17 | |
| 3tkz_A | 109 | Tyrosine-protein phosphatase non-receptor type 11; | 3e-17 | |
| 1nrv_A | 105 | Growth factor receptor-bound protein 10; dimer, si | 3e-17 | |
| 3k2m_A | 112 | Proto-oncogene tyrosine-protein kinase ABL1; engin | 7e-17 | |
| 2ysx_A | 119 | Signaling inositol polyphosphate phosphatase SHIP | 9e-17 | |
| 2dly_A | 121 | FYN-related kinase; BRK family kinase, structural | 1e-16 | |
| 2aug_A | 126 | Growth factor receptor-bound protein 14; phosphory | 4e-16 | |
| 3ov1_A | 117 | Growth factor receptor-bound protein 2; GRB2 SH2 d | 4e-16 | |
| 2gsb_A | 119 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 5e-16 | |
| 1rja_A | 100 | Tyrosine-protein kinase 6; human protein tyrosine | 5e-16 | |
| 2dlz_A | 118 | Protein VAV-2; RHO family guanine nucleotide excha | 6e-16 | |
| 1i3z_A | 103 | EWS/FLI1 activated transcript 2; SH2 domain phosph | 7e-16 | |
| 2eo3_A | 111 | CRK-like protein; phosphorylation, repeat, SH2 dom | 1e-15 | |
| 1r1p_A | 100 | GRB2-related adaptor protein 2; SH2, GADS, phospho | 1e-15 | |
| 1blj_A | 114 | P55 BLK protein tyrosine kinase; signal transducti | 2e-15 | |
| 2y3a_B | 302 | Phosphatidylinositol 3-kinase regulatory subunit; | 2e-15 | |
| 2cs0_A | 119 | Hematopoietic SH2 domain containing; ALX, FLJ14886 | 2e-15 | |
| 1ka6_A | 128 | SH2 domain protein 1A; SH2 domain, protein-peptide | 5e-15 | |
| 1h9o_A | 112 | Phosphatidylinositol 3-kinase; transferase/recepto | 5e-15 | |
| 1d4t_A | 104 | T cell signal transduction molecule SAP; SH2 domai | 6e-15 | |
| 2ekx_A | 110 | Cytoplasmic tyrosine-protein kinase BMX; SH2 domai | 7e-15 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 7e-15 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 1e-12 | |
| 2crh_A | 138 | VAV proto-oncogene; oncoprotein, structural genomi | 7e-15 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 8e-15 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 2e-13 | |
| 1jyr_A | 96 | Growth factor receptor-bound protein 2; receptor b | 9e-15 | |
| 2dm0_A | 125 | Tyrosine-protein kinase TXK; TEC family kinase, st | 9e-15 | |
| 2ge9_A | 125 | Tyrosine-protein kinase BTK; SH2 domain, structure | 1e-14 | |
| 2cia_A | 102 | Cytoplasmic protein NCK2; SH2-domain, SH3 domain, | 6e-14 | |
| 3gqi_B | 226 | Phospholipase C-gamma-1; phosphorylated kinase, PY | 7e-14 | |
| 3gqi_B | 226 | Phospholipase C-gamma-1; phosphorylated kinase, PY | 9e-10 | |
| 2kk6_A | 116 | Proto-oncogene tyrosine-protein kinase FER; method | 1e-13 | |
| 2hdv_A | 111 | SH2-B PH domain containing signaling mediator 1 ga | 1e-13 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 1e-13 | |
| 2eob_A | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 2e-13 | |
| 2bbu_A | 164 | Suppressor of cytokine signaling 3; SH2 domain, ex | 2e-13 | |
| 3s9k_A | 118 | Tyrosine-protein kinase ITK/TSK; proline isomeriza | 5e-13 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 5e-13 | |
| 2vif_A | 141 | Suppressor of cytokine signalling 6; growth regula | 9e-13 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 1e-12 | |
| 1ju5_A | 109 | CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid | 2e-12 | |
| 2dx0_A | 138 | Phospholipase C, gamma 2; phosphoric diester hydro | 3e-12 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 3e-12 | |
| 1mil_A | 104 | SHC adaptor protein; SH2 domain, phosphorylation, | 3e-12 | |
| 3maz_A | 125 | Signal-transducing adaptor protein 1; modular doma | 4e-12 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 7e-12 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 9e-08 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 7e-12 | |
| 2izv_A | 187 | Suppressor of cytokine signaling 4; signal transdu | 9e-12 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 9e-12 | |
| 2iug_A | 120 | Phosphatidylinositol 3-kinase regulatory alpha sub | 2e-11 | |
| 2c9w_A | 169 | Suppressor of cytokine signaling 2; growth regulat | 3e-11 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 3e-10 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 3e-09 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 1e-09 | |
| 1wqu_A | 114 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 2e-09 | |
| 2hmh_A | 152 | Suppressor of cytokine signaling 3; SOCS3, GP130, | 4e-09 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 5e-09 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 6e-09 | |
| 2eo6_A | 141 | B-cell linker protein; SH2, cytoplasmic adapter pr | 9e-09 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 2e-07 | |
| 2el8_A | 118 | Signal-transducing adaptor protein 2; SH2 domain, | 7e-07 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 2e-06 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 3e-06 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 3e-06 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 7e-06 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 8e-04 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 1e-05 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 3e-04 | |
| 1uur_A | 473 | Stata protein, STAT protein; transcription activat | 4e-04 |
| >2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A Length = 131 | Back alignment and structure |
|---|
Score = 96.5 bits (240), Expect = 1e-27
Identities = 31/94 (32%), Positives = 48/94 (51%), Gaps = 12/94 (12%)
Query: 8 EVLSQEPVGAFMVRESTTKPGCFALSLRVPKEFHHLG----------IAHYLILRTAKGY 57
+L + GAF++R+S + G + L+L+V + H+LI KG
Sbjct: 34 ALLKDKDPGAFLIRDSHSFQGAYGLALKVATPPPSAQPWKGDPVEQLVRHFLIETGPKGV 93
Query: 58 KIKGFTKE--FSSLTSLITHHSVMPELLPCTLSL 89
KIKG E F SL++L++ HS+ P LPC L +
Sbjct: 94 KIKGCPSEPYFGSLSALVSQHSISPISLPCCLRI 127
|
| >1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* Length = 106 | Back alignment and structure |
|---|
| >3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A Length = 106 | Back alignment and structure |
|---|
| >1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* Length = 105 | Back alignment and structure |
|---|
| >3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A Length = 117 | Back alignment and structure |
|---|
| >2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} PDB: 1jwo_A Length = 98 | Back alignment and structure |
|---|
| >3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Length = 109 | Back alignment and structure |
|---|
| >1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A Length = 105 | Back alignment and structure |
|---|
| >3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A Length = 112 | Back alignment and structure |
|---|
| >2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 121 | Back alignment and structure |
|---|
| >2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... Length = 117 | Back alignment and structure |
|---|
| >2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 119 | Back alignment and structure |
|---|
| >1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 100 | Back alignment and structure |
|---|
| >2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 Length = 103 | Back alignment and structure |
|---|
| >2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 111 | Back alignment and structure |
|---|
| >1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* Length = 100 | Back alignment and structure |
|---|
| >1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A Length = 114 | Back alignment and structure |
|---|
| >2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} Length = 302 | Back alignment and structure |
|---|
| >2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 119 | Back alignment and structure |
|---|
| >1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A Length = 128 | Back alignment and structure |
|---|
| >1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A Length = 112 | Back alignment and structure |
|---|
| >1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* Length = 104 | Back alignment and structure |
|---|
| >2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} Length = 110 | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* Length = 254 | Back alignment and structure |
|---|
| >2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* Length = 138 | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A Length = 254 | Back alignment and structure |
|---|
| >1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* Length = 96 | Back alignment and structure |
|---|
| >2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* Length = 102 | Back alignment and structure |
|---|
| >3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 | Back alignment and structure |
|---|
| >3gqi_B Phospholipase C-gamma-1; phosphorylated kinase, PY-recognition, tandem SH2 domains, A analog, ATP-binding, craniosynostosis, disease mutation; HET: PTR DVT ACP; 2.50A {Rattus norvegicus} PDB: 2fci_A* 2pld_A* 2ple_A* Length = 226 | Back alignment and structure |
|---|
| >2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} Length = 116 | Back alignment and structure |
|---|
| >2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* Length = 111 | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 | Back alignment and structure |
|---|
| >2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} Length = 124 | Back alignment and structure |
|---|
| >2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} Length = 164 | Back alignment and structure |
|---|
| >3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B Length = 118 | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 | Back alignment and structure |
|---|
| >2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} Length = 141 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 | Back alignment and structure |
|---|
| >1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 Length = 109 | Back alignment and structure |
|---|
| >2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} Length = 138 | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 | Back alignment and structure |
|---|
| >1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* Length = 104 | Back alignment and structure |
|---|
| >3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} Length = 125 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 | Back alignment and structure |
|---|
| >2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 187 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 | Back alignment and structure |
|---|
| >2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A Length = 120 | Back alignment and structure |
|---|
| >2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 Length = 169 | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A Length = 373 | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 | Back alignment and structure |
|---|
| >1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A Length = 114 | Back alignment and structure |
|---|
| >2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} Length = 152 | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 | Back alignment and structure |
|---|
| >2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} Length = 141 | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 | Back alignment and structure |
|---|
| >2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} Length = 118 | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Length = 532 | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} Length = 595 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 Length = 525 | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 | Back alignment and structure |
|---|
| >1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* Length = 473 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 97 | |||
| 3us4_A | 98 | Megakaryocyte-associated tyrosine-protein kinase; | 99.96 | |
| 1rja_A | 100 | Tyrosine-protein kinase 6; human protein tyrosine | 99.96 | |
| 1lkk_A | 105 | Human P56 tyrosine kinase; complex (tyrosine kinas | 99.96 | |
| 3eaz_A | 106 | Tyrosine-protein kinase CSK; SH2, disulfide, oxidi | 99.96 | |
| 2kno_A | 131 | Tensin-like C1 domain-containing phosphatase; SH2 | 99.95 | |
| 3k2m_A | 112 | Proto-oncogene tyrosine-protein kinase ABL1; engin | 99.95 | |
| 1blj_A | 114 | P55 BLK protein tyrosine kinase; signal transducti | 99.95 | |
| 1d4t_A | 104 | T cell signal transduction molecule SAP; SH2 domai | 99.95 | |
| 2lnw_A | 122 | VAV-2, guanine nucleotide exchange factor VAV2; si | 99.95 | |
| 2dlz_A | 118 | Protein VAV-2; RHO family guanine nucleotide excha | 99.95 | |
| 2dly_A | 121 | FYN-related kinase; BRK family kinase, structural | 99.95 | |
| 2ecd_A | 119 | Tyrosine-protein kinase ABL2; SH2 domain, phosphot | 99.95 | |
| 1i3z_A | 103 | EWS/FLI1 activated transcript 2; SH2 domain phosph | 99.95 | |
| 1aot_F | 106 | FYN protein-tyrosine kinase; SH2 domain, signal tr | 99.95 | |
| 2ysx_A | 119 | Signaling inositol polyphosphate phosphatase SHIP | 99.95 | |
| 1ka6_A | 128 | SH2 domain protein 1A; SH2 domain, protein-peptide | 99.95 | |
| 1nrv_A | 105 | Growth factor receptor-bound protein 10; dimer, si | 99.95 | |
| 1h9o_A | 112 | Phosphatidylinositol 3-kinase; transferase/recepto | 99.95 | |
| 2ge9_A | 125 | Tyrosine-protein kinase BTK; SH2 domain, structure | 99.94 | |
| 3pqz_A | 117 | Growth factor receptor-bound protein 7; SH2, binds | 99.94 | |
| 2ekx_A | 110 | Cytoplasmic tyrosine-protein kinase BMX; SH2 domai | 99.94 | |
| 2crh_A | 138 | VAV proto-oncogene; oncoprotein, structural genomi | 99.94 | |
| 2iug_A | 120 | Phosphatidylinositol 3-kinase regulatory alpha sub | 99.94 | |
| 3maz_A | 125 | Signal-transducing adaptor protein 1; modular doma | 99.94 | |
| 3s9k_A | 118 | Tyrosine-protein kinase ITK/TSK; proline isomeriza | 99.94 | |
| 2kk6_A | 116 | Proto-oncogene tyrosine-protein kinase FER; method | 99.94 | |
| 2aug_A | 126 | Growth factor receptor-bound protein 14; phosphory | 99.94 | |
| 2cs0_A | 119 | Hematopoietic SH2 domain containing; ALX, FLJ14886 | 99.94 | |
| 3tkz_A | 109 | Tyrosine-protein phosphatase non-receptor type 11; | 99.94 | |
| 2eo3_A | 111 | CRK-like protein; phosphorylation, repeat, SH2 dom | 99.93 | |
| 2dm0_A | 125 | Tyrosine-protein kinase TXK; TEC family kinase, st | 99.93 | |
| 2gsb_A | 119 | RAS GTPase-activating protein 1; GAP, RAS P21 prot | 99.93 | |
| 4d8k_A | 175 | Tyrosine-protein kinase LCK; protein kinases, SH2 | 99.93 | |
| 2eob_A | 124 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 99.93 | |
| 2vif_A | 141 | Suppressor of cytokine signalling 6; growth regula | 99.93 | |
| 2el8_A | 118 | Signal-transducing adaptor protein 2; SH2 domain, | 99.93 | |
| 2dx0_A | 138 | Phospholipase C, gamma 2; phosphoric diester hydro | 99.92 | |
| 1mil_A | 104 | SHC adaptor protein; SH2 domain, phosphorylation, | 99.92 | |
| 1ju5_A | 109 | CRK; CRK, SH2, SH3, adaptor protein, phosphopeptid | 99.92 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 99.92 | |
| 2c9w_A | 169 | Suppressor of cytokine signaling 2; growth regulat | 99.92 | |
| 2oq1_A | 254 | Tyrosine-protein kinase ZAP-70; tandem SH2 domains | 99.91 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 99.91 | |
| 2cia_A | 102 | Cytoplasmic protein NCK2; SH2-domain, SH3 domain, | 99.91 | |
| 2bbu_A | 164 | Suppressor of cytokine signaling 3; SH2 domain, ex | 99.91 | |
| 1r1p_A | 100 | GRB2-related adaptor protein 2; SH2, GADS, phospho | 99.91 | |
| 1a81_A | 254 | SYK kinase; complex (transferase-peptide), SYK, ki | 99.91 | |
| 2eo6_A | 141 | B-cell linker protein; SH2, cytoplasmic adapter pr | 99.91 | |
| 1jyr_A | 96 | Growth factor receptor-bound protein 2; receptor b | 99.91 | |
| 2hmh_A | 152 | Suppressor of cytokine signaling 3; SOCS3, GP130, | 99.91 | |
| 3ov1_A | 117 | Growth factor receptor-bound protein 2; GRB2 SH2 d | 99.9 | |
| 1wqu_A | 114 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 99.9 | |
| 2hdv_A | 111 | SH2-B PH domain containing signaling mediator 1 ga | 99.9 | |
| 2y3a_B | 302 | Phosphatidylinositol 3-kinase regulatory subunit; | 99.9 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 99.9 | |
| 2izv_A | 187 | Suppressor of cytokine signaling 4; signal transdu | 99.89 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 99.89 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 99.88 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 99.88 | |
| 4fbn_A | 246 | 1-phosphatidylinositol 4,5-bisphosphate phosphodi | 99.87 | |
| 2dvj_A | 230 | V-CRK sarcoma virus CT10 oncogene homolog, isoform | 99.86 | |
| 3qwx_X | 174 | Cell death abnormality protein 2; cell engulfment, | 99.86 | |
| 4fbn_A | 246 | 1-phosphatidylinositol 4,5-bisphosphate phosphodi | 99.86 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 99.86 | |
| 2eyz_A | 304 | V-CRK sarcoma virus CT10 oncogene homolog isoform | 99.86 | |
| 2lqn_A | 303 | CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT | 99.75 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 99.84 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 99.82 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 99.82 | |
| 3qwy_A | 308 | Cell death abnormality protein 2; cell engulfment, | 99.82 | |
| 3ps5_A | 595 | Tyrosine-protein phosphatase non-receptor type 6; | 99.81 | |
| 2cr4_A | 126 | 3BP-2, SH3 domain-binding protein 2; structural ge | 99.8 | |
| 2shp_A | 525 | SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin | 99.79 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 99.78 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 99.76 | |
| 2b3o_A | 532 | Tyrosine-protein phosphatase, non-receptor type 6; | 99.76 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 99.75 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 99.74 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 99.73 | |
| 3cxl_A | 463 | N-chimerin; SH2, RHO-GAP, structural genomics cons | 99.69 | |
| 1gri_A | 217 | Growth factor bound protein 2; SH2, SH3, signal tr | 99.67 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 99.61 | |
| 3hhm_B | 373 | NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidil | 99.58 | |
| 2xp1_A | 178 | SPT6; transcription, IWS1, histone chaperone, mRNA | 99.51 | |
| 3or8_A | 197 | Transcription elongation factor SPT6; SH2, CTD bin | 99.07 | |
| 1uur_A | 473 | Stata protein, STAT protein; transcription activat | 98.72 | |
| 2xp1_A | 178 | SPT6; transcription, IWS1, histone chaperone, mRNA | 98.5 | |
| 3or8_A | 197 | Transcription elongation factor SPT6; SH2, CTD bin | 98.35 | |
| 1yvl_A | 683 | Signal transducer and activator of transcription 1 | 98.29 | |
| 1bf5_A | 575 | Signal transducer and activator of transcription 1 | 98.17 | |
| 1y1u_A | 585 | Signal transducer and activator of transcription; | 98.17 | |
| 3bux_B | 329 | E3 ubiquitin-protein ligase CBL; TKB, signal trans | 98.09 | |
| 3op0_A | 323 | Signal transduction protein CBL-C; structural geno | 97.96 | |
| 1bg1_A | 596 | Protein (transcription factor STAT3B); protein-DNA | 97.82 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 97.66 | |
| 3psi_A | 1219 | Transcription elongation factor SPT6; nucleus; 3.3 | 95.24 | |
| 2ee9_A | 95 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 91.86 | |
| 2di8_A | 111 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 91.68 | |
| 2k9u_A | 119 | Gamma filamin; cytoskeletal complex, alternative s | 90.79 | |
| 2d7n_A | 93 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 90.7 | |
| 3rgh_A | 100 | Filamin-A; cell adhesion, cytoskeleton-complex, di | 90.69 | |
| 2eea_A | 115 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 90.61 | |
| 2bp3_A | 97 | Filamin A; structural protein, cytoskeleton/comple | 90.08 | |
| 2ds4_A | 113 | Tripartite motif protein 45; beta-sandwich, immuno | 89.99 | |
| 2d7o_A | 111 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 89.78 | |
| 2w0p_A | 94 | Filamin-A; alternative splicing, cytoskeleton/comp | 89.71 | |
| 2dj4_A | 108 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 88.9 | |
| 2dia_A | 113 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 88.64 | |
| 2e9j_A | 119 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 88.47 | |
| 2dmb_A | 124 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 88.46 | |
| 1v05_A | 96 | Filamin C; actin-binding protein, immunoglobulin; | 88.2 | |
| 2di9_A | 131 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 87.47 | |
| 2d7p_A | 112 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 87.24 | |
| 2dic_A | 105 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 87.09 | |
| 2dlg_A | 102 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 87.01 | |
| 2ee6_A | 105 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 86.66 | |
| 3cnk_A | 89 | Filamin-A; FLNA24, X-RAY crystalography, homodimer | 86.57 | |
| 2d7m_A | 115 | Filamin-C; beta-sandwich, immunoglobulin-like fold | 86.36 | |
| 2dib_A | 128 | Filamin-B; beta-sandwich, immunoglobulin-like fold | 81.51 | |
| 2di7_A | 124 | BK158_1; beta-sandwich, immunoglobulin-like fold, | 80.95 |
| >3us4_A Megakaryocyte-associated tyrosine-protein kinase; SH2 domain, signaling protein, structural genomics, joint CE structural genomics, JCSG; 1.50A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jwo_A | Back alignment and structure |
|---|
Probab=99.96 E-value=3.5e-29 Score=141.56 Aligned_cols=87 Identities=22% Similarity=0.324 Sum_probs=80.4
Q ss_pred CCHHHHHHHhCCCCCceEEEeecCCCCCeeEEEEEecCCCCCCceeEEEEEEeCCcEEEecccCCCCCHHHHHHHhhhCC
Q psy3300 1 MIQEITLEVLSQEPVGAFMVRESTTKPGCFALSLRVPKEFHHLGIAHYLILRTAKGYKIKGFTKEFSSLTSLITHHSVMP 80 (97)
Q Consensus 1 isr~~ae~~L~~~~~G~fLiR~s~~~~~~~~Ls~~~~~~~~~~~v~h~~I~~~~~~~~l~~~~~~F~sl~~Lv~~y~~~~ 80 (97)
|+|++||++|+..++|+||||+|++.+|.|+||++.. +.++||+|...+++|++.+ ...|+||.+||+||+.++
T Consensus 12 isr~~Ae~lL~~~~~G~FLVR~S~~~~g~y~LSv~~~-----~~v~H~~I~~~~~~~~~~~-~~~F~sl~~Lv~~y~~~~ 85 (98)
T 3us4_A 12 ISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFG-----RDVIHYRVLHRDGHLTIDE-AVFFCNLMDMVEHYSKDK 85 (98)
T ss_dssp CCHHHHHHHTCSCCTTCEEEEECSSSTTCEEEEEEET-----TEEEEEEEEEETTEEESSS-SSEESSHHHHHHHHHHCC
T ss_pred CCHHHHHHHccCCCCcEEEEEeCCCCCCcEEEEEEEC-----CceEEEEEEEeCCEEEECC-CCccCCHHHHHHHhhhCC
Confidence 7899999999887999999999999999999999995 8999999998777788876 778999999999999999
Q ss_pred CCcceeecCCCCC
Q psy3300 81 ELLPCTLSLHRYN 93 (97)
Q Consensus 81 ~~l~~~L~~p~~~ 93 (97)
++++|+|..|+++
T Consensus 86 ~~l~~~L~~P~pk 98 (98)
T 3us4_A 86 GAICTKLVRPKRK 98 (98)
T ss_dssp TTSSSCCCSBCCC
T ss_pred CCCeEcCCccCCC
Confidence 9999999999864
|
| >1rja_A Tyrosine-protein kinase 6; human protein tyrosine kinase-6 (PTK6/BRK), SRC homology 2(S domain, solution structure, backbone dynamics, transferase; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >1lkk_A Human P56 tyrosine kinase; complex (tyrosine kinase/peptide); HET: PTR; 1.00A {Homo sapiens} SCOP: d.93.1.1 PDB: 1lcj_A* 1bhf_A* 1bhh_A 1lkl_A* 1bhh_B 1fbz_A* 1ijr_A* 1cwd_L* 1cwe_A* | Back alignment and structure |
|---|
| >3eaz_A Tyrosine-protein kinase CSK; SH2, disulfide, oxidized reduced, ATP-binding, cell membrane, cytoplasm, membrane, nucleotide-binding, phosphoprotein; 1.31A {Homo sapiens} PDB: 3eac_A | Back alignment and structure |
|---|
| >2kno_A Tensin-like C1 domain-containing phosphatase; SH2 domain, TENC1, solution structure, cell junctio membrane, hydrolase, membrane, metal-binding; NMR {Homo sapiens} PDB: 2l6k_A | Back alignment and structure |
|---|
| >3k2m_A Proto-oncogene tyrosine-protein kinase ABL1; engineered binding protein, antibody mimic, protein-protein SH2 domain, ATP-binding, phosphoprotein; 1.75A {Homo sapiens} PDB: 3uyo_A 3t04_A 1ab2_A | Back alignment and structure |
|---|
| >1blj_A P55 BLK protein tyrosine kinase; signal transduction, transferase, phosphotransferase, phosphorylation; NMR {Mus musculus} SCOP: d.93.1.1 PDB: 1blk_A | Back alignment and structure |
|---|
| >1d4t_A T cell signal transduction molecule SAP; SH2 domain, tyrosine kinase, signal transduction, peptide recognition, signaling protein; 1.10A {Homo sapiens} SCOP: d.93.1.1 PDB: 1d1z_A 1d4w_A* 1m27_A* | Back alignment and structure |
|---|
| >2lnw_A VAV-2, guanine nucleotide exchange factor VAV2; signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2lnx_A | Back alignment and structure |
|---|
| >2dlz_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dly_A FYN-related kinase; BRK family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ecd_A Tyrosine-protein kinase ABL2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1i3z_A EWS/FLI1 activated transcript 2; SH2 domain phosphotyrosine signal transduction lymphocyte, signaling protein; HET: PTR; 2.15A {Mus musculus} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >1aot_F FYN protein-tyrosine kinase; SH2 domain, signal transduction, peptide complex, complex (proto-oncogene/early protein); HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1aou_F* | Back alignment and structure |
|---|
| >2ysx_A Signaling inositol polyphosphate phosphatase SHIP II; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ka6_A SH2 domain protein 1A; SH2 domain, protein-peptide complex, immune system; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 PDB: 1ka7_A | Back alignment and structure |
|---|
| >1nrv_A Growth factor receptor-bound protein 10; dimer, signaling protein; 1.65A {Homo sapiens} SCOP: d.93.1.1 PDB: 3m7f_A | Back alignment and structure |
|---|
| >1h9o_A Phosphatidylinositol 3-kinase; transferase/receptor, complex (phosphotransferase/receptor), phosphotransferase, SH2 domain; HET: PTR; 1.79A {Homo sapiens} SCOP: d.93.1.1 PDB: 1pic_A* 1bfi_A 1bfj_A 1qad_A | Back alignment and structure |
|---|
| >2ge9_A Tyrosine-protein kinase BTK; SH2 domain, structure, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3pqz_A Growth factor receptor-bound protein 7; SH2, binds phosphotyrosine, tyrosine kinases, cytoplasmic, P binding; 2.41A {Homo sapiens} PDB: 1mw4_A* 2l4k_A* 2qms_A | Back alignment and structure |
|---|
| >2ekx_A Cytoplasmic tyrosine-protein kinase BMX; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2crh_A VAV proto-oncogene; oncoprotein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2ror_A* 2lct_A* | Back alignment and structure |
|---|
| >2iug_A Phosphatidylinositol 3-kinase regulatory alpha subunit; transferase, polymorphism, UBL conjugation, phosphorylation, SH2, PI3K, SH2 domain; 1.89A {Homo sapiens} PDB: 2iuh_A* 2iui_A* 1fu5_A* 1fu6_A 1oo3_A 1oo4_A* 2pna_A 2pnb_A | Back alignment and structure |
|---|
| >3maz_A Signal-transducing adaptor protein 1; modular domain, phosphotyrosine, specificity, cytoplasm, phosphoprotein, SH2 domain, signaling protein; HET: PTR; 1.90A {Homo sapiens} | Back alignment and structure |
|---|
| >3s9k_A Tyrosine-protein kinase ITK/TSK; proline isomerization, CIS proline, domain swapped dimer, SH transferase; HET: CIT; 2.35A {Mus musculus} PDB: 2etz_A* 2eu0_A* 1lui_A 1luk_A 1lum_A 1lun_A 2k79_B 2k7a_B | Back alignment and structure |
|---|
| >2kk6_A Proto-oncogene tyrosine-protein kinase FER; methods development, SH2, NESG, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2aug_A Growth factor receptor-bound protein 14; phosphorylation, SH2 domain, signaling protein; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2cs0_A Hematopoietic SH2 domain containing; ALX, FLJ14886, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >3tkz_A Tyrosine-protein phosphatase non-receptor type 11; SH2 domain, protein protein interactions, PTR residues, HYDR peptide complex; HET: PTR; 1.80A {Homo sapiens} PDB: 3tl0_A* 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A | Back alignment and structure |
|---|
| >2eo3_A CRK-like protein; phosphorylation, repeat, SH2 domain, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dm0_A Tyrosine-protein kinase TXK; TEC family kinase, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2gsb_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* | Back alignment and structure |
|---|
| >2eob_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 2; SH2, phosphoinositide phospholipase C, PLC-gamma-2, phospholipase C-gamma-2; NMR {Rattus norvegicus} | Back alignment and structure |
|---|
| >2vif_A Suppressor of cytokine signalling 6; growth regulation, signal transduction inhibitor, KIT regula phosphotyrosine, signaling protein; HET: PTR; 1.45A {Homo sapiens} | Back alignment and structure |
|---|
| >2el8_A Signal-transducing adaptor protein 2; SH2 domain, phosphotyrosine binding domain, protein tyrosine kinase, signal transduction, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dx0_A Phospholipase C, gamma 2; phosphoric diester hydrolase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1mil_A SHC adaptor protein; SH2 domain, phosphorylation, collagen, growth regulation, transforming protein, alternative initiation; 2.70A {Homo sapiens} SCOP: d.93.1.1 PDB: 1tce_A* | Back alignment and structure |
|---|
| >1ju5_A CRK; CRK, SH2, SH3, adaptor protein, phosphopeptide, protein binding/transferase complex; HET: PTR; NMR {Homo sapiens} SCOP: d.93.1.1 | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A | Back alignment and structure |
|---|
| >2c9w_A Suppressor of cytokine signaling 2; growth regulation, SH2 domain, signal transduction inhibitor nuclear protein; 1.9A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >2oq1_A Tyrosine-protein kinase ZAP-70; tandem SH2 domains, ZAP-70, tyrosine kinase, transferase; HET: PTR; 1.90A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1m61_A | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >2cia_A Cytoplasmic protein NCK2; SH2-domain, SH3 domain, phosphorylation, binding specificity; HET: PTR MPD; 1.45A {Homo sapiens} PDB: 1z3k_A 2ci9_A* 2ci8_A* | Back alignment and structure |
|---|
| >2bbu_A Suppressor of cytokine signaling 3; SH2 domain, extended SH2 subdomain, PEST motif, protein complex, cytokine regulator; HET: PTR; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1r1p_A GRB2-related adaptor protein 2; SH2, GADS, phosphopeptide, peptide binding protein; HET: PTR; 1.80A {Mus musculus} SCOP: d.93.1.1 PDB: 1r1q_A* 1r1s_A* | Back alignment and structure |
|---|
| >1a81_A SYK kinase; complex (transferase-peptide), SYK, kinase, SH2 domain; HET: PTR; 3.00A {Homo sapiens} SCOP: d.93.1.1 d.93.1.1 PDB: 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >2eo6_A B-cell linker protein; SH2, cytoplasmic adapter protein, B-cell adapter containing SH2 domain protein; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1jyr_A Growth factor receptor-bound protein 2; receptor binding, regulatory, inhibitor, signaling protein-I complex; HET: PTR; 1.55A {Homo sapiens} SCOP: d.93.1.1 PDB: 1jyq_A* 1jyu_A 1qg1_E* 1x0n_A* 2aob_A* 2aoa_A* 3n7y_A* 1tze_E* 1zfp_E* 3mxc_A* 3mxy_A* 1cj1_A* | Back alignment and structure |
|---|
| >2hmh_A Suppressor of cytokine signaling 3; SOCS3, GP130, PTyr, peptide complex, cytokine regulator; HET: PTR; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3ov1_A Growth factor receptor-bound protein 2; GRB2 SH2 domain, phosphotyrosine binding, signaling protein, signaling protein-antagonist complex; HET: PTR; 1.60A {Homo sapiens} SCOP: d.93.1.1 PDB: 3imj_A* 3in7_A* 3imd_A* 3kfj_A* 3n8m_A* 3in8_A* 3s8l_A* 3s8n_A* 3s8o_A* 2huy_A* 2h5k_A* 2huw_A* 2h46_E* 3c7i_A* 3n84_A* 1fhs_A 1bm2_A* 1bmb_A* 3ove_A* 1fyr_A* ... | Back alignment and structure |
|---|
| >1wqu_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; SH2 domain, feline sarcoma oncogene, structural genomics; NMR {Homo sapiens} PDB: 2dcr_A | Back alignment and structure |
|---|
| >2hdv_A SH2-B PH domain containing signaling mediator 1 gamma isoform; adapter protein, signaling protein; 2.00A {Mus musculus} PDB: 2hdx_A* 1rpy_A 1rqq_C* | Back alignment and structure |
|---|
| >2y3a_B Phosphatidylinositol 3-kinase regulatory subunit; transferase, phosphoinositide 3-kinase, RTK; HET: GD9; 3.30A {Mus musculus} | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2izv_A Suppressor of cytokine signaling 4; signal transduction inhibitor, growth regulation, signal transduction, SH2 domain, nuclear protein; 2.55A {Homo sapiens} SCOP: a.271.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* | Back alignment and structure |
|---|
| >2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A | Back alignment and structure |
|---|
| >3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >4fbn_A 1-phosphatidylinositol 4,5-bisphosphate phosphodi gamma-1; SH2 domain, plcgamma specific array, interaction domain, FIB growth factor receptor 1; 2.40A {Homo sapiens} PDB: 4ey0_A* 3gqi_B* 2fci_A* 2pld_A* 2ple_A* | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A | Back alignment and structure |
|---|
| >2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3ps5_A Tyrosine-protein phosphatase non-receptor type 6; SH2, PTP, hydrolase, signaling protein; 3.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2cr4_A 3BP-2, SH3 domain-binding protein 2; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >3cxl_A N-chimerin; SH2, RHO-GAP, structural genomics consortium, SGC, gtpas activation, metal-binding, phorbol-ester binding, SH2 domai finger; 2.60A {Homo sapiens} PDB: 1xa6_A | Back alignment and structure |
|---|
| >1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >3hhm_B NISH2 P85alpha; PI3KCA, PI3K, PIK3R1, phosphatidilynositol 3,4,5- triphosphate, wortmannin, H1047R, ATP-binding, disease mutation, kinase; HET: KWT; 2.80A {Homo sapiens} PDB: 3hiz_B 2rd0_B 4a55_B* 3mtt_A | Back alignment and structure |
|---|
| >2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} | Back alignment and structure |
|---|
| >1uur_A Stata protein, STAT protein; transcription activator, SH2, signal transduction, transducer, transcription factor; HET: PTR; 2.7A {Dictyostelium discoideum} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 1uus_A* | Back alignment and structure |
|---|
| >2xp1_A SPT6; transcription, IWS1, histone chaperone, mRNA export; 2.20A {Antonospora locustae} | Back alignment and structure |
|---|
| >1yvl_A Signal transducer and activator of transcription 1-alpha/beta; signaling protein; HET: PTR; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1bf5_A Signal transducer and activator of transcription 1-alpha/beta; complex (SH2 domain/DNA), SH2 domain, transcription factor; HET: DNA PTR; 2.90A {Homo sapiens} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 | Back alignment and structure |
|---|
| >1y1u_A Signal transducer and activator of transcription; STAT, DNA-binding, SH2 domain, transcription REGU signaling protein; 3.21A {Mus musculus} | Back alignment and structure |
|---|
| >3bux_B E3 ubiquitin-protein ligase CBL; TKB, signal transduction, proto-oncogene, complex, ATP-binding, glycoprotein, kinase, membrane, nucleotide-binding; HET: PTR; 1.35A {Homo sapiens} SCOP: a.39.1.7 a.48.1.1 d.93.1.1 PDB: 1yvh_A* 3bun_B* 3buo_B* 3bum_B* 3buw_B* 3ob1_B* 3ob2_B* 3plf_B* 2cbl_A* 1b47_A 3pfv_A* | Back alignment and structure |
|---|
| >3op0_A Signal transduction protein CBL-C; structural genomics, structural genomics consortium, SGC, SI transduction protein, SH3-binding protein; HET: PTR; 2.52A {Homo sapiens} | Back alignment and structure |
|---|
| >1bg1_A Protein (transcription factor STAT3B); protein-DNA complex, cytokine activation, complex (transcription factor/DNA), transcription/DNA complex; HET: DNA PTR; 2.25A {Mus musculus} SCOP: a.47.1.1 b.2.5.5 d.93.1.1 PDB: 3cwg_A | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3psi_A Transcription elongation factor SPT6; nucleus; 3.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2ee9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2di8_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2k9u_A Gamma filamin; cytoskeletal complex, alternative splicing, cell adhesion, cell junction, cell shape, cytoplasm, cytoskeleton; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d7n_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >3rgh_A Filamin-A; cell adhesion, cytoskeleton-complex, disease mutation, immun like, cytoskeleton, actin-binding, cell junction, shape; HET: CME; 2.44A {Homo sapiens} SCOP: b.1.18.0 | Back alignment and structure |
|---|
| >2eea_A Filamin-B; beta-sandwich, immunoglobulin-like fold, interaction with GP1BA, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2bp3_A Filamin A; structural protein, cytoskeleton/complex, actin binding protein, cytoskeleton, complex; 2.32A {Homo sapiens} SCOP: b.1.18.10 PDB: 2aav_A | Back alignment and structure |
|---|
| >2ds4_A Tripartite motif protein 45; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d7o_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2w0p_A Filamin-A; alternative splicing, cytoskeleton/complex, phosphoprotein, disease mutation, immunoglobulin like, zinc, complex; 1.90A {Homo sapiens} SCOP: b.1.18.10 PDB: 2brq_A* 2jf1_A 3isw_A | Back alignment and structure |
|---|
| >2dj4_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2dia_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2e9j_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dmb_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >1v05_A Filamin C; actin-binding protein, immunoglobulin; 1.43A {Homo sapiens} SCOP: b.1.18.10 PDB: 2eed_A | Back alignment and structure |
|---|
| >2di9_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2d7p_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 PDB: 2eeb_A | Back alignment and structure |
|---|
| >2dic_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2dlg_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2ee6_A Filamin-B; beta-sandwich, immunoglobulin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3cnk_A Filamin-A; FLNA24, X-RAY crystalography, homodimer, acetylation, actin-binding, cytoplasm, cytoskeleton, disease mutation, phosphoprotein; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2d7m_A Filamin-C; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2dib_A Filamin-B; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.18.10 | Back alignment and structure |
|---|
| >2di7_A BK158_1; beta-sandwich, immunoglobulin-like fold, filamin domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 97 | ||||
| d1o48a_ | 106 | d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo s | 9e-16 | |
| d1lkka_ | 105 | d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo | 1e-15 | |
| d1g83a2 | 104 | d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (H | 2e-15 | |
| d1qcfa2 | 103 | d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {H | 3e-15 | |
| d1uura3 | 131 | d.93.1.1 (A:577-707) STAT homologue {Dictyostelium | 3e-14 | |
| d1nrva_ | 105 | d.93.1.1 (A:) Growth factor receptor-bound protein | 6e-14 | |
| d1opka2 | 101 | d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (M | 1e-13 | |
| d2oq1a1 | 130 | d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 | 3e-13 | |
| d2qmsa1 | 113 | d.93.1.1 (A:420-532) Growth factor receptor-bound | 4e-13 | |
| d1blja_ | 114 | d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mou | 5e-13 | |
| d1r1qa_ | 97 | d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA | 9e-13 | |
| d1rjaa_ | 100 | d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tu | 9e-13 | |
| d1k9aa2 | 101 | d.93.1.1 (A:77-177) Carboxyl-terminal src kinase ( | 3e-12 | |
| d1a81a1 | 129 | d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Hom | 4e-12 | |
| d1jwoa_ | 97 | d.93.1.1 (A:) Csk homologous kinase Chk {Human (Ho | 1e-11 | |
| d1jyra_ | 96 | d.93.1.1 (A:) Growth factor receptor-bound protein | 2e-11 | |
| d2oq1a2 | 124 | d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-7 | 6e-11 | |
| d2shpa3 | 108 | d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Hu | 6e-11 | |
| d1i3za_ | 103 | d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat | 8e-11 | |
| d2shpa2 | 109 | d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Huma | 1e-10 | |
| d2c9wa2 | 103 | d.93.1.1 (A:32-134) Suppressor of cytokine signali | 1e-10 | |
| d1qada_ | 107 | d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a | 1e-10 | |
| d1rpya_ | 86 | d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus nor | 2e-10 | |
| d1d4ta_ | 104 | d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sap | 7e-10 | |
| d1luia_ | 108 | d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mou | 9e-10 | |
| d1mila_ | 104 | d.93.1.1 (A:) Shc adaptor protein {Human (Homo sap | 2e-09 | |
| d1fu6a_ | 111 | d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-a | 2e-09 | |
| d2eyva1 | 109 | d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo | 3e-09 | |
| d1a81a2 | 125 | d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (H | 5e-09 | |
| d1xa6a2 | 141 | d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal dom | 2e-08 | |
| d2cs0a1 | 106 | d.93.1.1 (A:8-113) Hematopoietic SH2 domain contai | 3e-08 | |
| d2izva2 | 112 | d.93.1.1 (A:274-385) Suppressor of cytokine signal | 4e-08 | |
| d1bg1a3 | 141 | d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) | 6e-08 | |
| d2fcia1 | 105 | d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (B | 2e-07 |
| >d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: SH2-like superfamily: SH2 domain family: SH2 domain domain: c-src tyrosine kinase species: Human (Homo sapiens) [TaxId: 9606]
Score = 64.7 bits (157), Expect = 9e-16
Identities = 23/77 (29%), Positives = 36/77 (46%)
Query: 11 SQEPVGAFMVRESTTKPGCFALSLRVPKEFHHLGIAHYLILRTAKGYKIKGFTKEFSSLT 70
++ P G F+VRES T G + LS+ L + HY I + G +F+SL
Sbjct: 24 AENPRGTFLVRESETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQ 83
Query: 71 SLITHHSVMPELLPCTL 87
L+ ++S + L L
Sbjct: 84 QLVAYYSKHADGLCHRL 100
|
| >d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} Length = 131 | Back information, alignment and structure |
|---|
| >d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} Length = 105 | Back information, alignment and structure |
|---|
| >d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 101 | Back information, alignment and structure |
|---|
| >d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 | Back information, alignment and structure |
|---|
| >d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 | Back information, alignment and structure |
|---|
| >d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} Length = 100 | Back information, alignment and structure |
|---|
| >d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 101 | Back information, alignment and structure |
|---|
| >d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 129 | Back information, alignment and structure |
|---|
| >d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} Length = 97 | Back information, alignment and structure |
|---|
| >d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 | Back information, alignment and structure |
|---|
| >d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 | Back information, alignment and structure |
|---|
| >d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 | Back information, alignment and structure |
|---|
| >d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} Length = 107 | Back information, alignment and structure |
|---|
| >d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 86 | Back information, alignment and structure |
|---|
| >d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 108 | Back information, alignment and structure |
|---|
| >d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 111 | Back information, alignment and structure |
|---|
| >d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} Length = 109 | Back information, alignment and structure |
|---|
| >d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 141 | Back information, alignment and structure |
|---|
| >d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} Length = 106 | Back information, alignment and structure |
|---|
| >d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 | Back information, alignment and structure |
|---|
| >d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} Length = 141 | Back information, alignment and structure |
|---|
| >d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} Length = 105 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 97 | |||
| d1jwoa_ | 97 | Csk homologous kinase Chk {Human (Homo sapiens) [T | 99.97 | |
| d1k9aa2 | 101 | Carboxyl-terminal src kinase (csk) {Human (Homo sa | 99.96 | |
| d1rjaa_ | 100 | Tyrosine-protein kinase 6 (Breast tumor kinase, Br | 99.96 | |
| d1qcfa2 | 103 | Hemopoetic cell kinase Hck {Human (Homo sapiens) [ | 99.96 | |
| d1opka2 | 101 | Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: | 99.96 | |
| d1a81a1 | 129 | Syk tyrosine kinase {Human (Homo sapiens) [TaxId: | 99.96 | |
| d1lkka_ | 105 | p56-lck tyrosine kinase {Human (Homo sapiens) [Tax | 99.96 | |
| d2oq1a1 | 130 | Tyrosine-protein kinase zap-70 {Human (Homo sapien | 99.96 | |
| d1o48a_ | 106 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 99.96 | |
| d2oq1a2 | 124 | Tyrosine-protein kinase zap-70 {Human (Homo sapien | 99.95 | |
| d1g83a2 | 104 | Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: | 99.95 | |
| d1blja_ | 114 | P55 Blk protein tyrosine kinase {Mouse (Mus muscul | 99.95 | |
| d1nrva_ | 105 | Growth factor receptor-bound protein 10, GRB10 {Hu | 99.95 | |
| d1i3za_ | 103 | Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus | 99.95 | |
| d1a81a2 | 125 | Syk tyrosine kinase {Human (Homo sapiens) [TaxId: | 99.95 | |
| d2qmsa1 | 113 | Growth factor receptor-bound protein 7 {Human (Hom | 99.94 | |
| d1d4ta_ | 104 | The Xlp protein Sap {Human (Homo sapiens) [TaxId: | 99.94 | |
| d1luia_ | 108 | Itk/tsk protein tyrosine kinase {Mouse (Mus muscul | 99.94 | |
| d2shpa2 | 109 | Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T | 99.94 | |
| d1qada_ | 107 | Phosphatidylinositol 3-kinase, p85-alpha subunit { | 99.93 | |
| d2fcia1 | 105 | Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: | 99.93 | |
| d2cs0a1 | 106 | Hematopoietic SH2 domain containing protein HSH2D | 99.93 | |
| d1r1qa_ | 97 | GRB2-related adaptor protein 2 (MONA, GRID) {Mouse | 99.92 | |
| d2izva2 | 112 | Suppressor of cytokine signaling 4, SOCS-4 {Human | 99.92 | |
| d1jyra_ | 96 | Growth factor receptor-bound protein 2 (GRB2) {Hum | 99.92 | |
| d2shpa3 | 108 | Tyrosine phoshatase shp-2 {Human (Homo sapiens) [T | 99.92 | |
| d2eyva1 | 109 | Crk proto-oncogen {Human (Homo sapiens) [TaxId: 96 | 99.91 | |
| d1mila_ | 104 | Shc adaptor protein {Human (Homo sapiens) [TaxId: | 99.9 | |
| d1fu6a_ | 111 | Phosphatidylinositol 3-kinase, p85-alpha subunit { | 99.89 | |
| d2c9wa2 | 103 | Suppressor of cytokine signaling 2, SOCS-2 {Human | 99.89 | |
| d1rpya_ | 86 | Adaptor protein Aps {Rat (Rattus norvegicus) [TaxI | 99.87 | |
| d1xa6a2 | 141 | Beta-chimaerin, N-terminal domain {Human (Homo sap | 99.82 | |
| d1uura3 | 131 | STAT homologue {Dictyostelium discoideum [TaxId: 4 | 99.62 | |
| d1bg1a3 | 141 | STAT3b {Mouse (Mus musculus) [TaxId: 10090]} | 99.44 | |
| d1bf5a3 | 142 | STAT-1 {Human (Homo sapiens) [TaxId: 9606]} | 98.63 | |
| d3buxb3 | 88 | Cbl {Human (Homo sapiens) [TaxId: 9606]} | 96.35 | |
| d1wlha1 | 101 | F-actin cross-linking gelation factor (ABP-120) re | 89.7 | |
| d2d7na1 | 80 | Filamin C {Human (Homo sapiens) [TaxId: 9606]} | 89.08 | |
| d2di8a1 | 98 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 87.61 | |
| d2d7ma1 | 102 | Filamin C {Human (Homo sapiens) [TaxId: 9606]} | 87.29 | |
| d2dj4a1 | 101 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 86.93 | |
| d1qfha1 | 104 | F-actin cross-linking gelation factor (ABP-120) re | 86.39 | |
| d2w0pa1 | 92 | Filamin a {Human (Homo sapiens) [TaxId: 9606]} | 85.77 | |
| d2diaa1 | 100 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 85.69 | |
| d2diba1 | 115 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 84.48 | |
| d2d7pa1 | 99 | Filamin C {Human (Homo sapiens) [TaxId: 9606]} | 84.15 | |
| d2dica1 | 98 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 83.83 | |
| d2dmca1 | 103 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 82.18 | |
| d1v05a_ | 96 | Filamin C {Human (Homo sapiens) [TaxId: 9606]} | 81.56 | |
| d2di9a1 | 118 | Filamin b {Human (Homo sapiens) [TaxId: 9606]} | 80.88 |
| >d1jwoa_ d.93.1.1 (A:) Csk homologous kinase Chk {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: SH2-like superfamily: SH2 domain family: SH2 domain domain: Csk homologous kinase Chk species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97 E-value=2.2e-30 Score=145.00 Aligned_cols=87 Identities=22% Similarity=0.324 Sum_probs=80.1
Q ss_pred CCHHHHHHHhCCCCCceEEEeecCCCCCeeEEEEEecCCCCCCceeEEEEEEeCCcEEEecccCCCCCHHHHHHHhhhCC
Q psy3300 1 MIQEITLEVLSQEPVGAFMVRESTTKPGCFALSLRVPKEFHHLGIAHYLILRTAKGYKIKGFTKEFSSLTSLITHHSVMP 80 (97)
Q Consensus 1 isr~~ae~~L~~~~~G~fLiR~s~~~~~~~~Ls~~~~~~~~~~~v~h~~I~~~~~~~~l~~~~~~F~sl~~Lv~~y~~~~ 80 (97)
|+|++|+++|++.++|+||||+|++.+|.|+|||+.. +.++||+|...+++|++.+ ...|+||.+||+||+.++
T Consensus 11 isR~eAe~~L~~~~~G~FLVR~S~~~~g~~vLSv~~~-----~~v~H~~I~~~~~~~~~~~-~~~F~sl~~LI~~y~~~~ 84 (97)
T d1jwoa_ 11 ISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFG-----RDVIHYRVLHRDGHLTIDE-AVFFCNLMDMVEHYSKDK 84 (97)
T ss_dssp CCHHHHHHHTCSCCTTCEEEEECSSSTTCEEEEEEET-----TEEEEEEEEESSSEESSTT-SCCBSCHHHHHHHHHHCC
T ss_pred CCHHHHHHHhcCCCCCeEEEEecCCCCccEEEEEEec-----CceEEEEEEEcCCcEEecC-CcccCCHHHHHHHHhhCC
Confidence 7999999999988999999999999999999999985 8999999988777788866 778999999999999999
Q ss_pred CCcceeecCCCCC
Q psy3300 81 ELLPCTLSLHRYN 93 (97)
Q Consensus 81 ~~l~~~L~~p~~~ 93 (97)
++|+|+|+.|+++
T Consensus 85 ~~L~~~L~~P~~k 97 (97)
T d1jwoa_ 85 GAICTKLVRPKRK 97 (97)
T ss_dssp TTSSSCCCCBCCC
T ss_pred CCCCccCCccCcC
Confidence 9999999999864
|
| >d1k9aa2 d.93.1.1 (A:77-177) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjaa_ d.93.1.1 (A:) Tyrosine-protein kinase 6 (Breast tumor kinase, Brk) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qcfa2 d.93.1.1 (A:146-248) Hemopoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1opka2 d.93.1.1 (A:140-240) Abl tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a81a1 d.93.1.1 (A:9-137) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lkka_ d.93.1.1 (A:) p56-lck tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oq1a1 d.93.1.1 (A:5-134) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o48a_ d.93.1.1 (A:) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2oq1a2 d.93.1.1 (A:135-258) Tyrosine-protein kinase zap-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g83a2 d.93.1.1 (A:142-245) Tyrosine kinase Fyn {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1blja_ d.93.1.1 (A:) P55 Blk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1nrva_ d.93.1.1 (A:) Growth factor receptor-bound protein 10, GRB10 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1i3za_ d.93.1.1 (A:) Ews/fli1 activated transcript 2, Eat2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a81a2 d.93.1.1 (A:138-262) Syk tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qmsa1 d.93.1.1 (A:420-532) Growth factor receptor-bound protein 7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d4ta_ d.93.1.1 (A:) The Xlp protein Sap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1luia_ d.93.1.1 (A:) Itk/tsk protein tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2shpa2 d.93.1.1 (A:2-110) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qada_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2fcia1 d.93.1.1 (A:1-105) Phospholipase C-gamma-1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2cs0a1 d.93.1.1 (A:8-113) Hematopoietic SH2 domain containing protein HSH2D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1r1qa_ d.93.1.1 (A:) GRB2-related adaptor protein 2 (MONA, GRID) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2izva2 d.93.1.1 (A:274-385) Suppressor of cytokine signaling 4, SOCS-4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jyra_ d.93.1.1 (A:) Growth factor receptor-bound protein 2 (GRB2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2shpa3 d.93.1.1 (A:111-218) Tyrosine phoshatase shp-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2eyva1 d.93.1.1 (A:12-120) Crk proto-oncogen {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mila_ d.93.1.1 (A:) Shc adaptor protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fu6a_ d.93.1.1 (A:) Phosphatidylinositol 3-kinase, p85-alpha subunit {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2c9wa2 d.93.1.1 (A:32-134) Suppressor of cytokine signaling 2, SOCS-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rpya_ d.93.1.1 (A:) Adaptor protein Aps {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xa6a2 d.93.1.1 (A:21-161) Beta-chimaerin, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uura3 d.93.1.1 (A:577-707) STAT homologue {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1bg1a3 d.93.1.1 (A:576-716) STAT3b {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bf5a3 d.93.1.1 (A:569-710) STAT-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3buxb3 d.93.1.1 (B:264-351) Cbl {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wlha1 b.1.18.10 (A:547-647) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2d7na1 b.1.18.10 (A:8-87) Filamin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2di8a1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d7ma1 b.1.18.10 (A:8-109) Filamin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj4a1 b.1.18.10 (A:8-108) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qfha1 b.1.18.10 (A:646-749) F-actin cross-linking gelation factor (ABP-120) repeats {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2w0pa1 b.1.18.10 (A:2237-2328) Filamin a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2diaa1 b.1.18.10 (A:8-107) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2diba1 b.1.18.10 (A:8-122) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d7pa1 b.1.18.10 (A:8-106) Filamin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dica1 b.1.18.10 (A:8-105) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dmca1 b.1.18.10 (A:8-110) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v05a_ b.1.18.10 (A:) Filamin C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2di9a1 b.1.18.10 (A:8-125) Filamin b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|